[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00379

[Show Plain Result]

#ERROR : Can't open dsspfile "1okcA.bssp"
#ERROR : Can't open dsspfile "2c3eA.bssp"

## Summary of PDB Search
:390
    2e-10  32%  1okcA  [f.42.1] ADP, ATP CARRIER PROTEIN HEART ISOFORM T1
    2e-10  32%  2c3eA  [x.x.x] ADP/ATP TRANSLOCASE 1
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1okcA           ----------------------------------------------------------------------
2c3eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1okcA           ----------------------------------------------------------------------
2c3eA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIWLVKTRLQLDKS
1okcA           --------------------------------------------------------PIERVKLLLQVQ--
2c3eA           --------------------------------------------------------PIERVKLLLQVQ--


                         .         .         .         +         .         .         .:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILXXXXXXXXXDP
1okcA           HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTALNFAFKDKYKQIFLGGVDR-----
2c3eA           HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTALNFAFKDKYKQIFLGGVDR-----


                         .         *         .         .         .         .         +:350
query           AHVRGWTDTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
1okcA           -HKQFW----RYFXXXXXXXXXXXXTSLCFVYPLDFARTRL----AADVGKGAAQREFTGLGNCITKIFK
2c3eA           -HKQFW----RYFXXXXXXXXXXXXTSLCFVYPLDFARTRL----AADVGKGAAQREFTGLGNCITKIFK


                         .         .         .         .         *         .         .:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYExxxxxxxxxx
1okcA           SDGLRGLYQGFNVSVQGIIIYRAAYFGVYD----------
2c3eA           SDGLRGLYQGFNVSVQGIIIYRAAYFGVYD----------