[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00384

[Show Plain Result]

#ERROR : Can't open dsspfile "2qfjB.bssp"
#ERROR : Can't open dsspfile "2qfjA.bssp"
#ERROR : Can't open dsspfile "1fxlA.bssp"
#ERROR : Can't open dsspfile "1rk8A.bssp"
#ERROR : Can't open dsspfile "1oo0B.bssp"
#ERROR : Can't open dsspfile "1hl6A.bssp"
#ERROR : Can't open dsspfile "2dh8A.bssp"
#ERROR : Can't open dsspfile "1x4eA.bssp"

## Summary of PDB Search
:406
    2e-05  37%  2qfjB  [x.x.x] FBP-INTERACTING REPRESSOR
    4e-04  29%  2qfjA  [x.x.x] FBP-INTERACTING REPRESSOR
    4e-04  30%  1fxlA  [d.58.7 - d.58.7] PARANEOPLASTIC ENCEPHALOMYELITIS ANTIGEN
    5e-04  33%  1rk8A  [d.58.7] CG8781-PA PROTEIN
    5e-04  33%  1oo0B  [d.58.7] CG8781-PA
    5e-04  33%  1hl6A  [d.58.7] CG8781 PROTEIN
    7e-04  31%  2dh8A  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    9e-04  31%  1x4eA  [x.x.x] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qfjB           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
1x4eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDATSALYISDLYWWTTDDEIRGWINATGCEGELKD
2qfjB           --------------------------------------SRVYVGSIYYELGEDTIR---QAFAPFGPIKS
2qfjA           ------------------------------------AFNRIYVASVHQDLSDDDIKSVFEAFG---KIKS
1fxlA           --------------------------------------------------TQEEFRSLF---GSIGEIES
1rk8A           ----------------------------------------LFVTSIHEEAQEDEIQEKF----CDGEIKN
1oo0B           ----------------------------------------LFVTSIHEEAQEDEIQEKF----CDGEIKN
1hl6A           ----------------------------------------LFVTSIHEEAQEDEIQEKF----CDGEIKN
2dh8A           -----------------------------------DEIGKLFVGGLDWSTTQETLRSYFSQYG---EVVD
1x4eA           -------------------------------------SSGLYIRGLQPGTTDQDL---VKLCQPYGKIVS


                         +         .         .         .         .         *         .:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRxxxxxxxxxxx
2qfjB           IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
2qfjA           ATLARDPTTGKHKGYGFIEYEKAQSSQDA---VSSMN---------------------------------
1fxlA           CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
1rk8A           IHLNLDRRTGFSKGYALVEYETHKQALAAK---EALNGAEIMGQTIQVDW--------------------
1oo0B           IHLNLDRRTGFSKGYALVEYETHKQALAAK---EALNGAEIMGQTIQVDW--------------------
1hl6A           IHLNLDRRTGFSKGYALVEYETHKQALAAK---EALNGAEIMGQTIQVDW--------------------
2dh8A           CVIMKDKTTNQSRGFGFVKFKDP-----------------------------------------------
1x4eA           TKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQ-------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qfjB           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
1x4eA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qfjB           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
1x4eA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qfjB           --------------------------------------------------------
2qfjA           --------------------------------------------------------
1fxlA           --------------------------------------------------------
1rk8A           --------------------------------------------------------
1oo0B           --------------------------------------------------------
1hl6A           --------------------------------------------------------
2dh8A           --------------------------------------------------------
1x4eA           --------------------------------------------------------