[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00411

[Show Plain Result]

#ERROR : Can't open dsspfile "1r0dB.bssp"
#ERROR : Can't open dsspfile "1r0dA.bssp"
#ERROR : Can't open dsspfile "2jswA.bssp"
#ERROR : Can't open dsspfile "1hx8B.bssp"

## Summary of PDB Search
:1056
    2e-25  43%  1r0dB  [a.216.1] HUNTINGTIN INTERACTING PROTEIN 12
    2e-25  43%  1r0dA  [a.216.1] HUNTINGTIN INTERACTING PROTEIN 12
    1e-16  43%  2jswA  [x.x.x] TALIN-1
    3e-04  32%  1hx8B  [a.118.9 - a.7.8] SYNAPSE-ENRICHED CLATHRIN ADAPTOR PROTEIN
:1056

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ---------------------LAKSVCKATTEECIGPKKKHLDYLVHCANEPNVSIPHLANLLIESQNAN


                         .         .         *         .         .         .         .:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           WVVVYKSLITTHHLMAYGNERFMQXXXXXXXXXDKGTMGVPG-GRMGYSPFIRRYAKYLEKSLSYRAMAF


                         +         .         .         .         .         *         .:210
query           EFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           DFCKVKEG----SLRSMN----AEKLLKTLPVLQAQLDA-------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           ----------------------------------------------------------------------
1r0dA           ----------------------------------------------------------------------
2jswA           ----------------------------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
1r0dB           -----------RHASSGVKLEVNERILN-SCTDLKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSR
1r0dA           -----------RHASSGVKLEVNERILN-SCTDLKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSR
2jswA           -----------------------------------------------QRELVAQGKGAIPANAL--DDGQ
1hx8B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
1r0dB           WTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQE
1r0dA           WTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQE
2jswA           WSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQA
1hx8B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ASKAVGAACRALVRQVQAIIAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dB           CSRTVNERAANVVASTKS----------------------------------------------------
1r0dA           CSRTVNERAANVVASTKS----------------------------------------------------
2jswA           AGNAVKRASDNLVKAAQKAAA-------------------------------------------------
1hx8B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxx
1r0dB           ------
1r0dA           ------
2jswA           ------
1hx8B           ------