[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00429

[Show Plain Result]

#ERROR : Can't open dsspfile "1id3F.bssp"
#ERROR : Can't open dsspfile "1id3B.bssp"
#ERROR : Can't open dsspfile "1p3oF.bssp"
#ERROR : Can't open dsspfile "1p3oB.bssp"
#ERROR : Can't open dsspfile "2hioD.bssp"
#ERROR : Can't open dsspfile "1zbbF.bssp"
#ERROR : Can't open dsspfile "1zbbB.bssp"
#ERROR : Can't open dsspfile "1tzyH.bssp"
#ERROR : Can't open dsspfile "1tzyD.bssp"
#ERROR : Can't open dsspfile "1s32F.bssp"
#ERROR : Can't open dsspfile "1p3aF.bssp"
#ERROR : Can't open dsspfile "1p34F.bssp"
#ERROR : Can't open dsspfile "1m1aF.bssp"
#ERROR : Can't open dsspfile "1m18B.bssp"
#ERROR : Can't open dsspfile "1kx5B.bssp"
#ERROR : Can't open dsspfile "1kx4F.bssp"
#ERROR : Can't open dsspfile "1kx3B.bssp"
#ERROR : Can't open dsspfile "2io5C.bssp"
#ERROR : Can't open dsspfile "2hueC.bssp"
#ERROR : Can't open dsspfile "1f66F.bssp"
#ERROR : Can't open dsspfile "1f66B.bssp"
#ERROR : Can't open dsspfile "1eqzH.bssp"
#ERROR : Can't open dsspfile "1eqzD.bssp"
#ERROR : Can't open dsspfile "2cv5F.bssp"
#ERROR : Can't open dsspfile "3c1bF.bssp"
#ERROR : Can't open dsspfile "1aoiF.bssp"
#ERROR : Can't open dsspfile "1p3pF.bssp"
#ERROR : Can't open dsspfile "1p3pB.bssp"

## Summary of PDB Search
:476
    5e-05  40%  1id3F  [a.22.1] HISTONE H4
    5e-05  40%  1id3B  [a.22.1] HISTONE H4
    1e-04  38%  1p3oF  [a.22.1] HISTONE H4
    1e-04  38%  1p3oB  [a.22.1] HISTONE H4
    2e-04  37%  2hioD  [a.22.1] PROTEIN (HISTONE H4)
    3e-04  38%  1zbbF  [x.x.x] HISTONE H4
    3e-04  38%  1zbbB  [x.x.x] HISTONE H4
    3e-04  38%  1tzyH  [a.22.1] HISTONE H4-VI
    3e-04  38%  1tzyD  [a.22.1] HISTONE H4-VI
    3e-04  38%  1s32F  [a.22.1] HISTONE H4
    3e-04  38%  1p3aF  [a.22.1] HISTONE H4
    3e-04  38%  1p34F  [a.22.1] HISTONE H4
    3e-04  38%  1m1aF  [a.22.1] HISTONE H4
    3e-04  38%  1m18B  [a.22.1] HISTONE H4
    3e-04  38%  1kx5B  [a.22.1] HISTONE H4
    3e-04  38%  1kx4F  [a.22.1] HISTONE H4
    3e-04  38%  1kx3B  [a.22.1] HISTONE H4
    3e-04  38%  2io5C  [x.x.x] HISTONE H4
    3e-04  38%  2hueC  [x.x.x] HISTONE H4
    3e-04  38%  1f66F  [a.22.1] HISTONE H4
    3e-04  38%  1f66B  [a.22.1] HISTONE H4
    3e-04  38%  1eqzH  [a.22.1] PROTEIN (HISTONE H4)
    3e-04  38%  1eqzD  [a.22.1] PROTEIN (HISTONE H4)
    3e-04  38%  2cv5F  [x.x.x] HISTONE H4
    3e-04  38%  3c1bF  [x.x.x] HISTONE H4
    3e-04  38%  1aoiF  [a.22.1] HISTONE H4
    3e-04  38%  1p3pF  [a.22.1] HISTONE H4
    3e-04  38%  1p3pB  [a.22.1] HISTONE H4
:476

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           ----------------------------------------------------------------------
1id3B           ----------------------------------------------------------------------
1p3oF           ----------------------------------------------------------------------
1p3oB           ----------------------------------------------------------------------
2hioD           ----------------------------------------------------------------------
1zbbF           ----------------------------------------------------------------------
1zbbB           ----------------------------------------------------------------------
1tzyH           ----------------------------------------------------------------------
1tzyD           ----------------------------------------------------------------------
1s32F           ----------------------------------------------------------------------
1p3aF           ----------------------------------------------------------------------
1p34F           ----------------------------------------------------------------------
1m1aF           ----------------------------------------------------------------------
1m18B           ----------------------------------------------------------------------
1kx5B           ----------------------------------------------------------------------
1kx4F           ----------------------------------------------------------------------
1kx3B           ----------------------------------------------------------------------
2io5C           ----------------------------------------------------------------------
2hueC           ----------------------------------------------------------------------
1f66F           ----------------------------------------------------------------------
1f66B           ----------------------------------------------------------------------
1eqzH           ----------------------------------------------------------------------
1eqzD           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
1p3pF           ----------------------------------------------------------------------
1p3pB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           ----------------------------------------------------------------------
1id3B           ----------------------------------------------------------------------
1p3oF           ----------------------------------------------------------------------
1p3oB           ----------------------------------------------------------------------
2hioD           ----------------------------------------------------------------------
1zbbF           ----------------------------------------------------------------------
1zbbB           ----------------------------------------------------------------------
1tzyH           ----------------------------------------------------------------------
1tzyD           ----------------------------------------------------------------------
1s32F           ----------------------------------------------------------------------
1p3aF           ----------------------------------------------------------------------
1p34F           ----------------------------------------------------------------------
1m1aF           ----------------------------------------------------------------------
1m18B           ----------------------------------------------------------------------
1kx5B           ----------------------------------------------------------------------
1kx4F           ----------------------------------------------------------------------
1kx3B           ----------------------------------------------------------------------
2io5C           ----------------------------------------------------------------------
2hueC           ----------------------------------------------------------------------
1f66F           ----------------------------------------------------------------------
1f66B           ----------------------------------------------------------------------
1eqzH           ----------------------------------------------------------------------
1eqzD           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
1p3pF           ----------------------------------------------------------------------
1p3pB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           ----------------------------------------------------------------------
1id3B           ----------------------------------------------------------------------
1p3oF           ----------------------------------------------------------------------
1p3oB           ----------------------------------------------------------------------
2hioD           ----------------------------------------------------------------------
1zbbF           ----------------------------------------------------------------------
1zbbB           ----------------------------------------------------------------------
1tzyH           ----------------------------------------------------------------------
1tzyD           ----------------------------------------------------------------------
1s32F           ----------------------------------------------------------------------
1p3aF           ----------------------------------------------------------------------
1p34F           ----------------------------------------------------------------------
1m1aF           ----------------------------------------------------------------------
1m18B           ----------------------------------------------------------------------
1kx5B           ----------------------------------------------------------------------
1kx4F           ----------------------------------------------------------------------
1kx3B           ----------------------------------------------------------------------
2io5C           ----------------------------------------------------------------------
2hueC           ----------------------------------------------------------------------
1f66F           ----------------------------------------------------------------------
1f66B           ----------------------------------------------------------------------
1eqzH           ----------------------------------------------------------------------
1eqzD           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
1p3pF           ----------------------------------------------------------------------
1p3pB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           ----------------------------------------------------------------------
1id3B           ----------------------------------------------------------------------
1p3oF           ----------------------------------------------------------------------
1p3oB           ----------------------------------------------------------------------
2hioD           ----------------------------------------------------------------------
1zbbF           ----------------------------------------------------------------------
1zbbB           ----------------------------------------------------------------------
1tzyH           ----------------------------------------------------------------------
1tzyD           ----------------------------------------------------------------------
1s32F           ----------------------------------------------------------------------
1p3aF           ----------------------------------------------------------------------
1p34F           ----------------------------------------------------------------------
1m1aF           ----------------------------------------------------------------------
1m18B           ----------------------------------------------------------------------
1kx5B           ----------------------------------------------------------------------
1kx4F           ----------------------------------------------------------------------
1kx3B           ----------------------------------------------------------------------
2io5C           ----------------------------------------------------------------------
2hueC           ----------------------------------------------------------------------
1f66F           ----------------------------------------------------------------------
1f66B           ----------------------------------------------------------------------
1eqzH           ----------------------------------------------------------------------
1eqzD           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
1p3pF           ----------------------------------------------------------------------
1p3pB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           ----------------------------------------------------------------------
1id3B           ----------------------------------------------------------------------
1p3oF           ----------------------------------------------------------------------
1p3oB           ----------------------------------------------------------------------
2hioD           ----------------------------------------------------------------------
1zbbF           ----------------------------------------------------------------------
1zbbB           ----------------------------------------------------------------------
1tzyH           ----------------------------------------------------------------------
1tzyD           ----------------------------------------------------------------------
1s32F           ----------------------------------------------------------------------
1p3aF           ----------------------------------------------------------------------
1p34F           ----------------------------------------------------------------------
1m1aF           ----------------------------------------------------------------------
1m18B           ----------------------------------------------------------------------
1kx5B           ----------------------------------------------------------------------
1kx4F           ----------------------------------------------------------------------
1kx3B           ----------------------------------------------------------------------
2io5C           ----------------------------------------------------------------------
2hueC           ----------------------------------------------------------------------
1f66F           ----------------------------------------------------------------------
1f66B           ----------------------------------------------------------------------
1eqzH           ----------------------------------------------------------------------
1eqzD           ----------------------------------------------------------------------
2cv5F           ----------------------------------------------------------------------
3c1bF           ----------------------------------------------------------------------
1aoiF           ----------------------------------------------------------------------
1p3pF           ----------------------------------------------------------------------
1p3pB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
1id3F           ---------------------------QGITKPAIRRLARRGGVKRISIYEEVRAVLKS----FLESVIR
1id3B           ---------------------------QGITKPAIRRLARRGGVKRISIYEEVRAVLKS----FLESVIR
1p3oF           ---------------------------QGITKPAIRRLARRGGAKRISIYEETRGVLKV----FLENVIR
1p3oB           ---------------------------QGITKPAIRRLARRGGAKRISIYEETRGVLKV----FLENVIR
2hioD           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1zbbF           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1zbbB           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1tzyH           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1tzyD           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1s32F           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1p3aF           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1p34F           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1m1aF           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1m18B           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1kx5B           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1kx4F           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1kx3B           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
2io5C           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
2hueC           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1f66F           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1f66B           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1eqzH           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1eqzD           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
2cv5F           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
3c1bF           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1aoiF           ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
1p3pF           ---------------------------QGITKPAIRRLARRGGIKRISIYEETRGVLKV----FLENVIR
1p3pB           ---------------------------QGITKPAIRRLARRGGIKRISIYEETRGVLKV----FLENVIR


                         .         .         +         .         .         .         .:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1id3F           DSVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
1id3B           DSVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
1p3oF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1p3oB           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
2hioD           DAVTYTEHAKRKTVTAMDVVYALKRQER----------------------------
1zbbF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1zbbB           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1tzyH           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1tzyD           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1s32F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1p3aF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1p34F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1m1aF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1m18B           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1kx5B           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1kx4F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1kx3B           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
2io5C           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
2hueC           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1f66F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1f66B           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1eqzH           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1eqzD           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
2cv5F           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
3c1bF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1aoiF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1p3pF           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1p3pB           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------