[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00742

[Show Plain Result]

#ERROR : Can't open dsspfile "1ci0B.bssp"
#ERROR : Can't open dsspfile "1ci0A.bssp"
#ERROR : Can't open dsspfile "2a2jA.bssp"
#ERROR : Can't open dsspfile "1g76A.bssp"
#ERROR : Can't open dsspfile "1nrgA.bssp"
#ERROR : Can't open dsspfile "3hy8A.bssp"
#ERROR : Can't open dsspfile "1jnwA.bssp"
#ERROR : Can't open dsspfile "1dnlA.bssp"
#ERROR : Can't open dsspfile "1wv4A.bssp"
#ERROR : Can't open dsspfile "1wv4B.bssp"
#ERROR : Can't open dsspfile "1t9mA.bssp"
#ERROR : Can't open dsspfile "1ty9B.bssp"
#ERROR : Can't open dsspfile "1ty9A.bssp"
#ERROR : Can't open dsspfile "1wv4B.bssp"

## Summary of PDB Search
:241
    3e-36  53%  1ci0B  [b.45.1] PROTEIN (PNP OXIDASE)
    3e-36  53%  1ci0A  [b.45.1] PROTEIN (PNP OXIDASE)
    5e-28  50%  2a2jA  [x.x.x] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    8e-26  50%  1g76A  [b.45.1] PYRIDOXINE 5`-PHOSPHATE OXIDASE
    3e-23  44%  1nrgA  [b.45.1] PYRIDOXINE 5'-PHOSPHATE OXIDASE
    1e-22  44%  3hy8A  [x.x.x] PYRIDOXINE-5'-PHOSPHATE OXIDASE
    2e-22  51%  1jnwA  [b.45.1] PYRIDOXINE 5'-PHOSPHATE OXIDASE
    2e-22  51%  1dnlA  [b.45.1] PYRIDOXINE 5'-PHOSPHATE OXIDASE
    2e-09  56%  1wv4A  [b.45.1] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    3e-09  62%  1wv4B  [b.45.1] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    1e-07  35%  1t9mA  [b.45.1] PROBABLE PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    2e-07  32%  1ty9B  [b.45.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZG
    2e-07  32%  1ty9A  [b.45.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZG
    2e-06  45%  1wv4B  [b.45.1] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE(query 4->107)
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNXXXXXXXXXXXXSVIPDDGQGKL
1ci0B           LPSGRVSSRILLFKELDHRGFTIYSNWGT----------SRKAHDIAT----------------------
1ci0A           LPSGRVSSRILLFKELDHRGFTIYSNWGT----------SRKAHDIAT----------------------
2a2jA           ----------------------------------------------------------------------
1g76A           ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
1nrgA           ---GKPSARMLLLKGFGKDGFRFFTNFESRKGK-----------------------------------EL
3hy8A           ---GKPSARMLLLKGFGKDGFRFFTNFESRKGK-----------------------------------EL
1jnwA           ---GQPYQRIVLLKHYDEKG-VFYTNLGSRKAH-----------------------------------QI
1dnlA           ---GQPYQRIVLLKHYDEKG-VFYTNLGSRKAH-----------------------------------QI
1wv4A           ----------------------------------------------------------------------
1wv4B           ----------------------------------------------------------------------
1t9mA           ---GRPSTRIVVIAELGERGVVFATHADSQKGR-----------------------------------EL
1ty9B           ---GRPSTRIVVISEISDAGVVFSTHAGSQKGR-----------------------------------EL
1ty9A           ---GRPSTRIVVISEISDAGVVFSTHAGSQKGR-----------------------------------EL
1wv4B           ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI


                         .         .         *         .         .         .         .:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
1ci0B           --NPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVI-------------
1ci0A           --NPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVI-------------
2a2jA           ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
1g76A           ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
1nrgA           DSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVI-------------
3hy8A           DSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVI-------------
1jnwA           ENNPRVSLLFPWHTLERQV-VIGKAERLSTLEVK-YFHSRPRDSQIGAWVSKQS----------------
1dnlA           ENNPRVSLLFPWHTLERQV-VIGKAERLSTLEVK-YFHSRPRDSQIGAWVSKQS----------------
1wv4A           ----------------------------------------------------------------------
1wv4B           ----------------------------------------------------------------------
1t9mA           AQNPWASGVLYWRESSQQIILNGRAERLPDERADAQWLSRPYQTHPMSIASRQSETL-------------
1ty9B           LHNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSE--------ELQDVQA
1ty9A           LHNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSE--------ELQDVQA
1wv4B           ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMSFW---------------------------------


                         +         .         .         .         .         *         .:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
1ci0B           -------------------KNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
1ci0A           -------------------KNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
2a2jA           ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
1g76A           -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
1nrgA           -------------------PDREYLRKKNEELEQLYQD-QEVPKPKSWGGYVLYPQVMEFWQGQTNRLHD
3hy8A           -------------------PDREYLRKKNEELEQLYQD-QEVPKPKSWGGYVLYPQVMEFWQGQTNRLHD
1jnwA           -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
1dnlA           -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
1wv4A           --------------------------------------TLEVMKYSFWGGFRVSLEQIEFWQGGEHRLHD
1wv4B           ----------------------------------------------FWGGFRVSLEQIEFWQGGEHRLHD
1t9mA           ---ADIHXXXXXXXXXXXTDG-------------------PLPRPPGYCLFELCLESVEFWGNGTERLHE
1ty9B           MRNAARQLAELQGP---------------------------LPRPEGYCVFELRLESLEFWGNGQERLHE
1ty9A           MRNAARQLAELQGP---------------------------LPRPEGYCVFELRLESLEFWGNGQERLHE
1wv4B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP
1ci0B           RFVY-RRKTEND----------PWKVVRLAP
1ci0A           RFVY-RRKTEND----------PWKVVRLAP
2a2jA           RIRV--ANGRLERLQPG--------------
1g76A           RFLYQR---END----------AWKIDRLAP
1nrgA           RIVFRRPLGPMTHRGEED-----WLYERLAP
3hy8A           WIVFRRPLGPMTHRGEED-----WLYERLAP
1jnwA           RFLYQR---END----------AWKIDRLAP
1dnlA           RFLYQR---END----------AWKIDRLAP
1wv4A           RFLYQR---END----------AWKIDRLAP
1wv4B           RFLYQR---END----------AWKIDRLAP
1t9mA           RLRYDRDEGGWKH------------------
1ty9B           RLRY-------------DRSDTGWNVRRLQP
1ty9A           RLRY-------------DRSDTGWNVRRLQP
1wv4B           -------------------------------