[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_01208

[Show Plain Result]

#ERROR : Can't open dsspfile "1ymkA.bssp"
#ERROR : Can't open dsspfile "1qb0A.bssp"
#ERROR : Can't open dsspfile "1cwsA.bssp"
#ERROR : Can't open dsspfile "2uzqA.bssp"
#ERROR : Can't open dsspfile "2a2kA.bssp"
#ERROR : Can't open dsspfile "2ifdA.bssp"
#ERROR : Can't open dsspfile "2ifvA.bssp"
#ERROR : Can't open dsspfile "1ymdA.bssp"
#ERROR : Can't open dsspfile "1c25A.bssp"
#ERROR : Can't open dsspfile "2j6pA.bssp"

## Summary of PDB Search
:551
    8e-32  48%  1ymkA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    2e-31  48%  1qb0A  [c.46.1] PROTEIN (M-PHASE INDUCER PHOSPHATASE 2 (CDC25B))
    2e-31  48%  1cwsA  [c.46.1] CDC25 B-TYPE TYROSINE PHOSPHATASE
    4e-31  48%  2uzqA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    1e-30  47%  2a2kA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    1e-30  47%  2ifdA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    6e-30  47%  2ifvA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    1e-29  44%  1ymdA  [x.x.x] M-PHASE INDUCER PHOSPHATASE 2
    5e-29  43%  1c25A  [x.x.x] CDC25A
    2e-04  34%  2j6pA  [x.x.x] SB(V)-AS(V) REDUCTASE
:551

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ymkA           ----------------------------------------------------------------------
1qb0A           ----------------------------------------------------------------------
1cwsA           ----------------------------------------------------------------------
2uzqA           ----------------------------------------------------------------------
2a2kA           ----------------------------------------------------------------------
2ifdA           ----------------------------------------------------------------------
2ifvA           ----------------------------------------------------------------------
1ymdA           ----------------------------------------------------------------------
1c25A           ----------------------------------------------------------------------
2j6pA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ymkA           ----------------------------------------------------------------------
1qb0A           ----------------------------------------------------------------------
1cwsA           ----------------------------------------------------------------------
2uzqA           ----------------------------------------------------------------------
2a2kA           ----------------------------------------------------------------------
2ifdA           ----------------------------------------------------------------------
2ifvA           ----------------------------------------------------------------------
1ymdA           ----------------------------------------------------------------------
1c25A           ----------------------------------------------------------------------
2j6pA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ymkA           ----------------------------------------------------------------------
1qb0A           ----------------------------------------------------------------------
1cwsA           ----------------------------------------------------------------------
2uzqA           ----------------------------------------------------------------------
2a2kA           ----------------------------------------------------------------------
2ifdA           ----------------------------------------------------------------------
2ifvA           ----------------------------------------------------------------------
1ymdA           ----------------------------------------------------------------------
1c25A           ----------------------------------------------------------------------
2j6pA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ymkA           ----------------------------------------------------------------------
1qb0A           ----------------------------------------------------------------------
1cwsA           ----------------------------------------------------------------------
2uzqA           ----------------------------------------------------------------------
2a2kA           ----------------------------------------------------------------------
2ifdA           ----------------------------------------------------------------------
2ifvA           ----------------------------------------------------------------------
1ymdA           ----------------------------------------------------------------------
1c25A           ----------------------------------------------------------------------
2j6pA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDGPDQLPRVES
1ymkA           -----------------------------------------------------------DGKHQLKYISP
1qb0A           -----------------------------------------------------------DGKHQLKYISP
1cwsA           -----------------------------------------------------------DGKHQLKYISP
2uzqA           -----------------------------------------------------------DGKHQLKYISP
2a2kA           -----------------------------------------------------------DGKHQLKYISP
2ifdA           -----------------------------------------------------------DGKHQLKYISP
2ifvA           -----------------------------------------------------------DGKHQLKYISP
1ymdA           -----------------------------------------------------------DGKHQLKYISP
1c25A           ----------------------------------------------------------------LKYISP
2j6pA           -------------------------------------------------------------------IKP


                         .         .         .         .         *         .         .:420
query           SVLVDIINGKYNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
1ymkA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPKRVLIFHCEFSSE
1qb0A           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHCEFSSE
1cwsA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHCEFSSE
2uzqA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHCEFSSE
2a2kA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPKRVLIFHSEFSSE
2ifdA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHCEFSSE
2ifvA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHDEFSSE
1ymdA           ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPKRVILIFHEFSSE
1c25A           EIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTVIVVFHCEFSSE
2j6pA           EELVELLDNP--DSLVKAAVIDCR-DSDRDCGFIVNSINMTEEEKLAKTLFEEKKELA---VFHCAQSLV


                         .         .         +         .         .         .         .:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEHEFACERGLGK
1ymkA           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
1qb0A           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
1cwsA           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
2uzqA           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN--------------
2a2kA           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
2ifdA           RGPRMCRFIRERDLAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
2ifvA           RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
1ymdA           RGPRMCRFIRERDRAVN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
1c25A           RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPM---------------
2j6pA           RAPKGANRFALAQK--------KLGYPAVYVLRGGWEAFY------------------------------


                         *         .         .         .         .         +         .:560
query           VKQRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ymkA           LKTRS--------------------------------------------------------
1qb0A           LKTRS--------------------------------------------------------
1cwsA           LKTRS--------------------------------------------------------
2uzqA           -------------------------------------------------------------
2a2kA           LKTRS--------------------------------------------------------
2ifdA           LKTRS--------------------------------------------------------
2ifvA           LKTRS--------------------------------------------------------
1ymdA           LKTRS--------------------------------------------------------
1c25A           -------------------------------------------------------------
2j6pA           -------------------------------------------------------------