[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_01223

[Show Plain Result]

#ERROR : Can't open dsspfile "2dgoA.bssp"
#ERROR : Can't open dsspfile "2dh7A.bssp"
#ERROR : Can't open dsspfile "1x5sA.bssp"
#ERROR : Can't open dsspfile "3bs9A.bssp"
#ERROR : Can't open dsspfile "2jrsA.bssp"
#ERROR : Can't open dsspfile "2dhgA.bssp"
#ERROR : Can't open dsspfile "1p1tA.bssp"
#ERROR : Can't open dsspfile "2dnzA.bssp"
#ERROR : Can't open dsspfile "2d9pA.bssp"
#ERROR : Can't open dsspfile "2cqdA.bssp"
#ERROR : Can't open dsspfile "2e5hA.bssp"
#ERROR : Can't open dsspfile "2fy1A.bssp"
#ERROR : Can't open dsspfile "1l3kA.bssp"
#ERROR : Can't open dsspfile "2cjkA.bssp"
#ERROR : Can't open dsspfile "1up1A.bssp"
#ERROR : Can't open dsspfile "1u1pA.bssp"
#ERROR : Can't open dsspfile "1ha1A.bssp"
#ERROR : Can't open dsspfile "1uawA.bssp"
#ERROR : Can't open dsspfile "2dh8A.bssp"
#ERROR : Can't open dsspfile "2cpzA.bssp"
#ERROR : Can't open dsspfile "1sxlA.bssp"
#ERROR : Can't open dsspfile "1b7fA.bssp"
#ERROR : Can't open dsspfile "2qfjB.bssp"
#ERROR : Can't open dsspfile "2qfjA.bssp"
#ERROR : Can't open dsspfile "1fnxH.bssp"
#ERROR : Can't open dsspfile "1d8zA.bssp"
#ERROR : Can't open dsspfile "2g4bA.bssp"
#ERROR : Can't open dsspfile "3sxlA.bssp"
#ERROR : Can't open dsspfile "1cvjH.bssp"
#ERROR : Can't open dsspfile "1cvjG.bssp"
#ERROR : Can't open dsspfile "1cvjF.bssp"
#ERROR : Can't open dsspfile "1cvjD.bssp"
#ERROR : Can't open dsspfile "1cvjC.bssp"
#ERROR : Can't open dsspfile "1cvjB.bssp"
#ERROR : Can't open dsspfile "1cvjA.bssp"
#ERROR : Can't open dsspfile "1x5tA.bssp"
#ERROR : Can't open dsspfile "1x4bA.bssp"
#ERROR : Can't open dsspfile "2dguA.bssp"
#ERROR : Can't open dsspfile "1x4gA.bssp"
#ERROR : Can't open dsspfile "2u2fA.bssp"
#ERROR : Can't open dsspfile "1u6fA.bssp"
#ERROR : Can't open dsspfile "2k8gA.bssp"
#ERROR : Can't open dsspfile "2cq0A.bssp"
#ERROR : Can't open dsspfile "1whwA.bssp"
#ERROR : Can't open dsspfile "1x4eA.bssp"
#ERROR : Can't open dsspfile "1fxlA.bssp"
#ERROR : Can't open dsspfile "2cqbA.bssp"
#ERROR : Can't open dsspfile "2cpfA.bssp"
#ERROR : Can't open dsspfile "2dk2A.bssp"
#ERROR : Can't open dsspfile "1hd0A.bssp"
#ERROR : Can't open dsspfile "3h2uD.bssp"
#ERROR : Can't open dsspfile "3h2uB.bssp"
#ERROR : Can't open dsspfile "2mssA.bssp"
#ERROR : Can't open dsspfile "2dnmA.bssp"
#ERROR : Can't open dsspfile "2errA.bssp"
#ERROR : Can't open dsspfile "2cq3A.bssp"
#ERROR : Can't open dsspfile "2sxlA.bssp"
#ERROR : Can't open dsspfile "2cpjA.bssp"
#ERROR : Can't open dsspfile "2fc8A.bssp"
#ERROR : Can't open dsspfile "2cqcA.bssp"
#ERROR : Can't open dsspfile "2cq4A.bssp"
#ERROR : Can't open dsspfile "2i2yA.bssp"
#ERROR : Can't open dsspfile "2dnkA.bssp"
#ERROR : Can't open dsspfile "2cqgA.bssp"
#ERROR : Can't open dsspfile "2dngA.bssp"
#ERROR : Can't open dsspfile "1wtbA.bssp"
#ERROR : Can't open dsspfile "1iqtA.bssp"
#ERROR : Can't open dsspfile "1x5uA.bssp"
#ERROR : Can't open dsspfile "1rk8A.bssp"
#ERROR : Can't open dsspfile "1oo0B.bssp"
#ERROR : Can't open dsspfile "1n54B.bssp"
#ERROR : Can't open dsspfile "1n52B.bssp"
#ERROR : Can't open dsspfile "2i38A.bssp"
#ERROR : Can't open dsspfile "1hl6A.bssp"
#ERROR : Can't open dsspfile "1h2vZ.bssp"
#ERROR : Can't open dsspfile "1h2uY.bssp"
#ERROR : Can't open dsspfile "1h2uX.bssp"
#ERROR : Can't open dsspfile "1h2tZ.bssp"
#ERROR : Can't open dsspfile "2fc9A.bssp"
#ERROR : Can't open dsspfile "2dgsA.bssp"
#ERROR : Can't open dsspfile "2cpdA.bssp"

## Summary of PDB Search
:252
    3e-13  40%  2dgoA  [x.x.x] CYTOTOXIC GRANULE-ASSOCIATED RNA BINDING PROTEIN
    8e-13  40%  2dh7A  [x.x.x] NUCLEOLYSIN TIAR
    1e-10  33%  1x5sA  [x.x.x] COLD-INDUCIBLE RNA-BINDING PROTEIN
    8e-10  36%  3bs9A  [x.x.x] NUCLEOLYSIN TIA-1 ISOFORM P40
    1e-09  32%  2jrsA  [x.x.x] RNA-BINDING PROTEIN 39
    1e-09  45%  2dhgA  [x.x.x] TRNA SELENOCYSTEINE ASSOCIATED PROTEIN (SECP43)
    5e-09  35%  1p1tA  [d.58.7] CLEAVAGE STIMULATION FACTOR, 64 KDA SUBUNIT
    7e-09  33%  2dnzA  [x.x.x] PROBABLE RNA-BINDING PROTEIN 23
    9e-09  36%  2d9pA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 3
    9e-09  38%  2cqdA  [x.x.x] RNA-BINDING REGION CONTAINING PROTEIN 1
    3e-08  33%  2e5hA  [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-
    4e-08  32%  2fy1A  [x.x.x] RNA-BINDING MOTIF PROTEIN, Y CHROMOSOME, FAMILY
    8e-08  31%  1l3kA  [d.58.7 - d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    1e-07  33%  2cjkA  [x.x.x] NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN 4
    1e-07  38%  1up1A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    1e-07  38%  1u1pA  [d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    1e-07  38%  1ha1A  [x.x.x] HNRNP A1
    3e-07  36%  1uawA  [d.58.7] MOUSE-MUSASHI-1
    3e-07  40%  2dh8A  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    9e-07  37%  2cpzA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
    1e-06  33%  1sxlA  [x.x.x] SEX-LETHAL PROTEIN PROTEIN
    1e-06  33%  1b7fA  [d.58.7 - d.58.7] PROTEIN (SXL-LETHAL PROTEIN)
    1e-06  25%  2qfjB  [x.x.x] FBP-INTERACTING REPRESSOR
    1e-06  25%  2qfjA  [x.x.x] FBP-INTERACTING REPRESSOR
    1e-06  32%  1fnxH  [d.58.7 - d.58.7] HU ANTIGEN C
    1e-06  32%  1d8zA  [d.58.7] HU ANTIGEN C
    2e-06  26%  2g4bA  [x.x.x] SPLICING FACTOR U2AF 65 KDA SUBUNIT
    3e-06  37%  3sxlA  [d.58.7 - d.58.7] PROTEIN (SEX-LETHAL)
    3e-06  36%  1cvjH  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjG  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjF  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjD  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjC  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjB  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  36%  1cvjA  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-06  31%  1x5tA  [x.x.x] SPLICING FACTOR 3B SUBUNIT 4
    3e-06  38%  1x4bA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
    3e-06  42%  2dguA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Q
    4e-06  33%  1x4gA  [x.x.x] NUCLEOLYSIN TIAR
    6e-06  26%  2u2fA  [d.58.7] PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
    1e-05  30%  1u6fA  [x.x.x] RNA-BINDING PROTEIN UBP1
    1e-05  32%  2k8gA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 1
    1e-05  33%  2cq0A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3
    1e-05  34%  1whwA  [d.58.7] HYPOTHETICAL PROTEIN RIKEN CDNA 1200009A02
    2e-05  40%  1x4eA  [x.x.x] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    2e-05  29%  1fxlA  [d.58.7 - d.58.7] PARANEOPLASTIC ENCEPHALOMYELITIS ANTIGEN
    2e-05  37%  2cqbA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    2e-05  27%  2cpfA  [x.x.x] RNA BINDING MOTIF PROTEIN 19
    2e-05  44%  2dk2A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN R
    4e-05  30%  1hd0A  [d.58.7] PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN
    4e-05  25%  3h2uD  [x.x.x] RAVER-1
    4e-05  25%  3h2uB  [x.x.x] RAVER-1
    5e-05  28%  2mssA  [d.58.7] PROTEIN (MUSASHI1)
    5e-05  34%  2dnmA  [x.x.x] SRP46 SPLICING FACTOR
    6e-05  26%  2errA  [x.x.x] ATAXIN-2-BINDING PROTEIN 1
    6e-05  26%  2cq3A  [x.x.x] RNA-BINDING PROTEIN 9
    8e-05  32%  2sxlA  [x.x.x] SEX-LETHAL PROTEIN
    8e-05  41%  2cpjA  [x.x.x] NON-POU DOMAIN-CONTAINING OCTAMER-BINDING
    1e-04  38%  2fc8A  [x.x.x] NCL PROTEIN
    2e-04  29%  2cqcA  [x.x.x] ARGININE/SERINE-RICH SPLICING FACTOR 10
    2e-04  26%  2cq4A  [x.x.x] RNA BINDING MOTIF PROTEIN 23
    4e-04  32%  2i2yA  [x.x.x] FUSION PROTEIN CONSISTS OF IMMUNOGLOBIN G-
    4e-04  26%  2dnkA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
    4e-04  37%  2cqgA  [x.x.x] TAR DNA-BINDING PROTEIN-43
    5e-04  32%  2dngA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 4H
    7e-04  23%  1wtbA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0
    7e-04  23%  1iqtA  [d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0
    0.001  27%  1x5uA  [x.x.x] SPLICING FACTOR 3B SUBUNIT 4 (SPLICEOSOME
    0.001  26%  1rk8A  [d.58.7] CG8781-PA PROTEIN
    0.001  26%  1oo0B  [d.58.7] CG8781-PA
    0.001  29%  1n54B  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  29%  1n52B  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  30%  2i38A  [x.x.x] FUSION PROTEIN CONSISTS OF IMMUNOGLOBIN G-
    0.001  26%  1hl6A  [d.58.7] CG8781 PROTEIN
    0.001  29%  1h2vZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  29%  1h2uY  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  29%  1h2uX  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  29%  1h2tZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    0.001  34%  2fc9A  [x.x.x] NCL PROTEIN
    0.001  25%  2dgsA  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    0.001  34%  2cpdA  [x.x.x] APOBEC-1 STIMULATING PROTEIN
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dgoA           ----------------------------------------------------------------------
2dh7A           ----------------------------------------------------------------------
1x5sA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2dhgA           ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
2cqdA           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
1l3kA           ----------------------------------------------------------------------
2cjkA           ----------------------------------------------------------------------
1up1A           ----------------------------------------------------------------------
1u1pA           ----------------------------------------------------------------------
1ha1A           ----------------------------------------------------------------------
1uawA           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
1sxlA           ----------------------------------------------------------------------
1b7fA           ----------------------------------------------------------------------
2qfjB           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1fnxH           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
2g4bA           ----------------------------------------------------------------------
3sxlA           ----------------------------------------------------------------------
1cvjH           ----------------------------------------------------------------------
1cvjG           ----------------------------------------------------------------------
1cvjF           ----------------------------------------------------------------------
1cvjD           ----------------------------------------------------------------------
1cvjC           ----------------------------------------------------------------------
1cvjB           ----------------------------------------------------------------------
1cvjA           ----------------------------------------------------------------------
1x5tA           ----------------------------------------------------------------------
1x4bA           ----------------------------------------------------------------------
2dguA           ----------------------------------------------------------------------
1x4gA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
1u6fA           ----------------------------------------------------------------------
2k8gA           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
1whwA           ----------------------------------------------------------------------
1x4eA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
2cpfA           ----------------------------------------------------------------------
2dk2A           ----------------------------------------------------------------------
1hd0A           ----------------------------------------------------------------------
3h2uD           ----------------------------------------------------------------------
3h2uB           ----------------------------------------------------------------------
2mssA           ----------------------------------------------------------------------
2dnmA           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
2cpjA           ----------------------------------------------------------------------
2fc8A           ----------------------------------------------------------------------
2cqcA           ----------------------------------------------------------------------
2cq4A           ----------------------------------------------------------------------
2i2yA           ----------------------------------------------------------------------
2dnkA           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
2dngA           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
1x5uA           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1n54B           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
2i38A           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2fc9A           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
2cpdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxSGGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
2dgoA           --------------------------------------------HFHVFVGDLSPEITTEDIKAAFAPFG
2dh7A           --------------------------------------------HFHVFVGDLSPEITTEDIKSAFAPFG
1x5sA           ----------------------------------------------KLFVGGLSFDTNEQSLEQVFSKYG
3bs9A           --------------------------------------------HFHVFVGDLSPEXXXXXXXXXXXPFG
2jrsA           ----------------------------------------------RLYVGSLHFNITEDMLRGIFEPFG
2dhgA           ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
1p1tA           -----------------------------------------DPAVDRVFVGNIPYEATEEQLKDIFSEVG
2dnzA           -----------------------------------------------LYVGSLHFNITEDMLRGIFEPFG
2d9pA           -----------------------------------------------LYVKNLDDGIDDERLRKAFSPFG
2cqdA           -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEGFG
2e5hA           ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
2fy1A           ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
1l3kA           ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
2cjkA           ----------------------------------------------KMFIGGLNWDTTEDNLREYFGKYG
1up1A           ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
1u1pA           ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
1ha1A           ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
1uawA           ----------------------------------------------KMFIGGLSWQTTQEGLREYFGQFG
2dh8A           ----------------------------------------------KLFVGGLDWSTTQETLRSYFSQYG
2cpzA           ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
1sxlA           -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
1b7fA           -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
2qfjB           -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
2qfjA           -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
1fnxH           -----------------------------------------------LIVNYLPQNMTQDEFKSLFGSIG
1d8zA           -----------------------------------------------LIVNYLPQNMTQDEFKSLFGSIG
2g4bA           ------------------------------------------PGAHKLFIGGLPNYLNDDQVKELLTSFG
3sxlA           -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
1cvjH           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjG           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjF           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjD           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjC           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjB           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1cvjA           -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1x5tA           ---------------------------------------------------NLDPEIDEKLLYDTFSAFG
1x4bA           -----------------------------------------------LFIGGLSFETTEESLRNYYEQWG
2dguA           -----------------------------------------------LFVRNLANTVTEEILEKAFSQFG
1x4gA           ------------------------------------------PKNCTVYCGGIASGLTDQLMRQTFSPFG
2u2fA           ----------------------------------------------KLFIGGLPNYLNDDQVKELLTSFG
1u6fA           --------------------------------------------------------VDEVQLRQLFERYG
2k8gA           -----------------------------------------------IFIKNLDKSIDNKALYDTFSAFG
2cq0A           ---------------------------------------------------NLSEDTRETDLQELFRPFG
1whwA           ----------------------------------------------RLFVRNLSYTSSEEDLEKLFSAYG
1x4eA           -----------------------------------------------LYIRGLQPGTTDQDLVKLCQPYG
1fxlA           -----------------------------------------------LIVNYLPQNMTQEEFRSLFGSIG
2cqbA           -----------------------------------------------LYVGGLAEEVDDKVLHAAFIPFG
2cpfA           -----------------------------------------------LFIKNLNFSTTEETLKGVFSKVG
2dk2A           -----------------------------------------------LFVRNLATTVTEEILEKSFSEFG
1hd0A           ----------------------------------------------KMFIGGLSWDTTKKDLKDYFSKFG
3h2uD           --------------------------------------VQLQPTDALLCVANLPPSLTQQQFEELVRPFG
3h2uB           --------------------------------------VQLQPTDALLCVANLPPSLTQQQFEELVRPFG
2mssA           ----------------------------------------------KIFVGGLSVNTTVEDVKHYFEQFG
2dnmA           ---------------------------------------------------NLTYRTSPDSLRRVFEKYG
2errA           ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
2cq3A           ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
2sxlA           -----------------------------------------------LIVNYLPQDMTDRELYALFRAIG
2cpjA           --------------------------SGGEKTFTQRS---------RLFVGNLPPDITEEEMRKLFEKYG
2fc8A           -----------------------------------------------LFVKGLSEDTTEETLKESFD---
2cqcA           ---------------------------------------------------------TERDLREVFSKYG
2cq4A           -----------------------------------------------VFCMQLAARIRPRDLEDFFSAVG
2i2yA           ------------------------------------------PLDCKVYVGNLGNNGNKTELERAFGYYG
2dnkA           -----------------------------------SGCLRQPPSHRKLFVGMLNKQQSEDDVRRLFEAFG
2cqgA           ----------------------------------------------------LPWKTTEQDLKEYFSTFG
2dngA           ---------------------------------------------YTAYVGNLPFNTVQGDI-DAIFKDL
1wtbA           ----------------------------------------------KIFVGGLSPDTPEEKIREYFGGFG
1iqtA           ----------------------------------------------KIFVGGLSPDTPEEKIREYFGGFG
1x5uA           -----------------------------------------------VYVGGLDEKVSEPLLWELFLQAG
1rk8A           -----------------------------------------------LFVTSIHEEAQEDEIQEKFCDYG
1oo0B           -----------------------------------------------LFVTSIHEEAQEDEIQEKFCDYG
1n54B           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
1n52B           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
2i38A           ------------------------------------------PLDCKVYVGNLGNNGNKTELERAFGYYG
1hl6A           -----------------------------------------------LFVTSIHEEAQEDEIQEKFCDYG
1h2vZ           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
1h2uY           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
1h2uX           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
1h2tZ           -----------------------------------------------LYVGNLSFYTTEEQIYELFSKSG
2fc9A           -----------------------------------------------LVLSNLSYSATEETLQEVFEKAT
2dgsA           ----------------------------------------------KIFVGGIPHNCGETELREYFKKFG
2cpdA           -----------------------------------------------LYVRNLMLSTSEEMIEKEFNKPG


                         +         .         .         .         .         *         .:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPxxxxxxxxxxxx
2dgoA           RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQI-----------------------
2dh7A           KISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQI-----------------------
1x5sA           QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
3bs9A           RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQI-----------------------
2jrsA           RIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPM-----------------------
2dhgA           SCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVLGSKPVRLSVAI-----------------
1p1tA           PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
2dnzA           KIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPM-----------------------
2d9pA           TITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
2cqdA           DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
2e5hA           KVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQL----------------------------
2fy1A           PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQA------------------
1l3kA           TLTDCVVMRDPNTKRSRGFGFVTYATVEE-VDAAMNARPHKVDGRVVEPKRAVSTVK-------------
2cjkA           TVTDLKIMKDPATGRSRGFGFLSFSSVDEVVKTQHILDGKVI----------------------------
1up1A           TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
1u1pA           TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
1ha1A           TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
1uawA           EVKECLVMRDPLTKRSRGFGFVTFMD--------------------------------------------
2dh8A           EVVDCVIMKDKTTNQSRGFGFVKFKD--------------------------------------------
2cpzA           NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIG---------------------------
1sxlA           SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPGSQPLSVRLA------------------
1b7fA           SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPGSQPLSVRLA------------------
2qfjB           KIKSATLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMP------------
2qfjA           KIKSATLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMP------------
1fnxH           DIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNG-------------------------------
1d8zA           DIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNG-------------------------------
2g4bA           PLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA------------------
3sxlA           SIVQKNILRDKLTGRPRGVAFVRYNKREE-----------------------------------------
1cvjH           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjG           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjF           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjD           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjC           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjB           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1cvjA           PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV-----------------------
1x5tA           VIQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYA------------------
1x4bA           KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
2dguA           KLE--------RVKKLKDYAFIHFDERDGAVKAMEEMNGK------------------------------
1x4gA           QIMEIRVFPE------KGYSFVRFSTHESAAHAIVSVNGTTIEGHVV-----------------------
2u2fA           PLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA------------------
1u6fA           PIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNG-------------------------------
2k8gA           NILSCKVVCDENG--SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGR-------------------
2cq0A           SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
1whwA           PLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQ------------------------------
1x4eA           KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
1fxlA           EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNG-------------------------------
2cqbA           DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNM---------------------------------
2cpfA           AIKSCTISKKKNKAGSMGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRISERATKP------------
2dk2A           KLE--------RVKKLKDYAFVHFEDRGAAVKAMDEMNGK------------------------------
1hd0A           EVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNG---------------------------
3h2uD           SLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLG---------------------------
3h2uB           SLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLG---------------------------
2mssA           KVDDAMLMFDKTTNRHRGFGFVTF-ESEDIVEKVCEIHFHEINNKMVECKKA------------------
2dnmA           RVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDG-------------------------------
2errA           KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
2cq3A           KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
2sxlA           PINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNG-------------------------------
2cpjA           KAGEVFI------HKDKGFGFI------------------------------------------------
2fc8A           GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
2cqcA           PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANG-------------------------------
2cq4A           KVRDVRIISDRNSRRSKGIAYVEFCEIQS-VPLAIGLTGQRLLGVPIIVQASQAE---------------
2i2yA           PLRSVWVARNP-----PGFAFVEFEDPRDAADAVRELDGR------------------------------
2dnkA           NIEECTILRGP-DGNSKGCAFVKYSSHAEAQAAINALHG-------------------------------
2cqgA           EVLMVQVKKDLKTGHSKGFGFVRFTEYE------------------------------------------
2dngA           SIRSVRLVRDKDTDKFKGFCYVEF-DEVDSLKEALTYDGALLG---------------------------
1wtbA           EVESIELPMDNKTNKRRGFCFITFKEEE------------------------------------------
1iqtA           EVESIELPMDNKTNKRRGFCFITFKEEE------------------------------------------
1x5uA           PVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMDMIKLYGKPIRVNKA------------------
1rk8A           EIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI----------------------------
1oo0B           EIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI----------------------------
1n54B           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
1n52B           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
2i38A           PLRSVWVARN-----PPGFAFVEFEDPRDAADAVRDLDGR------------------------------
1hl6A           EIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI----------------------------
1h2vZ           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
1h2uY           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
1h2uX           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
1h2tZ           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-------------------------------
2fc9A           FIK----VPQNQNGKSKGYAFIEFASFEDAKEAKREIEGRAI----------------------------
2dgsA           VVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA-------------------------------------
2cpdA           AVERVKKIRD--------YAFVHFSNREDAVEAMKALNGKVLDGSPI-----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dgoA           ------------------------------------------
2dh7A           ------------------------------------------
1x5sA           ------------------------------------------
3bs9A           ------------------------------------------
2jrsA           ------------------------------------------
2dhgA           ------------------------------------------
1p1tA           ------------------------------------------
2dnzA           ------------------------------------------
2d9pA           ------------------------------------------
2cqdA           ------------------------------------------
2e5hA           ------------------------------------------
2fy1A           ------------------------------------------
1l3kA           ------------------------------------------
2cjkA           ------------------------------------------
1up1A           ------------------------------------------
1u1pA           ------------------------------------------
1ha1A           ------------------------------------------
1uawA           ------------------------------------------
2dh8A           ------------------------------------------
2cpzA           ------------------------------------------
1sxlA           ------------------------------------------
1b7fA           ------------------------------------------
2qfjB           ------------------------------------------
2qfjA           ------------------------------------------
1fnxH           ------------------------------------------
1d8zA           ------------------------------------------
2g4bA           ------------------------------------------
3sxlA           ------------------------------------------
1cvjH           ------------------------------------------
1cvjG           ------------------------------------------
1cvjF           ------------------------------------------
1cvjD           ------------------------------------------
1cvjC           ------------------------------------------
1cvjB           ------------------------------------------
1cvjA           ------------------------------------------
1x5tA           ------------------------------------------
1x4bA           ------------------------------------------
2dguA           ------------------------------------------
1x4gA           ------------------------------------------
2u2fA           ------------------------------------------
1u6fA           ------------------------------------------
2k8gA           ------------------------------------------
2cq0A           ------------------------------------------
1whwA           ------------------------------------------
1x4eA           ------------------------------------------
1fxlA           ------------------------------------------
2cqbA           ------------------------------------------
2cpfA           ------------------------------------------
2dk2A           ------------------------------------------
1hd0A           ------------------------------------------
3h2uD           ------------------------------------------
3h2uB           ------------------------------------------
2mssA           ------------------------------------------
2dnmA           ------------------------------------------
2errA           ------------------------------------------
2cq3A           ------------------------------------------
2sxlA           ------------------------------------------
2cpjA           ------------------------------------------
2fc8A           ------------------------------------------
2cqcA           ------------------------------------------
2cq4A           ------------------------------------------
2i2yA           ------------------------------------------
2dnkA           ------------------------------------------
2cqgA           ------------------------------------------
2dngA           ------------------------------------------
1wtbA           ------------------------------------------
1iqtA           ------------------------------------------
1x5uA           ------------------------------------------
1rk8A           ------------------------------------------
1oo0B           ------------------------------------------
1n54B           ------------------------------------------
1n52B           ------------------------------------------
2i38A           ------------------------------------------
1hl6A           ------------------------------------------
1h2vZ           ------------------------------------------
1h2uY           ------------------------------------------
1h2uX           ------------------------------------------
1h2tZ           ------------------------------------------
2fc9A           ------------------------------------------
2dgsA           ------------------------------------------
2cpdA           ------------------------------------------