[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_01232

[Show Plain Result]

#ERROR : Can't open dsspfile "3i3qB.bssp"
#ERROR : Can't open dsspfile "3i3qA.bssp"
#ERROR : Can't open dsspfile "3i3mA.bssp"
#ERROR : Can't open dsspfile "2fdkA.bssp"
#ERROR : Can't open dsspfile "2fdjA.bssp"
#ERROR : Can't open dsspfile "2fdiA.bssp"
#ERROR : Can't open dsspfile "3bkzA.bssp"
#ERROR : Can't open dsspfile "3bieA.bssp"
#ERROR : Can't open dsspfile "3bi3A.bssp"

## Summary of PDB Search
:388
    1e-08  34%  3i3qB  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
    1e-08  34%  3i3qA  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
    1e-08  34%  3i3mA  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
    1e-08  34%  2fdkA  [x.x.x] ALKYLATED DNA REPAIR PROTEIN ALKB
    1e-08  34%  2fdjA  [x.x.x] ALKYLATED DNA REPAIR PROTEIN ALKB
    1e-08  34%  2fdiA  [x.x.x] ALKYLATED DNA REPAIR PROTEIN ALKB
    1e-08  34%  3bkzA  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
    3e-08  34%  3bieA  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
    3e-08  34%  3bi3A  [x.x.x] ALPHA-KETOGLUTARATE-DEPENDENT DIOXYGENASE ALKB
:388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i3qB           ----------------------------------------------------------------------
3i3qA           ----------------------------------------------------------------------
3i3mA           ----------------------------------------------------------------------
2fdkA           ----------------------------------------------------------------------
2fdjA           ----------------------------------------------------------------------
2fdiA           ----------------------------------------------------------------------
3bkzA           ----------------------------------------------------------------------
3bieA           ----------------------------------------------------------------------
3bi3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i3qB           ----------------------------------------------------------------------
3i3qA           ----------------------------------------------------------------------
3i3mA           ----------------------------------------------------------------------
2fdkA           ----------------------------------------------------------------------
2fdjA           ----------------------------------------------------------------------
2fdiA           ----------------------------------------------------------------------
3bkzA           ----------------------------------------------------------------------
3bieA           ----------------------------------------------------------------------
3bi3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i3qB           ----------------------------------------------------------------------
3i3qA           ----------------------------------------------------------------------
3i3mA           ----------------------------------------------------------------------
2fdkA           ----------------------------------------------------------------------
2fdjA           ----------------------------------------------------------------------
2fdiA           ----------------------------------------------------------------------
3bkzA           ----------------------------------------------------------------------
3bieA           ----------------------------------------------------------------------
3bi3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxGQYNWTTKEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECD
3i3qB           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
3i3qA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
3i3mA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
2fdkA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
2fdjA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
2fdiA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
3bkzA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKCEDLR
3bieA           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLCLHQDKDEDLR
3bi3A           ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLCLHQDKDEDLR


                         .         *         .         .         .         .         +:350
query           TGLISISLGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAWHAVxxxxxxxxxxxxxxxxxxxxxx
3i3qB           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
3i3qA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
3i3mA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
2fdkA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
2fdjA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
2fdiA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
3bkzA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
3bieA           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
3bi3A           APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i3qB           --------------------------------------
3i3qA           --------------------------------------
3i3mA           --------------------------------------
2fdkA           --------------------------------------
2fdjA           --------------------------------------
2fdiA           --------------------------------------
3bkzA           --------------------------------------
3bieA           --------------------------------------
3bi3A           --------------------------------------