[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_01275

[Show Plain Result]

#ERROR : Can't open dsspfile "2furB.bssp"
#ERROR : Can't open dsspfile "2furA.bssp"

## Summary of PDB Search
:266
    3e-12  33%  2furB  [x.x.x] HYPOTHETICAL PROTEIN
    3e-12  33%  2furA  [x.x.x] HYPOTHETICAL PROTEIN
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2furB           ----------------------------------------------------------------------
2furA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxYLHGYVSSRIMNLARATDGKGLPICIAATHVDGLILTLTPNSHSYNYRSAVLHGYATLVTDVE
2furB           -------YLHGS-KSRIYGILKT----GQLIAISLLEINGIVLAKEIKNNSINYVSALIFGRPYEIDDTE
2furA           -------YLHGS-KSRIYGILKT----GQLIAISLLEINGIVLAKEIKNNSINYVSALIFGRPYEIDDTE


                         +         .         .         .         .         *         .:210
query           EKLWAMKLITNSVVPQRWENTRIPPDGAEMQSTTILKVKIVDGSGKIRDGGVSDERKDKDRPDVTEKVWT
2furB           KKIEVFRLLTEKLVKGRWDNS-IKPSYEDLNGVFVFAVK-PETFSKARTGPPHDTS--------TDDIWS
2furA           KKIEVFRLLTEKLVKGRWDNS-IKPSYEDLNGVFVFAVK-PETFSKARTGPPHDTS--------TDDIWS


                         .         .         .         +         .         .         .:280
query           GVVPVWQTFGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2furB           GVLPIQHTISE---------------------------------------------
2furA           GVLPIQHTISE---------------------------------------------