[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_01665

[Show Plain Result]

#ERROR : Can't open dsspfile "2vn4A.bssp"
#ERROR : Can't open dsspfile "1gaiA.bssp"
#ERROR : Can't open dsspfile "1gahA.bssp"
#ERROR : Can't open dsspfile "1agmA.bssp"
#ERROR : Can't open dsspfile "3eqaA.bssp"
#ERROR : Can't open dsspfile "1ayxA.bssp"
#ERROR : Can't open dsspfile "1ac0A.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "1pj9A.bssp"
#ERROR : Can't open dsspfile "1ot2A.bssp"
#ERROR : Can't open dsspfile "1ot1A.bssp"
#ERROR : Can't open dsspfile "1kclA.bssp"
#ERROR : Can't open dsspfile "1kckA.bssp"
#ERROR : Can't open dsspfile "1eo5A.bssp"
#ERROR : Can't open dsspfile "1dtuA.bssp"
#ERROR : Can't open dsspfile "1d3cA.bssp"
#ERROR : Can't open dsspfile "1cxlA.bssp"
#ERROR : Can't open dsspfile "1cgyA.bssp"
#ERROR : Can't open dsspfile "1cgxA.bssp"
#ERROR : Can't open dsspfile "1cgwA.bssp"
#ERROR : Can't open dsspfile "1cgvA.bssp"
#ERROR : Can't open dsspfile "1cdgA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "1v3kA.bssp"
#ERROR : Can't open dsspfile "1v3jA.bssp"
#ERROR : Can't open dsspfile "1uktA.bssp"
#ERROR : Can't open dsspfile "1uksA.bssp"
#ERROR : Can't open dsspfile "1pamA.bssp"
#ERROR : Can't open dsspfile "1d7fA.bssp"
#ERROR : Can't open dsspfile "1pezA.bssp"
#ERROR : Can't open dsspfile "1qhoA.bssp"
#ERROR : Can't open dsspfile "1tcmA.bssp"
#ERROR : Can't open dsspfile "6cgtA.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "3cgtA.bssp"
#ERROR : Can't open dsspfile "1cguA.bssp"
#ERROR : Can't open dsspfile "1cgtA.bssp"

## Summary of PDB Search
:628
    e-169  54%  2vn4A  [x.x.x] GLUCOAMYLASE
    e-164  60%  1gaiA  [x.x.x] GLUCOAMYLASE-471
    e-164  60%  1gahA  [x.x.x] GLUCOAMYLASE-471
    e-164  60%  1agmA  [x.x.x] GLUCOAMYLASE-471
    e-164  60%  3eqaA  [x.x.x] GLUCOAMYLASE
    2e-58  36%  1ayxA  [x.x.x] GLUCOAMYLASE
    1e-24  52%  1ac0A  [x.x.x] GLUCOAMYLASE
    1e-14  37%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    5e-11  31%  1pj9A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    5e-11  31%  1ot2A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    5e-11  31%  1ot1A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    5e-11  31%  1kclA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    5e-11  31%  1kckA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    5e-11  31%  1eo5A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    5e-11  31%  1dtuA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    5e-11  31%  1d3cA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    5e-11  31%  1cxlA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
    5e-11  31%  1cgyA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-11  31%  1cgxA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-11  31%  1cgwA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-11  31%  1cgvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-11  31%  1cdgA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    5e-11  32%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-11  32%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    7e-11  30%  1v3kA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    7e-11  30%  1v3jA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    7e-11  30%  1uktA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    7e-11  30%  1uksA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    7e-11  30%  1pamA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    7e-11  30%  1d7fA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-10  30%  1pezA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    2e-10  33%  1qhoA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] ALPHA-AMYLASE
    2e-09  30%  1tcmA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-08  30%  6cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    1e-08  30%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    1e-08  30%  3cgtA  [c.1.8 - b.71.1 - b.1.18 - b.3.1 (8cgtA)] CYCLODEXTRIN
    1e-08  30%  1cguA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    1e-08  30%  1cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
:628

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALQSILDNIGDDGAKVQGAHAGIVVA
2vn4A           --------------------------------------------ALNNLLCNVGPDGCRAFGTSAGAVIA
1gaiA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
1gahA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
1agmA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
3eqaA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
1ayxA           --------------------------------------------SLYYLLQNIAYPEGQFNNGVPGTVIA
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
2vn4A           SPSTIDPDYYYMWTRDSALVFKNLIDRFTE-TYDAQRRIEQYITAQVTLQGLSNPSGSLADGGLGEPKFE
1gaiA           SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
1gahA           SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
1agmA           SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
3eqaA           SPSTDNPDYFYTWTRDSGLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGGLGEPKFN
1ayxA           SPSTSNPDYYYQWTRDSAITFLTVLSELEDNNFNTTKAVEYYINTSYNLQRTSNPSGSFDDEGLGEPKFN
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
2vn4A           LTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEE
1gaiA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
1gahA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
1agmA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
3eqaA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEE
1ayxA           TDGSAYTGAWGRPQNDGPALRAYAISRYGKLVLTDSGDSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEE
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
2vn4A           VNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSNINTNEG--RTGKDVNSVL
1gaiA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
1gahA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
1agmA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
3eqaA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPEILCYLQSFWTGSFILANFDSSRSGKDANTLL
1ayxA           NQGRHFFTSLVQQKALAYAVDIAKSF--DDGDFANTLSSTASTLESYLSGSHIVENQQNSRQGLDSATYI
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
2vn4A           TSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLA
1gaiA           GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
1gahA           GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
1agmA           GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
3eqaA           GSIHTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYNGNPWFLC
1ayxA           GPLLTHD-IGESSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAYSA--GAAIGRYPEDVYNGGNPWFLA
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
2vn4A           TFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYXXXXXTFTNIINAVSTYADGFLSEAAK
1gaiA           TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIVSAVKTFADGFVSIVET
1gahA           TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIVSAVKTFADGFVSIVET
1agmA           TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIVSAVKTFADGFVSIVET
3eqaA           TLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGXXXXXXXXXXXIVDAVKTFADGFVSIVET
1ayxA           TAYAAQVPYKLAYDKSASNDITINKINYDFFNSAYQSSDSVTIKSGSDEFNTVADNLVTFGDSFLQVILD
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
2vn4A           YVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSR
1gaiA           HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSS
1gahA           HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSS
1agmA           HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSS
3eqaA           HAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSVVPASWGETSASSVPGTCAATSAIGTYSS
1ayxA           HINDDGSLNEQLNRYTGYSTGAYSLTWSSGALLEAIRLRNKV----------------------------
1ac0A           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
6cgtA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
3cgtA           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
1cgtA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ATIXXXXXXXXXXXXXXXXXXXXXXSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
2vn4A           PTASQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYA
1gaiA           VTV-------------------------------------------------------------------
1gahA           VTV-------------------------------------------------------------------
1agmA           VTV-------------------------------------------------------------------
3eqaA           VTV-------------------------------------------------------------------
1ayxA           ----------------------------------------------------------------------
1ac0A           -------------------------TAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
1cygA           --------------------------SVRFVVNNAT-TNLGQNIYIVGNVYELGNWDTSKAIGPMFNQVV
1pj9A           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1ot2A           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1ot1A           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1kclA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1kckA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1eo5A           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1dtuA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1d3cA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cxlA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cgyA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cgxA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cgwA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cgvA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1cdgA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
3bmvA           -------------------------------------TVYGENVYLTGNVAELGNWDTSKAIGPMFNQVV
1a47A           -------------------------------------TVYGENVYLTGNVAELGNWDTSKAIGPMFNQVV
1v3kA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1v3jA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1uktA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1uksA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1pamA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1d7fA           --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
1pezA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
1qhoA           -------------------------TSVVFTVKSAPPTNLGDKIYLTGNIPELGNWSSGAVNNAQGPLLA
1tcmA           --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNADPAKAIGPMYNQVV
6cgtA           -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI
4cgtA           -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI
3cgtA           -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI
1cguA           -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI
1cgtA           -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI


                         .         .         .         *         .         .         .:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNxxxxxxxxxxxxxxxxxxxxxx
2vn4A           DNHPLWIATVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVP------------------------
1gaiA           --------------------------------------------------------------------
1gahA           --------------------------------------------------------------------
1agmA           --------------------------------------------------------------------
3eqaA           --------------------------------------------------------------------
1ayxA           --------------------------------------------------------------------
1ac0A           SSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQ-----------------------
1cygA           YSYPTWYIDVSVPEGKTIEFKFIKKDSQGNVTWESGSNHVYTTPTN----------------------
1pj9A           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1ot2A           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1ot1A           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1kclA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1kckA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1eo5A           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1dtuA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1d3cA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cxlA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cgyA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cgxA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cgwA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cgvA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
1cdgA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
3bmvA           YQYPTWYYDVSVPAGTTIQFKFIKKNGN-TITWEGGSNHTYTVPSS----------------------
1a47A           YQYPTWYYDVSVPAGTTIQFKFIKKNGN-TITWEGGSNHTYTVPSS----------------------
1v3kA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1v3jA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1uktA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1uksA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1pamA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1d7fA           YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
1pezA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTATWEGGSNHTFTAPSS----------------------
1qhoA           PNYPDWFYVFSVPAGKTIQFKFFIKRADGTIQWENGSNHVATTP------------------------
1tcmA           YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
6cgtA           HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------
4cgtA           HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------
3cgtA           HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------
1cguA           HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------
1cgtA           HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------