[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02123

[Show Plain Result]

#ERROR : Can't open dsspfile "2j16B.bssp"
#ERROR : Can't open dsspfile "2j17B.bssp"
#ERROR : Can't open dsspfile "2j17A.bssp"
#ERROR : Can't open dsspfile "2j16A.bssp"
#ERROR : Can't open dsspfile "2hxpA.bssp"
#ERROR : Can't open dsspfile "2oudA.bssp"
#ERROR : Can't open dsspfile "1zzwB.bssp"
#ERROR : Can't open dsspfile "1zzwA.bssp"
#ERROR : Can't open dsspfile "1mkpA.bssp"
#ERROR : Can't open dsspfile "3ezzA.bssp"
#ERROR : Can't open dsspfile "2r0bA.bssp"
#ERROR : Can't open dsspfile "1m3gA.bssp"
#ERROR : Can't open dsspfile "1ikzA.bssp"
#ERROR : Can't open dsspfile "2g6zC.bssp"
#ERROR : Can't open dsspfile "2g6zB.bssp"
#ERROR : Can't open dsspfile "2g6zA.bssp"
#ERROR : Can't open dsspfile "2wgpB.bssp"
#ERROR : Can't open dsspfile "2wgpA.bssp"
#ERROR : Can't open dsspfile "2nt2A.bssp"
#ERROR : Can't open dsspfile "1vhrA.bssp"
#ERROR : Can't open dsspfile "2f4dA.bssp"
#ERROR : Can't open dsspfile "2esbA.bssp"
#ERROR : Can't open dsspfile "2hcmA.bssp"
#ERROR : Can't open dsspfile "1wrmA.bssp"
#ERROR : Can't open dsspfile "1j4xA.bssp"
#ERROR : Can't open dsspfile "2pq5C.bssp"
#ERROR : Can't open dsspfile "2pq5B.bssp"
#ERROR : Can't open dsspfile "2pq5A.bssp"
#ERROR : Can't open dsspfile "1d5rA.bssp"
#ERROR : Can't open dsspfile "2e0tA.bssp"
#ERROR : Can't open dsspfile "2gwoC.bssp"
#ERROR : Can't open dsspfile "2gwoA.bssp"
#ERROR : Can't open dsspfile "2rf6A.bssp"
#ERROR : Can't open dsspfile "3cm3A.bssp"

## Summary of PDB Search
:598
    6e-16  42%  2j16B  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE YIL113W
    9e-15  41%  2j17B  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE YIL113W
    9e-15  41%  2j17A  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE YIL113W
    2e-12  39%  2j16A  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE YIL113W
    1e-11  40%  2hxpA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 9
    8e-11  43%  2oudA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 10
    2e-10  45%  1zzwB  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 10
    2e-10  45%  1zzwA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 10
    3e-09  37%  1mkpA  [x.x.x] PYST1
    4e-09  34%  3ezzA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 4
    1e-08  33%  2r0bA  [x.x.x] SERINE/THREONINE/TYROSINE-INTERACTING PROTEIN
    3e-08  38%  1m3gA  [c.45.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 2
    3e-08  38%  1ikzA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 2
    3e-08  30%  2g6zC  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 5
    3e-08  30%  2g6zB  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 5
    3e-08  30%  2g6zA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 5
    1e-07  34%  2wgpB  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 14
    1e-07  34%  2wgpA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 14
    2e-07  42%  2nt2A  [x.x.x] PROTEIN PHOSPHATASE SLINGSHOT HOMOLOG 2
    8e-06  36%  1vhrA  [c.45.1] HUMAN VH1-RELATED DUAL-SPECIFICITY PHOSPHATASE
    8e-06  36%  2f4dA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 3
    1e-05  32%  2esbA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 18
    2e-05  26%  2hcmA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE
    3e-05  46%  1wrmA  [x.x.x] DUAL SPECIFICITY PHOSPHATASE 22
    1e-04  34%  1j4xA  [c.45.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 3
    1e-04  45%  2pq5C  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 13
    1e-04  45%  2pq5B  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 13
    1e-04  45%  2pq5A  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 13
    2e-04  34%  1d5rA  [c.45.1 - b.7.1] PHOSPHOINOSITIDE PHOSPHOTASE PTEN
    3e-04  64%  2e0tA  [x.x.x] DUAL SPECIFICITY PHOSPHATASE 26
    3e-04  38%  2gwoC  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 13
    3e-04  38%  2gwoA  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE 13
    7e-04  35%  2rf6A  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE
    7e-04  35%  3cm3A  [x.x.x] DUAL SPECIFICITY PROTEIN PHOSPHATASE
:598

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2j16B           ----------------------------------------------------------------------
2j17B           ----------------------------------------------------------------------
2j17A           ----------------------------------------------------------------------
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2j16B           ----------------------------------------------------------------------
2j17B           ----------------------------------------------------------------------
2j17A           ----------------------------------------------------------------------
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGYPDGPIRIYDS
2j16B           ---------------------------------------------------------RIYPKGPLLVLPE
2j17B           ---------------------------------------------------------RIYPKGPLLVLPE
2j17A           ---------------------------------------------------------RIYPKGPLLVLPE
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GLWLYLEPNEEEASKFDVVFNVAKEVNNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDTACSELSFK
2j16B           KIYLYSEPTVKELLPFDVVINVAEEAND------------------------------------------
2j17B           KIYLYSEPTVKELLPFDVVINVAEEAND------------------------------------------
2j17A           KIYLYSEPTVKELLPFDVVINVAEEAND------------------------------------------
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ------------------------------------------------------------DAPSSEVKFK
3cm3A           ------------------------------------------------------------DAPSSEVKFK


                         .         *         .         .         .         .         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
2j16B           ------------------PAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLI
2j17B           ------------------PAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHSQCGLSRSATLI
2j17A           ------------------PAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHSQCGLSRSATLI
2j16A           ----------------------YHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIH-QCGLSRSATLI
2hxpA           ----------------------------DHWSQNLSRFFPAIEFIDEALSQNCGVLVHSLAGVSRSVTVT
2oudA           ---------------------------------------------------GKGLLIHCQAGVSRSATIV
1zzwB           ---------------------------------------------------GKGLLIHCQAGVSRSATIV
1zzwA           ---------------------------------------------------GKGLLIHCQAGVSRSATIV
1mkpA           ----------------NAGEFKYKQIPIDHWSQNLSQFFPAISFIDEARGKNCGVLVHSLAGISRSVTVT
3ezzA           TALLNVSSDCP-----NHFEGHYIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHSQAGISRSATIC
2r0bA           ----------------------------DNPVENIIRFFPMTEFIDGSLQMGGKVLVHGNAGISRSAAFV
1m3gA           -------------------------------------------------NSGGRVLVHSQAGISRSATIC
1ikzA           -------------------------------------------------NSGGRVLVHSQAGISRSATIC
2g6zC           ----------------------HLHYKWSHTADISSHFQEAIDFIDCVREKGGKVLVHSEAGISRSPTIC
2g6zB           ----------------------HLHYKWSHTADISSHFQEAIDFIDCVREKGGKVLVHSEAGISRSPTIC
2g6zA           ----------------------HLHYKWSHTADISSHFQEAIDFIDCVREKGGKVLVHSEAGISRSPTIC
2wgpB           -------------PNFNWPQFEYVKVPLADMPHAPIGLYTVADKIHSVSRKHGATLVHCAAGVSRSATLC
2wgpA           -------------PNFNWPQFEYVKVPLADMPHAPIGLYTVADKIHSVSRKHGATLVHCAAGVSRSATLC
2nt2A           ---------------------------------------------------GSKCLVHSKMGVSRSASTV
1vhrA           ------------------------------------------DFIDQALAKNGRVLVHCREGYSRSPTLV
2f4dA           ------------------------------------------DFIDQALAKNGRVLVHCREGYSRSPTLV
2esbA           ---------------------QYMQVPVSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALC
2hcmA           -----------PGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVC
1wrmA           --------------------------------------------------RGESCLVHCLAGVSRSVTLV
1j4xA           ------------------------------------------DFIDQALAKNGRVLVHSREGYSRSPTLV
2pq5C           -----------------------------------------------------RVLVHCAMGVSRSATLV
2pq5B           -----------------------------------------------------RVLVHCAMGVSRSATLV
2pq5A           -----------------------------------------------------RVLVHCAMGVSRSATLV
1d5rA           ----------------------------DHNPPQLELIKPFCEDLDQWLSEDDNAAIHCKAGKGRTGVMI
2e0tA           ---------------------------------------------------GGKILVHCAVGVSRSATLV
2gwoC           -----------------------------------------------------RVLVHCAMGVSRSATLV
2gwoA           -----------------------------------------------------RVLVHCAMGVSRSATLV
2rf6A           YVLNLTMDKYT-LPNSNI---NIIHIPLVDDSKYFDDVTAFLSKCDQR---NEPVLVHSAAGVNRSGAMI
3cm3A           YVLNLTMDKYT-LPNSNI---NIIHIPLVDDSKYFDDVTAFLSKCDQR---NEPVLVHSAAGVNRSGAMI


                         .         .         .         .         *         .         .:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRxxxxxxxxxxxxxxxxxxx
2j16B           IAY-IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVAL--------------------------
2j17B           IAY-IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVAL--------------------------
2j17A           IAY-IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVAL--------------------------
2j16A           IAY-IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVAL--------------------------
2hxpA           VAY-LMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLR-------------------------
2oudA           IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR-------------------
1zzwB           IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNG-----------------------
1zzwA           IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNG-----------------------
1mkpA           VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDF------------------------------
3ezzA           LAYLMMKK-RVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------
2r0bA           IAY-IMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEY------------------------------
1m3gA           LAY-LMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV--------------------------
1ikzA           LAY-LMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV--------------------------
2g6zC           MAY-LMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEI--------------------------
2g6zB           MAY-LMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEI--------------------------
2g6zA           MAY-LMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEI--------------------------
2wgpB           IAY-LMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFG------------------------
2wgpA           IAY-LMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFG------------------------
2nt2A           IAYAM-KEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQ-----------------------------
1vhrA           IAY-LMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
2f4dA           IAY-LMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
2esbA           LAY-LMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG------------------------
2hcmA           TAYLMRHRGH-SLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAI---------------------
1wrmA           IAYIM---TVTDFDALHTVRAGRSC-ANPNVGFQRQLQEF------------------------------
1j4xA           IAY-LMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
2pq5C           LAFMIYENMTL-VEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
2pq5B           LAFMIYENMTL-VEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
2pq5A           LAFMIYENMTL-VEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
1d5rA           CAYLLHRGKFLKAQEAYGEVRTR-----------------------------------------------
2e0tA           LAY-------------------------------------------------------------------
2gwoC           LAFLMICENMTLVEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
2gwoA           LAFLMICENMTLVEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
2rf6A           LAYLMSKN--------------------------------------------------------------
3cm3A           LAYLMSKN--------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2j16B           ----------------------------------------------------------------------
2j17B           ----------------------------------------------------------------------
2j17A           ----------------------------------------------------------------------
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2j16B           ----------------------------------------------------------------------
2j17B           ----------------------------------------------------------------------
2j17A           ----------------------------------------------------------------------
2j16A           ----------------------------------------------------------------------
2hxpA           ----------------------------------------------------------------------
2oudA           ----------------------------------------------------------------------
1zzwB           ----------------------------------------------------------------------
1zzwA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
3ezzA           ----------------------------------------------------------------------
2r0bA           ----------------------------------------------------------------------
1m3gA           ----------------------------------------------------------------------
1ikzA           ----------------------------------------------------------------------
2g6zC           ----------------------------------------------------------------------
2g6zB           ----------------------------------------------------------------------
2g6zA           ----------------------------------------------------------------------
2wgpB           ----------------------------------------------------------------------
2wgpA           ----------------------------------------------------------------------
2nt2A           ----------------------------------------------------------------------
1vhrA           ----------------------------------------------------------------------
2f4dA           ----------------------------------------------------------------------
2esbA           ----------------------------------------------------------------------
2hcmA           ----------------------------------------------------------------------
1wrmA           ----------------------------------------------------------------------
1j4xA           ----------------------------------------------------------------------
2pq5C           ----------------------------------------------------------------------
2pq5B           ----------------------------------------------------------------------
2pq5A           ----------------------------------------------------------------------
1d5rA           ----------------------------------------------------------------------
2e0tA           ----------------------------------------------------------------------
2gwoC           ----------------------------------------------------------------------
2gwoA           ----------------------------------------------------------------------
2rf6A           ----------------------------------------------------------------------
3cm3A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2j16B           --------------------------------------
2j17B           --------------------------------------
2j17A           --------------------------------------
2j16A           --------------------------------------
2hxpA           --------------------------------------
2oudA           --------------------------------------
1zzwB           --------------------------------------
1zzwA           --------------------------------------
1mkpA           --------------------------------------
3ezzA           --------------------------------------
2r0bA           --------------------------------------
1m3gA           --------------------------------------
1ikzA           --------------------------------------
2g6zC           --------------------------------------
2g6zB           --------------------------------------
2g6zA           --------------------------------------
2wgpB           --------------------------------------
2wgpA           --------------------------------------
2nt2A           --------------------------------------
1vhrA           --------------------------------------
2f4dA           --------------------------------------
2esbA           --------------------------------------
2hcmA           --------------------------------------
1wrmA           --------------------------------------
1j4xA           --------------------------------------
2pq5C           --------------------------------------
2pq5B           --------------------------------------
2pq5A           --------------------------------------
1d5rA           --------------------------------------
2e0tA           --------------------------------------
2gwoC           --------------------------------------
2gwoA           --------------------------------------
2rf6A           --------------------------------------
3cm3A           --------------------------------------