[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02183

[Show Plain Result]

#ERROR : Can't open dsspfile "2bvfA.bssp"
#ERROR : Can't open dsspfile "3fwaA.bssp"
#ERROR : Can't open dsspfile "3fw9A.bssp"
#ERROR : Can't open dsspfile "3fw8A.bssp"
#ERROR : Can't open dsspfile "3fw7A.bssp"
#ERROR : Can't open dsspfile "3d2jA.bssp"
#ERROR : Can't open dsspfile "3d2hA.bssp"
#ERROR : Can't open dsspfile "3d2dA.bssp"
#ERROR : Can't open dsspfile "1zr6A.bssp"
#ERROR : Can't open dsspfile "3e0tA.bssp"

## Summary of PDB Search
:567
    6e-08  28%  2bvfA  [x.x.x] 6-HYDROXY-D-NICOTINE OXIDASE
    4e-07  28%  3fwaA  [x.x.x] RETICULINE OXIDASE
    4e-07  28%  3fw9A  [x.x.x] RETICULINE OXIDASE
    4e-07  28%  3fw8A  [x.x.x] RETICULINE OXIDASE
    4e-07  28%  3fw7A  [x.x.x] RETICULINE OXIDASE
    4e-07  28%  3d2jA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-07  28%  3d2hA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-07  28%  3d2dA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    1e-04  28%  1zr6A  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
    1e-04  28%  3e0tA  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
:567

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bvfA           ----------------------------------------------------------------------
3fwaA           ----------------------------------------------------------------------
3fw9A           ----------------------------------------------------------------------
3fw8A           ----------------------------------------------------------------------
3fw7A           ----------------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3d2hA           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTSDIQTAVKF
2bvfA           -----------------------------------------------------------SAGDVAKSVRY
3fwaA           ----------------------------------------------------------------------
3fw9A           ----------------------------------------------------------------------
3fw8A           ----------------------------------------------------------------------
3fw7A           ----------------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3d2hA           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
2bvfA           ACDNGLEISVRSGGHNPNGYATNDGGIVLDLRLMNSIHIDTA----GSRARIGG--------GVISGDLV
3fwaA           ----------------------------------------------------------------------
3fw9A           ----------------------------------------------------------------------
3fw8A           ----------------------------------------------------------------------
3fw7A           ----------------------------------------------------------------------
3d2jA           ----------------------------------------------------------------------
3d2hA           ----------------------------------------------------------------------
3d2dA           ----------------------------------------------------------------------
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RAAAENGVIVVGGSARTVXXXXXXXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
2bvfA           KEAAKFGLAAVTGMHPKVGFCGLALNGGVGF-LTPKYGLASDNILGATLVTATGDVIYCSDDERPELFWA
3fwaA           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3fw9A           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3fw8A           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3fw7A           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3d2jA           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3d2hA           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
3d2dA           ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
1zr6A           ---------------------------------THTHGLTLDWLIGATVVLADASIVHVSETENADLFWA
3e0tA           ---------------------------------THTHGLTLDWLIGATVVLADASIVHVSETENADLFWA


                         .         *         .         .         .         .         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLS
2bvfA           VRGAGPN-FGVVTEVEVQLYELPRKMLAGFI---------------------------------------
3fwaA           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3fw9A           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3fw8A           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3fw7A           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3d2jA           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3d2hA           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
3d2dA           IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
1zr6A           LRGGGG-GFAIVSEFEFNTFEAPEIITT--YQVTTTWNRKQHVAGLKALQD-------------------
3e0tA           LRGGGG-GFAIVSEFEFNTFEAPEIITT--YQVTTTWNRKQHVAGLKALQD-------------------


                         .         .         .         .         *         .         .:420
query           GGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG
2bvfA           ----------------------------------------------------------------------
3fwaA           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3fw9A           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3fw8A           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3fw7A           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3d2jA           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3d2hA           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
3d2dA           GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASAN
2bvfA           ----------------------------------------------------------------------
3fwaA           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3fw9A           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3fw8A           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3fw7A           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3d2jA           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3d2hA           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
3d2dA           KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFxxxxxxx
2bvfA           ----------------------------------------------------------------------
3fwaA           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3fw9A           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3fw8A           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3fw7A           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3d2jA           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3d2hA           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
3d2dA           KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
1zr6A           ----------------------------------------------------------------------
3e0tA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxx
2bvfA           -------
3fwaA           -------
3fw9A           -------
3fw8A           -------
3fw7A           -------
3d2jA           -------
3d2hA           -------
3d2dA           -------
1zr6A           -------
3e0tA           -------