[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02517

[Show Plain Result]

#ERROR : Can't open dsspfile "2ixnA.bssp"
#ERROR : Can't open dsspfile "2ixnB.bssp"
#ERROR : Can't open dsspfile "2ixmA.bssp"
#ERROR : Can't open dsspfile "2hv6A.bssp"
#ERROR : Can't open dsspfile "2hv6B.bssp"
#ERROR : Can't open dsspfile "2g62A.bssp"
#ERROR : Can't open dsspfile "2ixpB.bssp"
#ERROR : Can't open dsspfile "2ixpA.bssp"
#ERROR : Can't open dsspfile "2ixoB.bssp"
#ERROR : Can't open dsspfile "2ixoA.bssp"

## Summary of PDB Search
:424
    5e-69  45%  2ixnA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    4e-63  45%  2ixnB  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    1e-47  35%  2ixmA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    2e-47  34%  2hv6A  [x.x.x] PROTEIN PHOSPHATASE 2A, REGULATORY SUBUNIT B
    8e-42  33%  2hv6B  [x.x.x] PROTEIN PHOSPHATASE 2A, REGULATORY SUBUNIT B
    8e-42  33%  2g62A  [x.x.x] PROTEIN PHOSPHATASE 2A, REGULATORY SUBUNIT B' (PR
    9e-36  37%  2ixpB  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    1e-34  38%  2ixpA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    6e-30  34%  2ixoB  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
    9e-28  34%  2ixoA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A
:424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFIRPVPRILSP
2ixnA           --------------------------------------------------------------PEKRLLTP
2ixnB           --------------------------------------------------------------PEKRLLTP
2ixmA           -----------------------------------------------------------FIIPKKEIHTV
2hv6A           -----------------------------------------------------------FIIPKKEIHTV
2hv6B           -----------------------------------------------------------FIIPKKEIHTV
2g62A           -----------------------------------------------------------FIIPKKEIHTV
2ixpB           ----------------------------------------------------------------------
2ixpA           ----------------------------------------------------------------------
2ixoB           ----------------------------------------------------------------------
2ixoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QDLETFLSSPAHSLIIAFVFNXXXXXXXXXXXXXXXXXXXETIRKVLSILSAIEELIDKHPSLDQNGSRF
2ixnA           DDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPIS-ESINSMMNLLSQIKDITQKHPVI----KRF
2ixnB           DDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPIS-ESINSMMNLLSQIKDITQKHPVIK---SRF
2ixmA           PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVS--EAIEKLLALLNTLDRWIDETPPVDQP-SRF
2hv6A           PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVS--EAIEKLVALLNTLDRWIDETPPVDQP-SRF
2hv6B           PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVS--EAIEKLVALLNTLDRWIDETPPVDQP-SRF
2g62A           PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVS--EAIEKLVALLNTLDRWIDETPPVDQP-SRF
2ixpB           ------------------------------------------VNGLMGVLDKLAHLIDETPPLP-GPRRY
2ixpA           ------------------------------------------VNGLMGVLDKLAHLIDETPPL-------
2ixoB           ------------------------------------------VNGLMGVLDKLAHLIDETPPLP-GPRRY
2ixoA           ------------------------------------------VNGLMGVLDKLAHLIDETPPLPG----Y


                         +         .         .         .         .         *         .:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
2ixnA           GKVEFRDFYDEVSRNS----RKILRSEFPSLLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYG
2ixnB           GKVEFRDFYDEVSRNS----RKILRSEFPSLLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYG
2ixmA           GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
2hv6A           GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
2hv6B           GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
2g62A           GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
2ixpB           GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG
2ixpA           GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG
2ixoB           GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG
2ixoA           GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG


                         .         .         .         +         .         .         .:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
2ixnA           IFNSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHN
2ixnB           IFNSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGS----GLDDYHFLPFLFGAFQLTTHKHLKPISIHN
2ixmA           VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
2hv6A           VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
2hv6B           VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPA------GLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
2g62A           VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPA------GLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
2ixpB           M-----FPHMVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQLDAQAPLQPREILD
2ixpA           M-----FPHMVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQLDAQAPLQPREILD
2ixoB           MFPHHR-GADVFLLFNKYYTIMRRLILTYTLEPAGS----GLDDHFHLVYILGSSQLDAQAPLQPREILD
2ixoA           MFPHHR-GADVFLLFNKYYTIMRRLILTYTLEPA------GLDDHFHLVYILGSSQLDAQAPLQPREILD


                         .         *         .         .         .         .         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
2ixnA           NELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHF
2ixnB           NELVEMFAHRYLYFGCIAFINKVKS---LRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHF
2ixmA           EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
2hv6A           EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
2hv6B           EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
2g62A           EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
2ixpB           KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIATVPRWSKVCKGLLKMYSVEVLKKFPVVQHF
2ixpA           KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIATVPRWSKVCKGLLKMYSVEVLKKFPVVQHF
2ixoB           KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIATVPRWSKVCKGLLKMYSVEVEKKFPVVQHF
2ixoA           KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIATVPRWSKVCKGLLKMYSVEVEKKFPVVQHF


                         .         .         .         .         *         .         .:420
query           LFGSLIPALPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ixnA           YFSEFLP---------------------------------------------------------------
2ixnB           YFSEFLP---------------------------------------------------------------
2ixmA           KFGSLLPIHP------------------------------------------------------------
2hv6A           KFGSLLPIHP------------------------------------------------------------
2hv6B           KFGSLLPIHP------------------------------------------------------------
2g62A           KFGSLLPIHP------------------------------------------------------------
2ixpB           WFGT------------------------------------------------------------------
2ixpA           WFGT------------------------------------------------------------------
2ixoB           WFGT------------------------------------------------------------------
2ixoA           WFGT------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxx
2ixnA           ----
2ixnB           ----
2ixmA           ----
2hv6A           ----
2hv6B           ----
2g62A           ----
2ixpB           ----
2ixpA           ----
2ixoB           ----
2ixoA           ----