[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02551

[Show Plain Result]

#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "2oqkA.bssp"
#ERROR : Can't open dsspfile "1jt8A.bssp"
#ERROR : Can't open dsspfile "2dgyA.bssp"

## Summary of PDB Search
:149
    1e-45  85%  1d7qA  [b.40.4] TRANSLATION INITIATION FACTOR 1A
    1e-34  74%  2oqkA  [x.x.x] PUTATIVE TRANSLATION INITIATION FACTOR EIF-1A
    6e-13  35%  1jt8A  [b.40.4] PROBABLE TRANSLATION INITIATION FACTOR 1A
    1e-06  28%  2dgyA  [x.x.x] MGC11102 PROTEIN
:149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
1d7qA           -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
2oqkA           -------------------------LVFKEEGQEYGQVQR-LGNGRLDAYCFDGQKRLCHIRGK-RKKVW
1jt8A           ----------------------------KEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIW
2dgyA           --------------------------------QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW


                         .         .         *         .         .         .         .:140
query           INQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGxxxxxxxxxxxxxxxxxx
1d7qA           INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
2oqkA           VNPGDIVLVSLRDFQDSKGDIILKYTPDEARALKSKGEIPETTKI-------------------------
1jt8A           VREGDVVIVKPWEVQDQKCDIIWRYTKTQVEWLKRKGYLDE-----------------------------
2dgyA           IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEA----------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxx
1d7qA           ---------
2oqkA           ---------
1jt8A           ---------
2dgyA           ---------