[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02563

[Show Plain Result]

#ERROR : Can't open dsspfile "3cn7A.bssp"
#ERROR : Can't open dsspfile "1fj2A.bssp"
#ERROR : Can't open dsspfile "1auoA.bssp"

## Summary of PDB Search
:287
    8e-09  34%  3cn7A  [x.x.x] CARBOXYLESTERASE
    2e-08  28%  1fj2A  [c.69.1] PROTEIN (ACYL PROTEIN THIOESTERASE 1)
    8e-07  29%  1auoA  [c.69.1] CARBOXYLESTERASE
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
3cn7A           ----------------------------IWLHGLGADRTDFKPV--------AEALQMVLPSTRFILPQA
1fj2A           ----MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSS----------HIKYICPHA
1auoA           ----------------ILQPAKPADACVIWLHGLGADRYDFMPV--------AEALQESLLTTRFVLPQA


                         .         .         *         .         .         .         .:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
3cn7A           PSQANGGWV--MPSWYDILAFSPARAIDEDQ---LNASADQVIALIDEQ-RAKGIAAERIILAGFSQGGA
1fj2A           PVRPVTLNMNAMPSWFDIIGLSPDSQEDE---SGIKQAAENIKALIDQEVKN-GIPSNRIILGGFSQGGA
1auoA           PTRINGGY--EMPSWYDIKAMSPA---RSISLEELEVSAKMVTDLIEAQ-KRTGIDASRIFLAGFSQGGA


                         +         .         .         .         .         *         .:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
3cn7A           VVLHTAF----------------------------------RRYAQPLGGVLAL--------STYAPTFD
1fj2A           LSLYTALTT----QQKLAGVTALSCWLPLRASFPQ-----------------------------------
1auoA           VVFHTAFINQGPLGGVIAL-------------------------------------------STYAPTFG


                         .         .         .         +         .         .         .:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
3cn7A           ALDERHKRI---PVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDY---------------------
1fj2A           ----------------------------------------------------------------------
1auoA           DELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYP----MGHEVL-PQEIHDIGA


                         .         *         .         .         .         .         +:350
query           FLESKxx
3cn7A           -------
1fj2A           -------
1auoA           WLAAR--