[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_02986

[Show Plain Result]

#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"

## Summary of PDB Search
:1343
      0.0  40%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
      0.0  40%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-64  33%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    2e-62  32%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    8e-57  46%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-56  39%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-55  45%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-55  45%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-55  44%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    2e-54  52%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    2e-54  45%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-54  52%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-54  52%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-54  52%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-54  52%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-53  46%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-53  46%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-53  52%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-53  52%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-53  44%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-53  45%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-50  45%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    9e-50  45%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    2e-48  44%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-48  33%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-43  46%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    4e-31  36%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    6e-30  39%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-26  39%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-26  39%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    8e-25  37%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-24  35%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-24  35%  2oukB  [x.x.x] PROTEIN ARTP
    2e-24  32%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-24  32%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-23  34%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    9e-23  29%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-23  29%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-22  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-22  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-22  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-22  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-22  30%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-22  30%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-22  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-22  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-22  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-22  34%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    8e-22  31%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-21  31%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-21  31%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-21  36%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-21  34%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-21  34%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-21  34%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-21  34%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-21  34%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-21  34%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-21  30%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-21  30%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-21  30%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  30%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  30%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  30%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  31%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    1e-20  35%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-19  30%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-19  30%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-19  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  29%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-19  35%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-18  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  30%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-18  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-18  32%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-18  30%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-18  37%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-18  33%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    7e-18  33%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-18  33%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-17  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17  34%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-17  34%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-17  34%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-17  34%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-17  32%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-17  34%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-17  32%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    5e-17  31%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    8e-17  33%  2d2eA  [x.x.x] SUFC PROTEIN
    8e-17  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-16  27%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    9e-16  27%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-15  31%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-15  31%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-15  31%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-15  30%  1ji0A  [c.37.1] ABC TRANSPORTER
    3e-14  31%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-14  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-13  34%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-13  31%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-13  35%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-13  30%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-11  32%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-11  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-10  28%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-09  33%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-09  29%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    1e-08  24%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    1e-08  29%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-08  27%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-08  33%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    4e-08  26%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-08  33%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-07  26%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    1e-07  36%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-07  36%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-07  35%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-07  35%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-07  35%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    1e-06  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-06  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-06  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-06  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-06  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-06  38%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-06  37%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-63  35%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG(query 835->1339)
    2e-53  31%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA(query 801->1337)
    1e-54  46%  2ghiA  [x.x.x] TRANSPORT PROTEIN(query 427->674)
    8e-54  45%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA(query 1090->1322)
    1e-48  41%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    1e-48  41%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    2e-51  42%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1(query 1093->1334)
    2e-50  48%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN(query 1098->1320)
    1e-47  40%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    2e-50  48%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    4e-50  48%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    4e-50  48%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    4e-50  48%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    4e-50  45%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING(query 445->674)
    4e-50  45%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING(query 445->674)
    3e-49  48%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    3e-49  48%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 1098->1320)
    4e-46  39%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    8e-46  40%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    4e-50  46%  2ghiC  [x.x.x] TRANSPORT PROTEIN(query 427->674)
    5e-48  45%  2ghiB  [x.x.x] TRANSPORT PROTEIN(query 427->674)
    1e-41  40%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1(query 1093->1334)
    4e-42  42%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA(query 1099->1320)
    3e-06  23%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA(query 801->931)
    3e-42  46%  2ghiD  [x.x.x] TRANSPORT PROTEIN(query 427->674)
    1e-21  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 439->667)
    1e-21  34%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 1105->1325)
    3e-23  38%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 1116->1326)
    3e-23  38%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 1116->1326)
    2e-22  34%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN(query 442->662)
    7e-20  33%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER(query 1098->1323)
    1e-19  33%  2oukB  [x.x.x] PROTEIN ARTP(query 1102->1323)
    3e-17  32%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 1116->1314)
    3e-17  32%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 1116->1314)
    8e-17  30%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1(query 1116->1327)
    9e-18  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 418->660)
    9e-18  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 418->660)
    2e-16  31%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-17  32%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 418->660)
    8e-17  31%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-16  31%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-16  31%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    6e-20  31%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING(query 1116->1341)
    2e-16  31%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  31%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-16  31%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-16  31%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    4e-14  34%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 1116->1314)
    2e-17  33%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING(query 442->660)
    2e-17  33%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->660)
    2e-17  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->660)
    2e-17  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->660)
    3e-17  33%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->660)
    3e-17  33%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->660)
    5e-17  30%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->664)
    8e-17  30%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    5e-17  30%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->664)
    5e-17  30%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    5e-17  30%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    5e-17  30%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    8e-19  32%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK(query 442->663)
    1e-16  34%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 443->660)
    9e-16  27%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 1105->1326)
    9e-16  27%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 1105->1326)
    2e-17  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    9e-18  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->664)
    2e-15  29%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    3e-17  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING(query 1119->1339)
    2e-15  29%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-15  29%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    2e-16  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 442->660)
    5e-13  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-15  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    9e-15  36%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 443->660)
    8e-17  31%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 442->662)
    1e-16  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID(query 442->662)
    6e-17  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 442->662)
    6e-15  31%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-15  31%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    3e-13  31%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN(query 1116->1311)
    3e-13  31%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN(query 1116->1311)
    6e-17  30%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 433->660)
    6e-17  30%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 433->660)
    2e-14  32%  1b0uA  [c.37.1] HISTIDINE PERMEASE(query 1102->1318)
    4e-13  31%  2d2fA  [x.x.x] SUFC PROTEIN(query 1098->1332)
    5e-16  33%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN(query 1115->1295)
    2e-14  33%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING(query 442->660)
    3e-12  29%  2d2eA  [x.x.x] SUFC PROTEIN(query 1098->1332)
    6e-14  30%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 445->660)
    1e-13  26%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN(query 1097->1331)
    1e-13  26%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN(query 1097->1331)
    4e-13  32%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 433->655)
    4e-13  32%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 433->655)
    6e-11  30%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 1134->1330)
    3e-12  35%  1ji0A  [c.37.1] ABC TRANSPORTER(query 1116->1329)
    7e-12  31%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 433->655)
    2e-11  31%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 433->655)
    7e-12  34%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 1112->1291)
    2e-12  29%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BINDING(query 449->663)
    1e-11  35%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 1119->1291)
    1e-10  30%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 433->655)
    8e-06  26%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN(query 1116->1311)
    2e-07  38%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 1247->1323)
    5e-06  38%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 1112->1159)
    7e-08  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD(query 453->676)
    4e-07  26%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER(query 428->633)
    7e-07  30%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 453->661)
    7e-07  26%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 1115->1332)
    6e-06  27%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 1115->1332)
    2e-05  35%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 1219->1330)
    2e-05  35%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 1219->1330)
    7e-05  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 569->669)
    7e-05  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A(query 569->669)
    7e-05  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 569->669)
    7e-05  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 569->669)
    7e-05  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.(query 569->669)
    3e-04  35%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->489)
    2e-04  37%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 593->660)
    3e-04  35%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 442->489)
:1343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3g5uA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxVKFFTLYRYATTNDIIILXXXXXXXXXXXXXXPLFTILFGQMAGTFQRIILGTISY
3g5uA           --------------VSVLTMFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASV--GNVSK
3g60A           --------------VSVLTMFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASV--GNVSK
2hydA           ----------------------------------------------------------------------
3b60A           --------------------------------------------------LILNAASDTFMLSLLKPLLD
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           --------------------------------------------------LILNAASDTFMLSLLKPLLD
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
3g5uA           NSTNMSEADKRAMFAKLXXXXXLIVAYIQVSFLAAGRQI-HKIRQKFFHAIMNQEIGWFDVHDVGELNTR
3g60A           NSTNMSEADKRAMFAKLXXXXXLIVAYIQVSFLAAGRQI-HKIRQKFFHAIMNQEIGWFDVHDVGELNTR
2hydA           --------------IAIGIALFIVIVRPPIEFIWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISR
3b60A           DGFGKTDRSVLLWMPLVVIGLMILSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSR
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           DGFGKTDRSVLLWMPLVVIGLMILSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSR
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ITADTNLIQDGISEKVGXXXXXXXXXXXXXXIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
3g5uA           LTDDVSKINEGIGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKEL
3g60A           LTDDVSKINEGIGDKIGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKEL
2hydA           VINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFILTVYVFFGRLR---KLTRERS
3b60A           ITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQ
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSII----LVVLAPIVSIAIRVVFRSISKNM
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
3g5uA           HAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAF
3g60A           HAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAF
2hydA           QALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVI
3b60A           NTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSIQLIASLALAFVLYAASF
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           QNTMGQVTTSAERLQGMKMVSASSISDPI-----------------------IQLIASLALAFVLYAASF
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           WMGSRFIVSGXXXXXXXXXXXXXXXXGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET
3g5uA           WYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHK
3g60A           WYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHK
2hydA           GVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDYDIK-NGVGAQP
3b60A           PSVMDSLTAGTITVVFSSMIALMRPLKS--LTNV--NAQ-FQRGMAACQTLFAILDSEQEKD---EGKRV
2ghiA           ----------------------------------------------------------------------
1pf4A           ---------------------------------LTSVTSEFQRGMAACQTLFGLMDLETERDNGKYEAE-
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------PSVMDSLTAGTITV---VFSSMIA----LMRPLKSLTNVNAQFQRGMA
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           -------------------------------------------------------------------GEL
1r0zA           -------------------------------------------------------------------GEL
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           -------------------------------------------------------------------GEL
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFYNPVGGSVLVD
3g5uA           PDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSID
3g60A           PDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSID
2hydA           IEIKQGRIDIDHVSFQYNDN-EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILID
3b60A           IDRATGDLEFRNVTFTYPGR-EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMD
2ghiA           ----------------------------------------------------------------------
1pf4A           --RVNGEVDVKDVTFTYQGK-EKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLD
2ixfC           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
2ixfA           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
1jj7A           ---LEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLD
1mt0A           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
2ixeA           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
2ff7A           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
2fgkA           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
2ffbA           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
3b5jA           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLID
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
2ffaA           ------DITFRNIRFRYPDSP--VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLID
2ixgA           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
2ixfD           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ---MKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD
1z2rA           AE-------FRNVTFTYPGR-EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMD
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------IQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVD
2it1B           -------------------------LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFD
2it1A           -------------------------LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFD
2yyzA           ----------------------------------------------------------------------
2oljA           -------LQMIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXN
2oukB           -----------DVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXN
1l2tB           -------IKLKNVTKTYKMGEEIIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYID
1l2tA           -------IKLKNVTKTYKMGEEIIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYID
3gfoA           -------------------------LKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFD
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           -------------------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLD
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           -------IKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVS-IGPSGSGKSTIIGCLDK---PTEGEVYID
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           -------IEVVNVSHIFHRGTEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYD
2yz2A           -------IEVVNVSHIFHRGTEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYD
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLN
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ---------------------KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD
1oxsC           ---------------------KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ------------------------VLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVN
2d2fA           -----------EIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLD
2pcjA           ------------------------ILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLE
2d62A           ----------------------------------------------------------------------
2d2eA           -----------EIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLD
2bbsA           ----------------------------------------------------------------------
1z47B           -------IEFVGVEKIYPGGARSV--RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIG
1z47A           -------IEFVGVEKIYPGGARSV--RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIG
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           -------------------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVF
1ji0A           --------------HVYYGA--IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFN
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ---------------------ENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEV-
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEV-
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ---------------------------GVNAFVPVVKVVGIVGPNGTGKSTAVKILQLIPNLCGDNDSWD
1oxxK           ---------------------KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD
2awnA           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ------------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLF
2iwhB           ----------------------------------------------------------------------
2ihyB           ------------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLF
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ------NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIG
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ------------------------ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITID
1mv5A           ------------------------ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITID
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ------NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIG
2ghiB           ------NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIG
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ------NIEFSDVNFSYHR-----TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIG
2cbzA           ------------------ARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIK
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ---------------------KVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFD
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           LEKVQKHSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0zA           LEKVQKHSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0xB           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0xA           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0zB           LEKVENNVSFSHLCLV--GNP---VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1xfaA           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1xf9B           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1xf9A           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1q3hD           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1q3hC           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0wC           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
3d31A           ----------------------------------------------------------------------
1r10A           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0zD           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0xD           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0xC           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0wB           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1r0wA           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1q3hB           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1q3hA           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1xf9D           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1xf9C           ------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1f3oA           ----------------------------------------------------------------------
1q12A           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
3fh6A           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2awoA           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2awnB           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2r6gB           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2r6gA           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2pzgA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2pzeB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2pzeA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1xmiE           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1xmiC           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1xmiA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1g291           ---------------------EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIG
2awoC           ----------------------VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2pzfA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2bboA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2onkA           ----------------------------------------------------------------------
1xmiD           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2pzgB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1xmjA           ---------------------ETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1xmiB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2bbtA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2awnC           ----------------------VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRM---------------
1g6hA           ---------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFE
1gajA           ---------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFE
1g9xA           ---------------------EFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFE
2bbtB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
2bbsB           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ------------IGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLS
3fvqA           ------------IGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLS
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ---------------------DVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYIE
2d2eA           ----------------------------------------------------------------------
2bbsA           ------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ------------IKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFK
2d3wA           ------------IKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFK
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ------------IKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFK
2d3wD           ------------IKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFK
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------LNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFG
2nq2D           ----------------------------------------------------------------------
2d3wC           ------------IKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFK
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           --------------------------------VRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFA
1sgwA           -------LEIRDLSVGY-DKP---VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYN
1l7vC           --------------------------------VRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFA
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-
2awnD           ----------------------------------------------------------------------
2awnD           ---------------------EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI-


                         *         .         .         .         .         +         .:560
query           GVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQSVRQRIENAAKMANAHDFIMG
3g5uA           GQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGR---------EDVTMDEIEKAVKEANAYDFIMK
3g60A           GQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGR---------EDVTMDEIEKAVKEANAYDFIMK
2hydA           GHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENI---LLGRPTATD------EEVVEAAKMANAHDFIMN
3b60A           GHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYA--------RTEEYSREQIEEAARMAYAMDFINK
2ghiA           ----------------------------------------------------------------------
1pf4A           GHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEG--------EYTREQIEQAARQAHAMEFIEN
2ixfC           GEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
2ixfA           GEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
1jj7A           GKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKP--------TMEEITAAAVKSGAHSFISG
1mt0A           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
2ixeA           GEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
2ff7A           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
2fgkA           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
2ffbA           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
3b5jA           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
2ffaA           GHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLA--------NPGMSV-EKVIYAAKLAGAHDFISE
2ixgA           GEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
2ixfD           GEPLVQYDHHYLHTQVAAVGQ--LLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           GEPLVQYDHHYLHTQVAAVG--PLLFGRSFRENIAYGLTRTP--------TMEEITAVAMESGAHDFISG
1z2rA           GHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYA--------RTEEYSREQIEEAARMAYAMDFINK
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           GQELTTLSLTKARRQIGMIFQHFNLLSSTVFGNV-----ALPLELDPKDEVKRRVTELLSL-------VG
2it1B           EKDVTELPPK--DRNVGLVFQNWALYPMTVYKNI-----AFPLELRPREEIDKKVREVAKMLHIDKLLNR
2it1A           EKDVTELPPK--DRNVGLVFQNWALYPMTVYKNI-----AFPLELRPREEIDKKVREVAKMLHIDKLLNR
2yyzA           ----------------------------------------------------------------------
2oljA           -LKAKDTNLNKVREEVGMVFQRFNLFPMTVLNNITL----APMKVR--KWPREKAE--AKAMELLDKV-G
2oukB           -LKAKDTNLNKVREEVGMVFQRFNLFPMTVLNNITL----APMKVR--KWPREKAE--AKAMELLDKV-G
1l2tB           NIKTNDLDTKIRRDKIGFVFQQFNLIPLTALENVELPLIFKYRGAMSGEERRKRALECLKMAE-------
1l2tA           NIKTNDLDTKIRRDKIGFVFQQFNLIPLTALENVELPLIFKYRGAMSGEERRKRALECLKMAE-------
3gfoA           NIDYSRKGIMKLRESIGIVFQDPDLFSASVYQDVSFGAVNMKL---PEDEIRKRVDNALKRTG----IEH
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           GKDVTDLSPE--KHDIAFVYQNYSLF--------------------PHMNVKKNLEFGMRMKKIKDPKRV
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           NIKTNDLDTKIRRDKIGFVFQQFNLIPLTALENVELPLI---FKYR-GASGEERRKRALECLKAE-----
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           GERKKGYEI---RRNIGIAFQYPEFFAERVFDEVAFAVKNFYPDRDPVPLVKKAME-----------FVG
2yz2A           GERKKGYEI---RRNIGIAFQYPEFFAERVFDEVAFAVKNFYPDRDPVPLVKKAME-----------FVG
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           GADITPLPPE--RRGIGFVPQDYALFPLSVYRNIAYGLXXXXXXXXXXXXXXM----AEKLGIAH-----
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           DRLVAS-NGKLIDRKIGMVFQTWALYNLTAFENIAFPLTNMKMSKE---EIRKRVEEVAKILDIHHVLNH
1oxsC           DRLVAS-NGKLIDRKIGMVFQTWALYNLTAFENIAFPLTNMKMSKE---EIRKRVEEVAKILDIHHVLNH
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           G---QNINLRLLRTRLTMVFQHFNLWSMTVLENVMEA---------PIQVLGLSKHDARERALKYLAKVG
2d2fA           GENILELSPERARKGLFLAFQYPVVPGVTIANFLRLAL---QAKLGREVGVAEFWTKVKKALELLDW---
2pcjA           GKEVDYTNEKELNRKLGFVFQELTALENVIVPMLKMG--------KPKKEAKERGEYLLSE-------LG
2d62A           ----------------------------------------------------------------------
2d2eA           GENILELSPERARKGLFLAFQYPVVPGVTIANFLRLAL---QAKLGREVGVAEFWTKVKKALELLDWDES
2bbsA           ----------------------------------------------------------------------
1z47B           GKRVTDLPPQ--KRNVGLVFQNYALFHMTVYDNVSFGL---REKRVPKDEMDARVRELLRFMRLESYANR
1z47A           GKRVTDLPPQ--KRNVGLVFQNYALFHMTVYDNVSFGL---REKRVPKDEMDARVRELLRFMRLESYANR
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           GKNVVEEPHE-VRKLISYLPEEAGAYRNM--QGIEYLRFVAGFYASSSSEIEEMVERATEIA-------G
1ji0A           GQDITNKPAHVINRGIALVPEGRRIFELTVYENL------GAYNRKDKEGIKRDLE----------WIFS
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ------------YQSIGFV---PQFFSSPFYSVLDIVLMGRSTHI-----------NTFAKPKSHDYMQA
1v43A           ----------------------------------------------------------------------
2nq2D           ------------YQSIGFV---PQFFSSPFYSVLDIVLMGRSTHI-----------NTFAKPKSHDYMQA
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           GVELQNYFEKLKNGEIRPVVKPQYV------DLIPKAVKGKVIEL-----LKKADETGKXXXXXXXXXXX
1oxxK           DRLVASLIVPPEDRKIGMVFQTWALYNLTAFENIAFPLTNMKMSKE---EIRKRVEEVAKILDIHHVLNH
2awnA           --------------EKRMNDTPPAERGV--------GMVFQSYALEV---INQRVNQVAEV---------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           GK--PGYSAETVRQHIGFVSHEKFQEGERVIDVVISGAI--------DDEIRNEAHQLLKLVGS------
2iwhB           -----------------------------------------------------------KEIEEHCSMLG
2ihyB           GKPGKGYSAETVRQHIGFVSHEKFQEGERVIDVVISGAFKSGVYQDIDDEIRNEAHQLLKLVGS------
2ix3A           -----------------------------------------------------------KEIEEHCSMLG
2pjzA           ----------------------------------------------------------------------
2r6fB           --------------------------------------------------------------DALDFFAS
2r6fA           --------------------------------------------------------------DALDFFAS
2ix8A           --------------------------------------------------------------------LG
2iw3B           --------------------------------------------------------------------LG
2iw3A           --------------------------------------------------------------------LG
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           GKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDE---------EVIKATKSAQLYDFIEA
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           GQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGD----YTDEDLWQVLD----LAFARSFVEN
1mv5A           GQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGD----YTDEDLWQVLD----LAFARSFVEN
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           GKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATEE----------VIKATKSAQLYDFIEA
2ghiB           GKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKL---------DATDEEVIKATKSAQLYDFIEA
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           GKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDE---------EVIKATKSAQLYDFIEA
2cbzA           GSVAYVPQQAWI-QNDSL--RENILFGCQLEEPYYRSVIQA-CALLPDLEI-------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           DVLVNDIPPKY--REVGMVFQNYALYPMTVFENIAFPLRAR--RISKDEVEKRVVEIARKL-----LIDN
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0zA           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0xB           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0xA           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0zB           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1xfaA           G-------------RVSFCSQFSWIMPGTIKENIIRGVSYDEY----------RYKSVVKACQLQQDITK
1xf9B           G-------------RVSFCSQFSWIMPGTIKENIISGVSYDEY----------RYKSVVKACQLQQDITK
1xf9A           G-------------RVSFCSQFSWIMPGTIKENIISGVSYDEY----------RYKSVVKACQLQQDITK
1q3hD           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1q3hC           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0wC           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
3d31A           ----------------------------------------------------------------------
1r10A           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0zD           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0xD           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0xC           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0wB           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1r0wA           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1q3hB           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1q3hA           G-------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY----------RYKSVVKACQLQQDITK
1xf9D           G-------------RVSFCSQFSWIMPGTIKENIISGVSYDEY----------RYKSVVKACQLQQDITK
1xf9C           G-------------RVSFCSQFSWIMPGTIKENIISGVSYDEY----------RYKSVVKACQLQQDITK
1f3oA           ----------------------------------------------------------------------
1q12A           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
3fh6A           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2awoA           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2awnB           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2r6gB           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2r6gA           GEKRMN-DTPPAERGVGMVFQSYALYHLSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2pzgA           G-------------RISFCSQFSWIMPGTIKENIIFGVSYDEY----------RYRSVIKACQLEEDISK
2pzeB           G-------------RISFCSQFSWIMPGTIKENIIFGVSYDEY----------RYRSVIKACQLEEDISK
2pzeA           G-------------RISFCSQFSWIMPGTIKENIIFGVSYDEY----------RYRSVIKACQLEEDISK
1xmiE           G-------------RISFCSQFSWIMPGTIKENIIAGVSYDEY----------RYRSVIKACQLEEDISK
1xmiC           G-------------RISFCSQFSWIMPGTIKENIIAGVSYDEY----------RYRSVIKACQLEEDISK
1xmiA           G-------------RISFCSQFSWIMPGTIKENIIAGVSYDEY----------RYRSVIKACQLEEDISK
1g291           DKLVKGIFVPPKDRDIAMVFQSYALYPMTVYDNI-----AFPLKLRPRQEIDQRVREVAELLGLTELLNR
2awoC           GEKRMN-DTPPAERGVGMVALYPHL---SVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           G-------------RISFCSQ----FSWIMPGTIKENIIGVSYD-------EYRYRSVIKACQLEEDISK
2pzfA           G-------------RISFCSQ----FSWIMPGTIKENIIGVSYD-------EYRYRSVIKACQLEEDISK
2bboA           G-------------RISFCSQFSWIMPGTIKENIIFGVSYDEY----------RYRSVIKACQLEEDISK
2onkA           ----------------------------------------------------------------------
1xmiD           G-------------RISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG
2pzgB           G-------------RISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG
1xmjA           G-------------RISFCSQ----FSWIMPGTIKENIIGVSYD-------EYRYRSVIKACQLEEDISK
1xmiB           G-------------RISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKIV--------
2bbtA           G-------------RISFCSQNSWIMPGTI----KENIIGVSYDEYRYRSVIQLEEDISKFAEKDNIVLG
2awnC           ---IAGLGVGMVFQSYALYPH------LSVAENMSFGLAGAKKEV-----INQRVNQVAEVLQLAHLLDR
1g6hA           NKDITNKEAELYHYGIVRTFQTPPLKEMTVLENLLIGEINSLFYKKWIPKEEEMVEKAFKILE----FLK
1gajA           NKDITNKEPAELYHQTPQPLKEMTVLENLLIGEINPGPLNSLFYKKWIPKEEEMVEKAFKILE----FLK
1g9xA           NKDITNKEPAELYHQTPQPLKEMTVLENLLIGEINPGPLNSLFYKKWIPKEEEMVEKAFKILE----FLK
2bbtB           G-------------RISFCSQNSWIMPGTI----KENIIGVSYDEYRYRSVIQLEEDISKFAEKDNIVLG
2bbsB           G-------------RISFCSQNSWIMPGTI----KENIIGVSYDEYRYRSVIQLEEDISKFAEKDNIVLG
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           GKTIKNTNLPVRERRLGYLVQEGVLFHLTVYRNIAYGLGNGKGRTAQE---RQRIEAMLELTGISELAGR
3fvqA           GKTIKNTNLPVRERRLGYLVQEGVLFHLTVYRNIAYGLGNGKGRTAQE---RQRIEAMLELTGISELAGR
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           DADPEKGVFVPPKERDVAVFQSYALYPHTVYDNI-----AFPLKLRPKQEIDKRVREVAEL--------G
2d2eA           ----------------------------------------------------------------------
2bbsA           G-------------RISFCSQNSWIMPGTI----KENIIGVSYDEYRYRSVIQLEEDISKFAEKDNIVL-
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           GKDLLALSPERAGEGIFMAFQYPVFFLQTALNAVRSYRGQETLDRFDFQDLMEE-----KIA-----LLK
2d3wA           GKDLLALSPERAGEGIFMAFQYPVFFLQTALNAVRSYRGQETLDRFDFQDLMEE-----KIA-----LLK
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           GKDLLALSPERAGEGIFMAFQYPVFFLQTALNAVRSYRGQETLDRFDFQDLMEE-----KIA-----LLK
2d3wD           GKDLLALSPERAGEGIFMAFQYPVFFLQTALNAVRSYRGQETLDRFDFQDLMEE-----KIA-----LLK
2nq2C           ----------------------------------------------------------------------
1v43A           DRDVTYLPPK--DRNISMVFQH-----MTVYEN-----IAFPLKKFPKDEIDKRVRWAAELLQIEELLNR
2nq2D           ----------------------------------------------------------------------
2d3wC           GKDLLALSFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEE-----KIA-----LLK
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           GQPLEAWSATKLALHRAYLSQQQTPFATPVWHYL---------------TLHQHDKTRTELLNDVAGALA
1sgwA           GVPITKVKGKFLPEEIIV----PRKISVEDYLKAVASLYGVKVNKNEIMDALESVE-----------VLD
1l7vC           GQPLEAWSATKLALHRAYLSQQQTPFATPVWHYL---------------TLHQHDKTRTELLNDVAGALA
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIII
3g5uA           LPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDT----------------------
3g60A           LPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDT----------------------
2hydA           LPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIV
3b60A           MDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVI
2ghiA           ----------------------------------------------------------------------
1pf4A           MPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVI
2ixfC           FPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLI
2ixfA           FPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLI
1jj7A           LPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPESRSVLLI
1mt0A           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII
2ixeA           FPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLI
2ff7A           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII
2fgkA           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIII
2ffbA           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIII
3b5jA           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII
2ffaA           LREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII
2ixgA           FPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLI
2ixfD           FPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLI
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           FPQGYDTEV-----QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLI
1z2rA           MDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVI
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           LGDKHDSYPSN----LSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRGLTILLI
2it1B           YP-----------WQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKGITTVYV
2it1A           YP-----------WQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKGITTVYV
2yyzA           ----------------------------------------------------------------------
2oljA           LKDKAHAYPDS----LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQANEGMTMVVV
2oukB           LKDKAHAYPDS----LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQANEGMTMVVV
1l2tB           LEERFANHKPNQ---LSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEGKTVVVV
1l2tA           LEERFANHKPNQ---LSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEGKTVVVV
3gfoA           LKDK-PTHC------LSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKGXXXXXX
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           LDTKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNTVLHI
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           LEERFANHKPNQ---LSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQKKLNE-EDGKTVVVV
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           LD--FDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKKTLGKTVILI
2yz2A           LD--FDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKKTLGKTVILI
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           -------LLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPIV
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           FPRE-----------LSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSGVTLLVV
1oxsC           FPRE-----------LSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSGVTLLVV
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           IDERAQ---GKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQAEEGKTMVVV
2d2fA           -DESYLSRYLNEGF--SGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVN-AMRGPNALVI
2pcjA           LGDK----LSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVV
2d62A           ----------------------------------------------------------------------
2d2eA           YLSRY----------LNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVN-AMRGPNALVI
2bbsA           ----------------------------------------------------------------------
1z47B           FPHE-----------LSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVEMGVTSVFV
1z47A           FPHE-----------LSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVEMGVTSVFV
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           LGEKIKDRVST----YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASEGLTILVS
1ji0A           LFPRLKERLKQLGGTLSGGE-QQLAIGRAL-SRPK--LLDEPSLGLAPILVSEVFEVIQKINQEGTTILL
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           LDYLNLTHLAKREFTLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDQSQNMTVVFT
1v43A           ----------------------------------------------------------------------
2nq2D           LDYLNLTHLAKREFTLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDQSQNMTVVFT
2d3wC           ----------------------------------------------------------------------
3bk7A           ---------------LSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRANEGKAVLVV
1yqtA           XXXXREIQH------LSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRNAARAIRRLSEEGKSVLVV
1oxxK           FPRE-----------LSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSGVTLLVV
2awnA           -----------------------LAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           --AKAQQYIG----YLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYV
2iwhB           LDPEIVSHSRIRG--LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG--VIII
2ihyB           --AKAQQYIG----YLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYV
2ix3A           LDPEIVSHSRIRG--LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG--VIII
2pjzA           ----------------------------------------------------------------------
2r6fB           IPKKLETKLGQPATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRVDNGDTVLVI
2r6fA           IPKKLETKLGQPATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRVDNGDTVLVI
2ix8A           LDPEIVSHSRIRG--LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG--VIII
2iw3B           LDPEIVSHSRIRG--LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG--VIII
2iw3A           LDPEIVSHSRIRG--LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG--VIII
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           LPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIII
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           MPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI
1mv5A           MPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           LPKKWDTIVG--GMKL--GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIII
2ghiB           LPKKWDTIVGNK-MKLSGGERQRIAIARCLLKDPKIVIFDEATS--DSKTEYLFQKAVEDLRKNRTLIII
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           LPKKWDTIV------LSGGERQRIAIARCLLKDPKIVIFD------DSKTEYLFQKAVED---NRTLIII
2cbzA           LPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHGKHIFENVIGPKGKNKTRILV
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           LLDRKPTQ-------LSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQGITSVYV
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0zA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0xB           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0xA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0zB           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1xfaA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1xf9B           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1xf9A           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1q3hD           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1q3hC           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0wC           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
3d31A           ----------------------------------------------------------------------
1r10A           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0zD           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0xD           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0xC           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0wB           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1r0wA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1q3hB           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1q3hA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1xf9D           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1xf9C           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILV
1f3oA           ----------------------------------------------------------------------
1q12A           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
3fh6A           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2awoA           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2awnB           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2r6gB           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKGRTMIYV
2r6gA           KPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKGRTMIYV
2pzgA           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2pzeB           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2pzeA           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1xmiE           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1xmiC           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1xmiA           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1g291           KPRE-----------LSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRGVTTIYV
2awoC           KPKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2pzfA           FAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2bboA           FAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2onkA           ----------------------------------------------------------------------
1xmiD           ------------EITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2pzgB           IT-------------LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1xmjA           FAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1xmiB           -------------LTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2bbtA           ------------GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2awnC           KPKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
1g6hA           LSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVPGLAHDIFNHVLELKAKGITFLII
1gajA           LSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDQPIAGVPGLAHDIFNHVLELKAKGITFLII
1g9xA           LSHLYDRKAGE----LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVPGLAHDIFNHVLELKAKGITFLII
2bbtB           IT-------------LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
2bbsB           ------------GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           YPHE-----------LSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAAANGKSAVFV
3fvqA           YPHE-----------LSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAAANGKSAVFV
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           LTELLNRKPRE----LSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKLR-VKRAELKKLQRGVTTIYV
2d2eA           ----------------------------------------------------------------------
2bbsA           -------------ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILV
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           MPEDLLTRSVNVGF--SGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGRSFIIV
2d3wA           MPEDLLTRSVNVGF--SGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGRSFIIV
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           MPEDLLTRSVNVGF--SGGEKKRNDILQMAVLEPELCILDESDS-LDIDALKVVADGVNSLRDGKRSFII
2d3wD           MPEDLLTRSVNVGF--SGGEKKRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGRSFIIV
2nq2C           ----------------------------------------------------------------------
1v43A           YPAQ-----------LSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLTTIYV
2nq2D           ----------------------------------------------------------------------
2d3wC           MPEDLLTRSVNVGF--SGGEKKRNDILQMAVLEPELCILDESD---DIDALKVVADGVNSLRDGRSFIIV
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           LDDK----LGRSTNQLSGGEWQRVRLAAVVLANPQLLLLDEPNS-LDVAQQSALDKILSALSQQGLAIVS
1sgwA           LKKK----LGE----LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVII
1l7vC           LDDK----LGRSTNQLSGGEWQRVRLAAVVLANPQLLLLDEPNS-LDVAQQSALDKILSALCQQGLAIVS
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           --------LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKVDAGNTVIAV
2vf8A           --------LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKVDAGNTVIAV
2vf7C           --------LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKVDAGNTVIAV
2vf7B           --------LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKVDAGNTVIAV
2vf7A           --------LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKVDAGNTVIAV
2awoD           ----------------------------------------------------------------------
2awnD           --------------------------------EPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYV
2awnD           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AHRLSTIKTADNIVVLVDGRIVEQGTHDELVERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDA
3g5uA           -----------------ESEAVVQAALDKAREGRTT---IVIAHRLSTVRNADVIAGFDGGVIVEQGNHD
3g60A           -----------------ESEAVVQAALDKAREGRTT---IVIAHRLSTVRNADVIAGFDGGVIVEQGNHD
2hydA           AHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL------------------------
3b60A           AHRLSTIEQAXXXXXXXXXXXXXRGTHSELLAQHGVYAQLHKMQ--------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           AHRLSTIEQADEILVVDEGEIIERGRH-------------------------------------------
2ixfC           THQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
2ixfA           THQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
1jj7A           TQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQA---------------------------
1mt0A           AHRLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
2ixeA           TQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
2ff7A           AHRLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
2fgkA           AHRLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
2ffbA           AHRLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
3b5jA           AHRLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           AARLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
2ffaA           AARLSTVKNADRIIVMEKGKIVEQGKH-------------------------------------------
2ixgA           TQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
2ixfD           THQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           TQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA---------------------------
1z2rA           AHRLSTIEQAXXXXXXXXXXXXXRGTH-------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           THEMDVVKICDCVAVISNGELIEQDTVSEVFSHPKTPL--------------------------------
2it1B           THQAEALAMADRIAVIREGEILQVGTPDEV----------------------------------------
2it1A           THQAEALAMADRIAVIREGEILQVGTPDEV----------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           THEMGFAREVGDRVLFMDGYIIEEGKPEDLFDR-------------------------------------
2oukB           THEMGFAREVGDRVLFMDGYIIEEGKPEDLFDR-------------------------------------
1l2tB           THDINVARFGERIIYLKDGEV-------------------------------------------------
1l2tA           THDINVARFGERIIYLKDGEV-------------------------------------------------
3gfoA           XXXXXXVPLCDNVFVMKEGRVILQGNPKEV----------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           THDQTEARMADRIAVVMDGKLIQVGKPEEIFEK-------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           THDINVARFGERIIYLKDGEV-------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           SHDIETINHVDRVVVLEKGKKVFDGTRMEFLERFFTSKMLVMRRLVLKGEDPFSMSDDE-----------
2yz2A           SHDIETINHVDRVVVLEKGKKVFDGTRMEFLERFFTSKMLVMRRLVLKGEDPFSMSDDE-----------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           THDLEAAMLADEVAVMLNGRIVEKGKLKELFSKNGEVAEFLSARNL------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           SH--------------------------------------------------------------------
1oxsC           SH--------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           THEMGFARVSSHVIFLHQGKIEEEGDPEQV----------------------------------------
2d2fA           THRILNYIQPDKVHVMMDGRVVATG---------------------------------------------
2pcjA           THERELAELTHRTLEMKDGKVVGEIT--------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           THRILNYIQPDKVHVMMDGRVVATG---------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           THQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGT----------------------------------
1z47A           THQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGT----------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           SHNMLEVELCDRIALIHNGTIVETGTVEELKER-------------------------------------
1ji0A           VEQLGALKVAHYGYVLETGQIVLEGKASELLDNE------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           THQPNQVVAIANKTLLLN----------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           THQPNQVVAIANKTLLLN----------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           EHDLAVLDYLSDVIHVVYG---EPGVYGIFSKPKGT----------------------------------
1yqtA           EHDLAVLDYLSDIIHVVYG---EPGVYGIFSQPKGT----------------------------------
1oxxK           SH--------------------------------------------------------------------
2awnA           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           THFIEEIANFSKILLLKDGQSIQQGAVEDILENSRFFQKNVAVQRWNNRFSA------------------
2iwhB           THSAEFTKNTEEVWAVKDGRMTPSG---------------------------------------------
2ihyB           THFIEEIANFSKILLLKDGQSIQQGAVEDILENSRFFQKNVAVQRWNNRFSA------------------
2ix3A           THSAEFTKNTEEVWAVKDGRM-------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           EHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEHTGRYLKILERDRARQAR--------------------
2r6fA           EHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEHTGRYLKILERDRARQAR--------------------
2ix8A           THSAEFTKNTEEVWAVKDGR--------------------------------------------------
2iw3B           THSAEFTKNTEEVWAVKDGR--------------------------------------------------
2iw3A           THSAEFTKNTEEVWAVKDGR--------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           AHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQ--------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           AHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQ--------------------------
1mv5A           AHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQ--------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           AHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQ--------------------------
2ghiB           AHR--TISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQ--------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           AHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQ--------------------------
2cbzA           THSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAF---------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           THQAEAMTMASRIAVFNQGKLVQYGTPDEVYD--------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0zA           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0xB           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0xA           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0zB           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1xfaA           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1xf9B           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1xf9A           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1q3hD           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1q3hC           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0wC           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0zD           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0xD           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0xC           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0wB           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1r0wA           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1q3hB           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1q3hA           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1xf9D           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1xf9C           TSKMEHLRKADKILILHQGSSYFYGTFSEL----------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
3fh6A           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2awoA           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2awnB           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2r6gB           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2r6gA           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2pzgA           TSKMEHLKKADKILILHEGSSYFYGTFSELQNPD------------------------------------
2pzeB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2pzeA           TSKMEHLKKADKILILHEGSSYFYGTFSELQNLD------------------------------------
1xmiE           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1xmiC           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1xmiA           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1g291           THQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDK-------------------------------------
2awoC           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2pzfA           TSKMEHLKKADKILILHEGSSYFYGTFSELQNLD------------------------------------
2bboA           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2pzgB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1xmjA           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1xmiB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2bbtA           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2awnC           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
1g6hA           EHRLDVLNYIDHLYVMFNGQIIAEGRGEEEIK--------------------------------------
1gajA           EHRLDVLNYIDHLYVMFNGQIIAEGRGEEEIK--------------------------------------
1g9xA           EHRLDVLNYIDHLYVMFNGQIIAEGRGEEEIK--------------------------------------
2bbtB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
2bbsB           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           SHREEALQYADRIAVMKQGRILQTASPHEL----------------------------------------
3fvqA           SHREEALQYADRIAVMKQGRILQTASPHEL----------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           TH--DQVEATGDRIAVNKGELQQVGTPDEV----------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           TSKMEHLKKADKILILHEGSSYFYGTFSEL----------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           THRILDYIKPDYVHVLYQGRIVKSG---------------------------------------------
2d3wA           THRILDYIKPDYVHVLYQGRIVKSG---------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           VYRILDYIKPDYVHVLYQGRIVKSG---------------------------------------------
2d3wD           THRILDYIKPDYVHVLYQGRIVKSG---------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           THQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLR-------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           THRILDYIKPDYVHVLYQGRIVKSG---------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           SHDLNTLRHAHRAWLLKGGKLAEVLTPPNLAQAYGNFRRLIEGHRL------------------------
1sgwA           SSR-------------------------------------------------------------------
1l7vC           SHDLNTLRHAHRAWLLKGGKLA-SGRREEVL---------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           EHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSYLR-------------------------------
2vf8A           EHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSYLR-------------------------------
2vf7C           EHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSYLR-------------------------------
2vf7B           EHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSYLR-------------------------------
2vf7A           EHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSYLR-------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           THQVEAMTLADKIVVLDAGRVAQVGKPLEL----------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           DALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSVILSKREPEKDKEYGLGTLIKFISSFNAAEW
3g5uA           ELMR----------------EKGIYFKLVMTQTL---------------DEDVPPASFWRILK-LNSTEW
3g60A           ELMR----------------EKGIYFKLVMTQTL---------------DEDVPPASFWRILK-LNSTEW
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           KLMVTGLAVSIICGAGQPTMAVFFSKCISALALPPPLYDKLRSDANFWCLMFLMLGIVMFFAYSIQGSLF
3g5uA           PYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPP-ETQRQNSNXXXXXXXXXXXXXXXXXXXQGFTF
3g60A           PYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPP-ETQRQNSNXXXXXXXXXXXXXXXXXXXQGFTF
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ------------------------------ISLLKPLLDEGNAESNFLRILFMILGLM--FVRGLSGFAS
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------IRQYLA
3b60A           ------------------------------LSLLKPLLDDGFGKTDRSVLLWMPLVVILMILRGITSYIS
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ------------------------------LSLLKPLLDDGFGKTDRSVLLWMPLVVILMILRGITSYIS
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASM
3g5uA           GKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGI
3g60A           GKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGI
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           SYCSGNVVMQMRRRLFNHFMHMPVRFFD--QESTGGLLSRITYDSEQVAGATSRALVSIVREGASIIGLL
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           QWTSNKILYDIRKKLYNHLQALSARFYA--NNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIAL
3b60A           SYCSGKVVMTMRRRLFGHMMGMPVAFFD--KQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLF
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           SYCSGKVVMTMRRRLFGHMMGMPVAFFD--KQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLF
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRXXXXXXXXXXXXXXXXXXIRTVASLTREPDVS
3g5uA           IISLIYGWQLTXXXXXXXXXXXXXXXXEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFE
3g60A           IISLIYGWQLTXXXXXXXXXXXXXXXXEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFE
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           TLMFWNSWQLSLVLIVVAPVV-------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           SIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEA
3b60A           IMMFYYSWQLSIILVVLAPIVIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRF
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           IMMFYYSWQLSIILVVLAPIV-------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           GTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTLLGKGEYTLFQFFLAFSEVIFGAQS
3g5uA           TMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAAAFRFGAYLVTQQLMTFENVLLVFSAIVFGAMA
3g60A           TMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMA
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2hydA           KNFDKK----NTNFLTRALKHTRWNAYSFAAINTVTDIG---PIIVIGVGAYL----------AISGSIT
3b60A           DKVSNKMRLQGMKSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITV-----VFSSMIALMRP
2ghiA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           AGTVFSFAPDMGKAKSAAADFKKLFDRRPPIDTLSKEGDDVEHIEGTIEFRDVHFRYPTRPEQPVLRGLN
3g5uA           VGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLS
3g60A           VGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLS
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           -----------------------------------------------IEFSDVNFSYPKQTNHRTLKSIN
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           --------------------------------------------------RHVDFAYDD--SEQILRDIS
1mv5A           --------------------------------------------------RHVDFAYDD--SEQILRDIS
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiC           -----------------------------------------------IEFSDVNFSYPKQTNHRTLKSIN
2ghiB           -----------------------------------------------IEFSDVNFSYPKQTNHRTLKSIN
2ixeD           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           -----------------------------------------------IEFSDVNFSY-----HRTLKSIN
2cbzA           ----------------------------------------------SITVRNATFTW-ARSDPPTLNGIT
3dhwC           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2yyzA           -------------------------------------------------------------------GVS
2oljA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1r0zC           -------------------------------------GELLEKVQKHSDENNVSFSHLCLVGNPVLKNIN
1r0zA           -------------------------------------GELLEKVQKHSDENNVSFSHLCLVGNPVLKNIN
1r0xB           --------------------------------------------EGFGELLEKSFSHLCLVGNPVLKNIN
1r0xA           --------------------------------------------EGFGELLEKSFSHLCLVGNPVLKNIN
1r0zB           -------------------------------------GELLEKVKHSDE-NNVSFSHLCLVGNPVLKNIN
1xfaA           --------------------------------------------EGFGELLEKSFSHLCLVGNPVLKNIN
1xf9B           --------------------------------------------EGFGELLEKSFSHLCLVGNPVLKNIN
1xf9A           --------------------------------------------EGFGELLEKSFSHLCLVGNPVLKNIN
1q3hD           --------------------------------------------EGFGELLEKVFSHLCLVGNPVLKNIN
1q3hC           --------------------------------------------EGFGELLEKVFSHLCLVGNPVLKNIN
1r0wC           ----------------------------------------------------VQFSHLCLVGNPVLKNIN
3d31A           ----------------------------------------------------------------------
1r10A           ---------------------------------------------------------------PVLKNIN
1r0zD           ---------------------------------------------------------------PVLKNIN
1r0xD           ---------------------------------------------------------------PVLKNIN
1r0xC           ---------------------------------------------------------------PVLKNIN
1r0wB           ---------------------------------------------------------------PVLKNIN
1r0wA           ---------------------------------------------------------------PVLKNIN
1q3hB           ---------------------------------------------------------------PVLKNIN
1q3hA           ---------------------------------------------------------------PVLKNIN
1xf9D           ---------------------------------------------------------------PVLKNIN
1xf9C           ---------------------------------------------------------------PVLKNIN
1f3oA           ----------------------------------------------------------------------
1q12A           -------------------------------------------------------------EVVVSKDIN
3fh6A           -------------------------------------------------------------EVVVSKDIN
2awoA           -------------------------------------------------------------EVVVSKDIN
2awnB           -------------------------------------------------------------EVVVSKDIN
2r6gB           -------------------------------------------------------------EVVVSKDIN
2r6gA           -------------------------------------------------------------EVVVSKDIN
2pzgA           ---------------------------------------------------------------PVLKDIN
2pzeB           ---------------------------------------------------------------PVLKDIN
2pzeA           ---------------------------------------------------------------PVLKDIN
1xmiE           ---------------------------------------------------------------PVLKDIN
1xmiC           ---------------------------------------------------------------PVLKDIN
1xmiA           ---------------------------------------------------------------PVLKDIN
1g291           -------------------------------------------------------------EVTAVREMS
2awoC           ----------------------------------------------------------------VSKDIN
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfB           ---------------------------------------------------------------PVLKDIN
2pzfA           ---------------------------------------------------------------PVLKDIN
2bboA           ---------------------------------------------------------------PVLKDIN
2onkA           ----------------------------------------------------------------------
1xmiD           ---------------------------------------------------------------PVLKDIN
2pzgB           ---------------------------------------------------------------PVLKDIN
1xmjA           -------------------------------------------------------------ETPVLKDIN
1xmiB           ---------------------------------------------------------------PVLKDIN
2bbtA           ---------------------------------------------------------------PVLKDIN
2awnC           ----------------------------------------------------------------VSKDIN
1g6hA           -------------------------------------------------------------EFKALDGVS
1gajA           -------------------------------------------------------------EFKALDGVS
1g9xA           -------------------------------------------------------------EFKALDGVS
2bbtB           ---------------------------------------------------------------PVLKDIN
2bbsB           ----------------------------------------------------------------VLKDIN
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3fvqB           ---------------------------------------------------------------PVLNDIS
3fvqA           ---------------------------------------------------------------PVLNDIS
1b0uA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2d62A           -----------------------------------------------------------------VKDLS
2d2eA           ----------------------------------------------------------------------
2bbsA           ---------------------------------------------------------------PVLKDIN
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2zu0C           -----------------------------------------------LSIKDLHVSVE---DKAILRGLS
2d3wA           -----------------------------------------------LSIKDLHVSVE---DKAILRGLS
1vplA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           -----------------------------------------------LSIKDLHVSVE---DKAILRGLS
2d3wD           -----------------------------------------------LSIKDLHVSVE---DKAILRGLS
2nq2C           ----------------------------------------------------------------------
1v43A           --------------------------------------------------------------------LN
2nq2D           ----------------------------------------------------------------------
2d3wC           -----------------------------------------------LSIKDLHVSVE---DKAILRGLS
3bk7A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2qi9C           -------------------------------------------------------------ESTRLGPLS
1sgwA           -----------------------------------------------LEIRDLSVGY----DKPVLERIT
1l7vC           -------------------------------------------------------------ESTRLGPLS
2ihyA           ----------------------------------------------------------------------
2iwhB           ------------KAKDILDEFRKRAVDNIPVDDEEDEGEDLCNCEFSLAYG----------AKILLNKTQ
2ihyB           ----------------------------------------------------------------------
2ix3A           ------------KAKDILDEFRKRAVDNIPVDDEEDEGEDLCNCEFSLAYG----------AKILLNKTQ
2pjzA           -----------------------------------------------------------------LENIN
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix8A           ------------KAKDILDEFRKRAVDNIPVDDEEDEGEDLCNCEFSLAYG----------AKILLNKTQ
2iw3B           ------------KAKDILDEFRKRAVDNIPVDDEEDEGEDLCNCEFSLAYG----------AKILLNKTQ
2iw3A           ------------KAKDILDEFRKRAVDNIPVDDEEDEGEDLCNCEFSLAYG----------AKILLNKTQ
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------------EVVVSKDIN
2awnD           -------------------------------------------------------------EVVVSKDIN
2hydA           VGTLAAFVGYLGPLRRLVASFTTLTQSFASMDRVFQLIDEIEIKQGRIDIDHVSFQYNDN-EAPILKDIN
3b60A           LKSLTNVNAQFQRGMAACQTLFAILDSEQEKD----EGKRVDRATGDLEFRNVTFTYPGR-EVPALRNIN
2ghiA           ----------------------------------------------------------------------
1pf4A           ---------------------------------------EAERVNGEVDVKDVTFTYQGK-EKPALSHVS
2ixfC           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
2ixfA           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
1jj7A           ------------------------------------------HLEGLVQFQDVSFAYPNRPDVLVLQGLT
1mt0A           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
2ixeA           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
2ff7A           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
2fgkA           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
2ffbA           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
3b5jA           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1xefA           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
2ffaA           -----------------------------------------------ITFRNIRFRY--KPDSPVLDNIN
2ixgA           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
2ixfD           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeD           ------------------------------------------NMKGLVKFQDVSFAYPNHPNVQVLQGLT
1z2rA           ------------------------------------------------EFRNVTFTYPGR-EVPALRNIN
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ------------------------------------------------------FHQGTRTIQ-ALNNVS
2it1B           -----------------------------------------------------------------LNNIN
2it1A           -----------------------------------------------------------------LNNIN
2yyzA           ----------------------------------------------------------------------
2oljA           -----------------------------------------------LQMIDVHQLKKSFGSLEVLKGIN
2oukB           ---------------------------------------------------DVHQLKKSFGSLEVLKGIN
1l2tB           -----------------------------------------------------------------LKNVN
1l2tA           -----------------------------------------------------------------LKNVN
3gfoA           -----------------------------------------------------------------LKGIN
1r0zC           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
3d31A           -----------------------------------------------------------------LDNLS
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1f3oA           -----------------------------------------------------------------LKNVN
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yz2B           ------------------------------------------------------FHRGTPLEKKALENVS
2yz2A           ------------------------------------------------------FHRGTPLEKKALENVS
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2onkA           --------------------------------------------------------------------LN
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1oxvA           -----------------------------------------------------------------LDNVN
1oxsC           -----------------------------------------------------------------LDNVN
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1b0uA           ---------------------------------------------------DLHKRYGGHE---VLKGVS
2d2fA           -----------------------------------------------LEIRDL---WASIDGETILKGVN
2pcjA           ----------------------------------------------------------------ILKGIS
2d62A           ----------------------------------------------------------------------
2d2eA           -----------------------------------------------LEIRDL---WASIDGETILKGVN
2bbsA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------TIEFVGVEKIYPGGARS--VRGVS
1z47A           ----------------------------------------------TIEFVGVEKIYPGGARS--VRGVS
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1ji0A           -----------------------------------------------------------------IKGID
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2nq2C           -------------------------------------------------------------ENFLFQQLN
1v43A           ----------------------------------------------------------------------
2nq2D           --------------------------------------------------------------------LN
2d3wC           ----------------------------------------------------------------------
1oxxK           -----------------------------------------------------------------LDNVN
2awnA           ----------------------------------------------------------------------
2awnA           -------------------------------------------------------------EVVVSKDIN
2qi9C           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------ILKKIS
2ihyB           ----------------------------------------------------------------ILKKIS
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           LSVKPGQYVALVGPSGCGKSTTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSI
3g5uA           LEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSI
3g60A           LEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSI
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiA           FFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETI
1pf4A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1mv5D           FEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTI
1mv5A           FEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQ