[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_10403

[Show Plain Result]

#ERROR : Can't open dsspfile "3d0sA.bssp"
#ERROR : Can't open dsspfile "3i54D.bssp"
#ERROR : Can't open dsspfile "3i54C.bssp"
#ERROR : Can't open dsspfile "3i54A.bssp"
#ERROR : Can't open dsspfile "3d0sB.bssp"
#ERROR : Can't open dsspfile "3i54B.bssp"
#ERROR : Can't open dsspfile "3i59A.bssp"
#ERROR : Can't open dsspfile "3i59B.bssp"
#ERROR : Can't open dsspfile "2pqqD.bssp"
#ERROR : Can't open dsspfile "2pqqA.bssp"
#ERROR : Can't open dsspfile "2pqqC.bssp"
#ERROR : Can't open dsspfile "2pqqB.bssp"
#ERROR : Can't open dsspfile "1zrfA.bssp"
#ERROR : Can't open dsspfile "1zrcA.bssp"
#ERROR : Can't open dsspfile "2wc2A.bssp"
#ERROR : Can't open dsspfile "1runA.bssp"
#ERROR : Can't open dsspfile "1j59B.bssp"
#ERROR : Can't open dsspfile "1j59A.bssp"
#ERROR : Can't open dsspfile "1i5zB.bssp"
#ERROR : Can't open dsspfile "1i5zA.bssp"
#ERROR : Can't open dsspfile "2gzwD.bssp"
#ERROR : Can't open dsspfile "3gapB.bssp"
#ERROR : Can't open dsspfile "3gapA.bssp"
#ERROR : Can't open dsspfile "1g6nB.bssp"
#ERROR : Can't open dsspfile "1g6nA.bssp"
#ERROR : Can't open dsspfile "1i6xB.bssp"
#ERROR : Can't open dsspfile "1i6xA.bssp"
#ERROR : Can't open dsspfile "1hw5B.bssp"
#ERROR : Can't open dsspfile "1hw5A.bssp"
#ERROR : Can't open dsspfile "1db9A.bssp"
#ERROR : Can't open dsspfile "2gzwB.bssp"
#ERROR : Can't open dsspfile "1ruoB.bssp"
#ERROR : Can't open dsspfile "1ruoA.bssp"
#ERROR : Can't open dsspfile "3fweB.bssp"
#ERROR : Can't open dsspfile "3fweA.bssp"
#ERROR : Can't open dsspfile "3hifA.bssp"
#ERROR : Can't open dsspfile "2oz6A.bssp"
#ERROR : Can't open dsspfile "2gauA.bssp"
#ERROR : Can't open dsspfile "3dkwA.bssp"
#ERROR : Can't open dsspfile "1vp6A.bssp"
#ERROR : Can't open dsspfile "1u12B.bssp"
#ERROR : Can't open dsspfile "1u12A.bssp"
#ERROR : Can't open dsspfile "2k0gA.bssp"
#ERROR : Can't open dsspfile "3cl1B.bssp"
#ERROR : Can't open dsspfile "3cl1A.bssp"
#ERROR : Can't open dsspfile "2fmyA.bssp"
#ERROR : Can't open dsspfile "3clpC.bssp"
#ERROR : Can't open dsspfile "3clpA.bssp"
#ERROR : Can't open dsspfile "3idcB.bssp"
#ERROR : Can't open dsspfile "3idbB.bssp"
#ERROR : Can't open dsspfile "1cx4A.bssp"
#ERROR : Can't open dsspfile "3co2D.bssp"
#ERROR : Can't open dsspfile "3co2C.bssp"
#ERROR : Can't open dsspfile "3co2B.bssp"
#ERROR : Can't open dsspfile "3co2A.bssp"
#ERROR : Can't open dsspfile "1ft9A.bssp"
#ERROR : Can't open dsspfile "3etqB.bssp"
#ERROR : Can't open dsspfile "1u7eB.bssp"
#ERROR : Can't open dsspfile "1rl3B.bssp"
#ERROR : Can't open dsspfile "1rgsA.bssp"
#ERROR : Can't open dsspfile "2qcsB.bssp"
#ERROR : Can't open dsspfile "1ne4A.bssp"
#ERROR : Can't open dsspfile "3fhiB.bssp"
#ERROR : Can't open dsspfile "3etqA.bssp"
#ERROR : Can't open dsspfile "2hkxA.bssp"
#ERROR : Can't open dsspfile "2zcwA.bssp"
#ERROR : Can't open dsspfile "2z69B.bssp"
#ERROR : Can't open dsspfile "1o7fA.bssp"
#ERROR : Can't open dsspfile "2byvE.bssp"
#ERROR : Can't open dsspfile "3bpzC.bssp"
#ERROR : Can't open dsspfile "1q3eA.bssp"
#ERROR : Can't open dsspfile "2q0aA.bssp"
#ERROR : Can't open dsspfile "3h3zB.bssp"
#ERROR : Can't open dsspfile "3h3zA.bssp"
#ERROR : Can't open dsspfile "3fx3B.bssp"
#ERROR : Can't open dsspfile "3fx3A.bssp"
#ERROR : Can't open dsspfile "3bpzA.bssp"
#ERROR : Can't open dsspfile "2qvsB.bssp"
#ERROR : Can't open dsspfile "1ft9B.bssp"
#ERROR : Can't open dsspfile "3ffqA.bssp"
#ERROR : Can't open dsspfile "1q3eB.bssp"
#ERROR : Can't open dsspfile "3ffqB.bssp"
#ERROR : Can't open dsspfile "2h6cA.bssp"
#ERROR : Can't open dsspfile "2zdbA.bssp"
#ERROR : Can't open dsspfile "3cf6E.bssp"
#ERROR : Can't open dsspfile "3e6cC.bssp"
#ERROR : Can't open dsspfile "3e6bB.bssp"
#ERROR : Can't open dsspfile "3e5uB.bssp"
#ERROR : Can't open dsspfile "3e5uD.bssp"
#ERROR : Can't open dsspfile "3e5uC.bssp"
#ERROR : Can't open dsspfile "3gydB.bssp"
#ERROR : Can't open dsspfile "3gydA.bssp"
#ERROR : Can't open dsspfile "2h6bB.bssp"
#ERROR : Can't open dsspfile "2h6bA.bssp"
#ERROR : Can't open dsspfile "3e5xD.bssp"
#ERROR : Can't open dsspfile "3e5xB.bssp"
#ERROR : Can't open dsspfile "3e5xA.bssp"
#ERROR : Can't open dsspfile "1q5oA.bssp"
#ERROR : Can't open dsspfile "3e5uA.bssp"
#ERROR : Can't open dsspfile "1q43B.bssp"
#ERROR : Can't open dsspfile "1q43A.bssp"

## Summary of PDB Search
:221
    8e-62  58%  3d0sA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-61  57%  3i54D  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    8e-60  59%  3i54C  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    1e-59  63%  3i54A  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    6e-58  57%  3d0sB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-55  60%  3i54B  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    8e-55  62%  3i59A  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    4e-52  65%  3i59B  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    6e-34  67%  2pqqD  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    6e-34  67%  2pqqA  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-33  64%  2pqqC  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-33  64%  2pqqB  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-20  30%  1zrfA  [x.x.x] CATABOLITE GENE ACTIVATOR
    2e-20  30%  1zrcA  [b.82.3 - a.4.5 (1o3qA)] CATABOLITE GENE ACTIVATOR
    2e-20  30%  2wc2A  [x.x.x] CATABOLITE GENE ACTIVATOR
    2e-20  30%  1runA  [b.82.3 - a.4.5] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN
    2e-20  30%  1j59B  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    2e-20  30%  1j59A  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    2e-20  30%  1i5zB  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    2e-20  30%  1i5zA  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    2e-20  30%  2gzwD  [x.x.x] CATABOLITE GENE ACTIVATOR
    2e-20  30%  3gapB  [x.x.x] CATABOLITE GENE ACTIVATOR PROTEIN - CYCLIC /AMP$
    2e-20  30%  3gapA  [x.x.x] CATABOLITE GENE ACTIVATOR PROTEIN - CYCLIC /AMP$
    2e-20  30%  1g6nB  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    2e-20  30%  1g6nA  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    3e-20  30%  1i6xB  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    3e-20  30%  1i6xA  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR PROTEIN
    5e-20  30%  1hw5B  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR
    5e-20  30%  1hw5A  [b.82.3 - a.4.5] CATABOLITE GENE ACTIVATOR
    5e-20  30%  1db9A  [b.82.3 - a.4.5 (1o3sA)] CATABOLITE GENE ACTIVATOR PROTEIN
    8e-20  33%  2gzwB  [x.x.x] CATABOLITE GENE ACTIVATOR
    2e-19  30%  1ruoB  [b.82.3 - a.4.5] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN
    2e-19  30%  1ruoA  [b.82.3 - a.4.5] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN
    3e-19  30%  3fweB  [x.x.x] CATABOLITE GENE ACTIVATOR
    3e-19  30%  3fweA  [x.x.x] CATABOLITE GENE ACTIVATOR
    1e-18  30%  3hifA  [x.x.x] CATABOLITE GENE ACTIVATOR
    3e-18  30%  2oz6A  [x.x.x] VIRULENCE FACTOR REGULATOR
    9e-16  27%  2gauA  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
    5e-12  24%  3dkwA  [x.x.x] DNR PROTEIN
    6e-10  30%  1vp6A  [b.82.3] CYCLIC-NUCLEOTIDE BINDING DOMAIN OF
    6e-10  30%  1u12B  [b.82.3] CYCLIC NUCLEOTIDE BINDING DOMAIN
    6e-10  30%  1u12A  [b.82.3] CYCLIC NUCLEOTIDE BINDING DOMAIN
    6e-10  30%  2k0gA  [x.x.x] MLL3241 PROTEIN
    6e-10  30%  3cl1B  [x.x.x] MLL3241 PROTEIN
    6e-10  30%  3cl1A  [x.x.x] MLL3241 PROTEIN
    7e-10  22%  2fmyA  [x.x.x] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    2e-09  29%  3clpC  [x.x.x] MLL3241 PROTEIN
    2e-09  29%  3clpA  [x.x.x] MLL3241 PROTEIN
    3e-09  34%  3idcB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE II-BETA
    3e-09  34%  3idbB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE II-BETA
    3e-09  34%  1cx4A  [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE REGULATORY
    5e-09  29%  3co2D  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    5e-09  29%  3co2C  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    5e-09  29%  3co2B  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    5e-09  29%  3co2A  [x.x.x] MLOTIK1 ION CHANNEL PROTEIN
    8e-09  30%  1ft9A  [b.82.3 - a.4.5] CARBON MONOXIDE OXIDATION SYSTEM
    8e-09  31%  3etqB  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    1e-08  32%  1u7eB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA
    1e-08  32%  1rl3B  [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA
    1e-08  32%  1rgsA  [x.x.x] CAMP DEPENDENT PROTEIN KINASE
    1e-08  32%  2qcsB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA
    1e-08  32%  1ne4A  [b.82.3 - b.82.3] CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA
    1e-08  32%  3fhiB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA
    1e-08  32%  3etqA  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    4e-08  26%  2hkxA  [x.x.x] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    9e-08  29%  2zcwA  [x.x.x] TRANSCRIPTIONAL REGULATOR, FNR/CRP FAMILY
    9e-08  30%  2z69B  [x.x.x] DNR PROTEIN
    1e-07  38%  1o7fA  [b.82.3 - a.4.5 - b.82.3] CAMP-DEPENDENT RAP1
    1e-07  38%  2byvE  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR 4
    1e-07  30%  3bpzC  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    2e-07  30%  1q3eA  [b.82.3] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    2e-07  30%  2q0aA  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    2e-07  33%  3h3zB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-07  33%  3h3zA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-07  33%  3fx3B  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-07  33%  3fx3A  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    2e-07  30%  3bpzA  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    2e-07  30%  2qvsB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE TYPE II-ALPHA
    3e-07  29%  1ft9B  [b.82.3 - a.4.5] CARBON MONOXIDE OXIDATION SYSTEM
    3e-07  31%  3ffqA  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    6e-07  30%  1q3eB  [b.82.3] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    6e-07  30%  3ffqB  [x.x.x] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    1e-06  22%  2h6cA  [x.x.x] CHLOROPHENOL REDUCTION GENE K
    1e-06  32%  2zdbA  [x.x.x] TRANSCRIPTIONAL REGULATOR, CRP FAMILY
    5e-06  30%  3cf6E  [x.x.x] RAP GUANINE NUCLEOTIDE EXCHANGE FACTOR (GEF) 4
    6e-06  18%  3e6cC  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-06  18%  3e6bB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-06  18%  3e5uB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-06  18%  3e5uD  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-06  18%  3e5uC  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-05  31%  3gydB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING DOMAIN
    1e-05  31%  3gydA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING DOMAIN
    1e-05  18%  2h6bB  [x.x.x] CHLOROPHENOL REDUCTION GENE K
    1e-05  18%  2h6bA  [x.x.x] CHLOROPHENOL REDUCTION GENE K
    1e-05  18%  3e5xD  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-05  18%  3e5xB  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    1e-05  18%  3e5xA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    3e-05  33%  1q5oA  [b.82.3] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    3e-05  20%  3e5uA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
    6e-05  34%  1q43B  [b.82.3] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    6e-05  34%  1q43A  [b.82.3] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
:221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
3d0sA           ----AGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3i54D           ----AGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3i54C           --------------AIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3i54A           -----------------------------RGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3d0sB           ----AGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
3i54B           ----------------SAIAALLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGR------RNLLTIMG
3i59A           -----------------------------RGHTVFAEGEPGDRLYIIISGKVKIGRRAPD--ENLLTI-G
3i59B           -----------------------------RGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMG
2pqqD           -----PLFAALDDEQSAELRAS-SEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGREN-LAVVG
2pqqA           -----PLFAALDDEQSAELRAS-SEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGREN-LAVVG
2pqqC           -----PLFAALDDEQSAELRAS-SEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGREN-LAVVG
2pqqB           -----PLFAALDDEQSAELRAS-SEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGREN-LAVVG
1zrfA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1zrcA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
2wc2A           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1runA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1j59B           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1j59A           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1i5zB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1i5zA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
2gzwD           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3gapB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3gapA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1g6nB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1g6nA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1i6xB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKHEEGKEMILSYLN
1i6xA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKHEEGKEMILSYLN
1hw5B           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1hw5A           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1db9A           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
2gzwB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1ruoB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1ruoA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3fweB           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3fweA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
3hifA           ---------------------------------LIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
2oz6A           ---------------------------------IIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLN
2gauA           ------VWSLLNEEERELLDKEIQPFPCKKASTVFSEGDIPNNLFYLYEGKIKILR-----RFHISRIVK
3dkwA           ------LFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTN
1vp6A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
1u12B           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
1u12A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
2k0gA           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3cl1B           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3cl1A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
2fmyA           ---DTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYED-KEFTLAILE
3clpC           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3clpA           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3idcB           ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
3idbB           ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
1cx4A           ---DILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDI-YVKCDGVGRCVGNYD
3co2D           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3co2C           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3co2B           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
3co2A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNP-------VELG
1ft9A           ------------------------------------EGDENG-VFVVVDGRLRVYLVGEE-REISLFYLT
3etqB           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKNKEMK------LS
1u7eB           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
1rl3B           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
1rgsA           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
2qcsB           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
1ne4A           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
3fhiB           ------LFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNN-----EWATSVG
3etqA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
2hkxA           ---DTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYED-KEFTLAILE
2zcwA           ----------------------------KAGDVILYPGVPGDRAYRVLEGLVRLEAVDEEGNALTLRLVR
2z69B           ------LFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTN
1o7fA           ---------------------------LEKGITLFRQGDIGTNWYAVLAGSVKVSETSSHQDAVTICTLG
2byvE           ---------------------------LEKGITLFRQGDIGTNWYAVLAGSVKVSETSSHQDAVTICTLG
3bpzC           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKNKEMK------LS
1q3eA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMK------LS
2q0aA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
3h3zB           ------LIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRTPT-GSEAVVSVFT
3h3zA           ------LIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRTPT-GSEAVVSVFT
3fx3B           ------LIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRTPT-GSEAVVSVFT
3fx3A           ------LIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRTPT-GSEAVVSVFT
3bpzA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV---LTKGNKEMK--LS
2qvsB           ---DILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDN
1ft9B           ------------------------------------EGDENG-VFVVVDGRLRVYLVGEE-REISLFYLT
3ffqA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSV-------LTNKEMKLS
1q3eB           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMK---------LS
3ffqB           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKEMK--------LS
2h6cA           -----------------------------KGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAG
2zdbA           ----------------------------------------------------------------------
3cf6E           ------------------------ESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYG----KGVVCTLH
3e6cC           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e6bB           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5uB           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5uD           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5uC           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3gydB           --NKIKLFGDFSNEEVRYLCSYQCYAAPRDCQLLT-EGDPGDYLLLILTGEVNVIKDIPNKGIQTIAKVG
3gydA           --NKIKLFGDFSNEEVRYLCSYQCYAAPRDCQLLT-EGDPGDYLLLILTGEVNVIKDIPNKGIQTIAKVG
2h6bB           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
2h6bA           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5xD           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5xB           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
3e5xA           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
1q5oA           ----SPLFANADPNFVTAL-TKLKFEVFQPGDYIIREGTIGKK-YFIQHGVVSV--LTKGNKEKL----S
3e5uA           -----------------------------KGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
1q43B           ----SPLFANADPNFVTAL-TKLKFEVFQPGDYIIREGTIGKK-YFIQHGVVSV----------LTEKLS
1q43A           ----SPLFANADPNFVTAL-TKLKFEVFQPGDYIIREGTIGKK-YFIQHGVVSV----------LTEKLS


                         .         .         *         .         .         .         .:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXXNDVVADLVF
3d0sA           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i54D           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i54C           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i54A           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3d0sB           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i54B           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i59A           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADLIF
3i59B           PSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQXXXXXXXXXXXXXXXXADL--
2pqqD           PSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEXXXXXXXXXXXXXXKTNDA---LVF
2pqqA           PSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEXXXXXXXXXXXXXXKTNDA---LVF
2pqqC           PSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRP--------------------------
2pqqB           PSELIGELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRP--------------------------
1zrfA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1zrcA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
2wc2A           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1runA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1j59B           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1j59A           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1i5zB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1i5zA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
2gzwD           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3gapB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3gapA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1g6nB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1g6nA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1i6xB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1i6xA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1hw5B           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAF
1hw5A           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAF
1db9A           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
2gzwB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1ruoB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1ruoA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3fweB           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3fweA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
3hifA           QGDFIGELGLFEEGERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSE--KNLAF
2oz6A           SGDFFGELGLFEQ-ERSAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAF
2gauA           PGQFFGMRPYFAEETCSSTAIAVENSKVLAIPVEAIEALLKGNTSFCRYFLKALAKELGYAERRTVTLTQ
3dkwA           ERNTFAEAMMFMDTPNVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSL
1vp6A           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
1u12B           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
1u12A           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
2k0gA           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3cl1B           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3cl1A           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
2fmyA           AGDIFCTHT-------RAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVF
3clpC           PGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3clpA           PGAFFGEMALISGEPESATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3idcB           NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
3idbB           NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
1cx4A           NRGSFGELALMYNTPRAATITATSPGALWGL---------------------------------------
3co2D           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3co2C           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3co2B           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
3co2A           PGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEI------------------------
1ft9A           SGDMFCMHS-----GCLVEATERTEVRFADIRTFE--QKLQTCPSMAWGLIAILGRALTSCMRTIEDLMF
3etqB           DGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMM------------------------
1u7eB           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
1rl3B           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
1rgsA           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
2qcsB           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
1ne4A           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
3fhiB           EGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG----------------------------
3etqA           DGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMM------------------------
2hkxA           AGDIFCTHT-------RAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVXXXXXXXXXXXXXXXXXXF
2zcwA           PGGFFGEEALFGQ-ERIYFAEAATDXXXXXXXXKDLAQHLS--------------QGLAEAYRRIERLAT
2z69B           ERNTFAEAMMFMDTPNVATAQAVVPSQLFRFSNKAYLRQLQ-----------------------------
1o7fA           IGTAFGE-SILDNTPRHATIVTRESSELLRIEQED-----------------------------------
2byvE           IGTAFGE-SILDNTPRHATIVTRESSELLRIEQED-----------------------------------
3bpzC           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
1q3eA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
2q0aA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
3h3zB           RGESFGEAVALRNTPYPVSAEAVT----------------------------------------------
3h3zA           RGESFGEAVALRNTPYPVSAEAVT----------------------------------------------
3fx3B           RGESFGEAVALRNTPYPVSAEAVT----------------------------------------------
3fx3A           RGESFGEAVALRNTPYPVSAEAVT----------------------------------------------
3bpzA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
2qvsB           RGS-FGELALMYNTPRAATIIATSEGSLWGL---------------------------------------
1ft9B           SGDMFCMHS-----GCLVEATERTEVRFADIRTFE--QKLQTCPSMAWGLIAILGRALTSCMRTIEDLMF
3ffqA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
1q3eB           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
3ffqB           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMM------------------------
2h6cA           SNSLIGRLY---PTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINT
2zdbA           -----------------------------------------------------------------AHLQT
3cf6E           EGDDFGKLALVNDAPRAASIVLREDNCFLRVDKED-----------------------------------
3e6cC           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e6bB           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5uB           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5uD           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5uC           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3gydB           AGAIIGESI---DGPRSASCVASLPTDFAVLSRDALYQLL------------------------------
3gydA           AGAIIGESI---DGPRSASCVASLPTDFAVLSRDALYQLL------------------------------
2h6bB           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
2h6bA           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5xD           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5xB           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
3e5xA           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
1q5oA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------
3e5uA           GNSLIGKLY---PTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
1q43B           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------
1q43A           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------


                         +         .         .         .         .         *         .:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
3d0sA           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i54D           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i54C           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i54A           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3d0sB           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i54B           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i59A           TDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
3i59B           -DVPGRVAKQLLQLAQRFGT-----LRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLI
2pqqD           SD--------------------------------------------------------------------
2pqqA           SD--------------------------------------------------------------------
2pqqC           ----------------------------------------------------------------------
2pqqB           ----------------------------------------------------------------------
1zrfA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1zrcA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
2wc2A           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1runA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1j59B           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1j59A           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1i5zB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1i5zA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
2gzwD           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
3gapB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
3gapA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1g6nB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1g6nA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1i6xB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1i6xA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1hw5B           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1hw5A           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
1db9A           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVV
2gzwB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRIL------------------
1ruoB           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVV
1ruoA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVV
3fweB           LLVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
3fweA           LLVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
3hifA           LDVTGRIAQTLLNLAKQDAMTHPDGMQI--KITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
2oz6A           LDVTGRVARTLLDLCQQDAMTHPDGMQI--KITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVV
2gauA           KHVRGRLAETLLILKENFG-FENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKI
3dkwA           KNATHRVVRYLLTLA---AHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISI
1vp6A           ----------------------------------------------------------------------
1u12B           ----------------------------------------------------------------------
1u12A           ----------------------------------------------------------------------
2k0gA           ----------------------------------------------------------------------
3cl1B           ----------------------------------------------------------------------
3cl1A           ----------------------------------------------------------------------
2fmyA           KDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILRVNQRTLLL
3clpC           ----------------------------------------------------------------------
3clpA           ----------------------------------------------------------------------
3idcB           ----------------------------------------------------------------------
3idbB           ----------------------------------------------------------------------
1cx4A           ----------------------------------------------------------------------
3co2D           ----------------------------------------------------------------------
3co2C           ----------------------------------------------------------------------
3co2B           ----------------------------------------------------------------------
3co2A           ----------------------------------------------------------------------
1ft9A           HDIKQRIAGFFIDHANTTGRQT--GVIVSVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGR----
3etqB           ----------------------------------------------------------------------
1u7eB           ----------------------------------------------------------------------
1rl3B           ----------------------------------------------------------------------
1rgsA           ----------------------------------------------------------------------
2qcsB           ----------------------------------------------------------------------
1ne4A           ----------------------------------------------------------------------
3fhiB           ----------------------------------------------------------------------
3etqA           ----------------------------------------------------------------------
2hkxA           KDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILRVNQRTLLL
2zcwA           QRLKNRAA-ALLELSETPLAHEEEG-KVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKIQL
2z69B           ----------------------------------------------------------------------
1o7fA           ----------------------------------------------------------------------
2byvE           ----------------------------------------------------------------------
3bpzC           ----------------------------------------------------------------------
1q3eA           ----------------------------------------------------------------------
2q0aA           ----------------------------------------------------------------------
3h3zB           ----------------------------------------------------------------------
3h3zA           ----------------------------------------------------------------------
3fx3B           ----------------------------------------------------------------------
3fx3A           ----------------------------------------------------------------------
3bpzA           ----------------------------------------------------------------------
2qvsB           ----------------------------------------------------------------------
1ft9B           HDIKQRIAGFFIDHANT------TGVIVSVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGR----
3ffqA           ----------------------------------------------------------------------
1q3eB           ----------------------------------------------------------------------
3ffqB           ----------------------------------------------------------------------
2h6cA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLA-----------------
2zdbA           GELRARIARYLLFLADT-PLSARDRQGIYVTVSHEEIADATASIRESVSKVLADLRREGLIATAYRRVYL
3cf6E           ----------------------------------------------------------------------
3e6cC           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e6bB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5uB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5uD           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3e5uC           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIV
3gydB           ----------------------------------------------------------------------
3gydA           ----------------------------------------------------------------------
2h6bB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
2h6bA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3e5xD           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3e5xB           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
3e5xA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
1q5oA           ----------------------------------------------------------------------
3e5uA           YNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLA-----------------
1q43B           ----------------------------------------------------------------------
1q43A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDIERMARRAR
3d0sA           SDSERLARRAR
3i54D           SDSERLARRA-
3i54C           SDSERLARRA-
3i54A           SDSERLARRA-
3d0sB           SD---------
3i54B           SDSERLARRA-
3i59A           SDSERLARRA-
3i59B           SD---------
2pqqD           -----------
2pqqA           -----------
2pqqC           -----------
2pqqB           -----------
1zrfA           -----------
1zrcA           -----------
2wc2A           -----------
1runA           -----------
1j59B           -----------
1j59A           -----------
1i5zB           -----------
1i5zA           -----------
2gzwD           -----------
3gapB           -----------
3gapA           -----------
1g6nB           -----------
1g6nA           -----------
1i6xB           -----------
1i6xA           -----------
1hw5B           -----------
1hw5A           -----------
1db9A           -----------
2gzwB           -----------
1ruoB           -----------
1ruoA           -----------
3fweB           -----------
3fweA           -----------
3hifA           -----------
2oz6A           -----------
2gauA           IDCDRLQKTAR
3dkwA           LDRERL-----
1vp6A           -----------
1u12B           -----------
1u12A           -----------
2k0gA           -----------
3cl1B           -----------
3cl1A           -----------
2fmyA           KDLQKL-----
3clpC           -----------
3clpA           -----------
3idcB           -----------
3idbB           -----------
1cx4A           -----------
3co2D           -----------
3co2C           -----------
3co2B           -----------
3co2A           -----------
1ft9A           -----------
3etqB           -----------
1u7eB           -----------
1rl3B           -----------
1rgsA           -----------
2qcsB           -----------
1ne4A           -----------
3fhiB           -----------
3etqA           -----------
2hkxA           KDLQKL-----
2zcwA           LDLKGLKELA-
2z69B           -----------
1o7fA           -----------
2byvE           -----------
3bpzC           -----------
1q3eA           -----------
2q0aA           -----------
3h3zB           -----------
3h3zA           -----------
3fx3B           -----------
3fx3A           -----------
3bpzA           -----------
2qvsB           -----------
1ft9B           -----------
3ffqA           -----------
1q3eB           -----------
3ffqB           -----------
2h6cA           -----------
2zdbA           LDLAALEREA-
3cf6E           -----------
3e6cC           YNL--------
3e6bB           YNL--------
3e5uB           YNL--------
3e5uD           YNL--------
3e5uC           YNL--------
3gydB           -----------
3gydA           -----------
2h6bB           YNL--------
2h6bA           YNL--------
3e5xD           YNL--------
3e5xB           YNL--------
3e5xA           YNL--------
1q5oA           -----------
3e5uA           -----------
1q43B           -----------
1q43A           -----------