[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00317

[Show Plain Result]


## Summary of Sequence Search
    1::182
   77::209     9e-04  27%  334 aa  PPIP2_MOUSE RecName: Full=Proline-serine-threonine
    1::182

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxMHTFPRNLDHVPEAFVPRVKELLDLSAEREKNGQGMLRRIIDAEIQRKAKEFQNKYGAYVK
PPIP2_MOUSE     ---------LEVFKQQVDNVAQCHIQLAQTLMEEFREKQKLQRKKTETIMDAAHKQRNAQFKKAMDA---


                         .         .         *         .         .         .         .:140
query           DLKKKNAEEKDKCNPYNTRSKAAAGPAVEGVKTGPSSNIANDALMERFCTALEDTRRTLEGIEKGLNKIV
PPIP2_MOUSE     ---KKNYEQK-------CRDKDEAEQAVHR-----SANVANQRQQEKLFVKLATSKTAVEDSDKAYMLHI


                         +         .         .         .         .         *         .:210
query           SILEKAKVDVSIVHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PPIP2_MOUSE     NMLEKVREDWQSEH----------------------------