[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00332

[Show Plain Result]


## Summary of Sequence Search
    1::587
   21::553     e-178  59%  587 aa  PHO84_YEAST RecName: Full=Inorganic phosphate transporter PHO84;
    9::520     3e-94  41%  526 aa  PHT17_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    9::516     8e-94  40%  521 aa  PHT13_ARATH RecName: Full=Probable inorganic phosphate transporter
    9::510     2e-91  39%  535 aa  PHT17_ARATH RecName: Full=Probable inorganic phosphate transporter
    5::548     2e-91  36%  548 aa  PHT15_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    9::512     1e-90  37%  528 aa  PHT12_ORYSJ RecName: Full=Inorganic phosphate transporter 1-2;     
    9::517     2e-89  37%  527 aa  PHT11_ORYSJ RecName: Full=Inorganic phosphate transporter 1-1;     
    3::516     3e-89  38%  524 aa  PHT11_ARATH RecName: Full=Inorganic phosphate transporter 1-1;     
    3::516     1e-88  38%  524 aa  PHT12_ARATH RecName: Full=Probable inorganic phosphate transporter
   13::517     2e-87  37%  541 aa  PHT18_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    3::504     3e-87  40%  516 aa  PHT16_ARATH RecName: Full=Probable inorganic phosphate transporter
    8::530     7e-87  37%  538 aa  PHT14_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    8::530     7e-87  37%  538 aa  PHT14_ORYSI RecName: Full=Probable inorganic phosphate transporter
    9::516     2e-85  36%  526 aa  PHT13_ORYSJ RecName: Full=Probable inorganic phosphate transporter
   11::521     3e-85  38%  541 aa  PT112_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    9::540     3e-85  36%  542 aa  PHT15_ARATH RecName: Full=Probable inorganic phosphate transporter
    9::511     4e-83  38%  534 aa  PHT14_ARATH RecName: Full=Inorganic phosphate transporter 1-4;     
    7::517     2e-82  37%  532 aa  PHT19_ARATH RecName: Full=Probable inorganic phosphate transporter
   46::545     8e-81  40%  573 aa  YHD1_SCHPO RecName: Full=Putative inorganic phosphate transporter
   13::510     1e-79  35%  555 aa  PT111_ORYSJ RecName: Full=Inorganic phosphate transporter 1-11;    
   46::544     2e-79  38%  572 aa  YBN1_SCHPO RecName: Full=Putative inorganic phosphate transporter
   14::519     4e-78  36%  534 aa  PHT16_ORYSJ RecName: Full=Inorganic phosphate transporter 1-6;     
    4::483     5e-78  38%  508 aa  PT113_ORYSJ RecName: Full=Putative inorganic phosphate transporter
    6::503     2e-72  36%  534 aa  PHT18_ARATH RecName: Full=Probable inorganic phosphate transporter
   49::536     7e-69  36%  559 aa  YAEC_SCHPO RecName: Full=Putative inorganic phosphate transporter
   40::549     3e-68  35%  583 aa  YCX2_SCHPO RecName: Full=Probable metabolite transporter C2H8.02;
    7::517     4e-58  33%  552 aa  PT110_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    8::521     2e-43  30%  582 aa  PHT19_ORYSJ RecName: Full=Probable inorganic phosphate transporter
    8::431     4e-27  29%  443 aa  YAAU_ECOLI RecName: Full=Putative metabolite transport protein
   42::423     7e-23  28%  518 aa  GIT1_YEAST RecName: Full=Probable metabolite transport protein
   73::431     2e-17  29%  543 aa  YHM9_SCHPO RecName: Full=Probable metabolite transport protein
   64::447     3e-17  28%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   64::447     3e-17  28%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   87::530     4e-16  26%  557 aa  ITR2_SCHPO RecName: Full=Myo-inositol transporter 2;
   38::493     1e-13  26%  494 aa  SVOPL_MOUSE RecName: Full=Putative transporter SVOPL;AltName:
  173::458     4e-13  28%  464 aa  ARAE_BACSU RecName: Full=Arabinose-proton symporter;AltName:
   38::491     5e-13  24%  492 aa  SVOPL_HUMAN RecName: Full=Putative transporter SVOPL;AltName:
   16::451     1e-12  24%  451 aa  YYAJ_BACSU RecName: Full=Putative metabolite transport protein
   25::447     1e-12  31%  500 aa  PROP_ECOLI RecName: Full=Proline/betaine transporter;AltName:
   25::447     1e-12  31%  500 aa  PROP_ECO57 RecName: Full=Proline/betaine transporter;AltName:
   55::435     2e-12  25%  457 aa  YWTG_BACSU RecName: Full=Putative metabolite transport protein
   85::478     2e-12  26%  482 aa  EDL14_ARATH RecName: Full=Sugar transporter ERD6-like 14;
   99::407     2e-12  28%  683 aa  SV2B_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2B;
   59::489     3e-12  23%  520 aa  YOU1_CAEEL RecName: Full=Putative transporter ZK637.1;
   86::524     3e-12  26%  539 aa  PLT5_ARATH RecName: Full=Polyol transporter 5;AltName:
   43::462     4e-12  25%  541 aa  HXT2_YEAST RecName: Full=High-affinity glucose transporter HXT2;
    6::538     4e-12  28%  551 aa  HGT1_KLULA RecName: Full=High-affinity glucose transporter;
   74::474     1e-11  27%  548 aa  SVOP_PONAB RecName: Full=Synaptic vesicle 2-related protein;       
   74::474     1e-11  27%  548 aa  SVOP_HUMAN RecName: Full=Synaptic vesicle 2-related protein;       
  119::466     1e-11  26%  567 aa  HXT16_YEAST RecName: Full=Hexose transporter HXT16;
   25::457     1e-11  27%  472 aa  ARAE_KLEOX RecName: Full=Arabinose-proton symporter;AltName:
  119::466     2e-11  26%  567 aa  HXT15_YEAST RecName: Full=Hexose transporter HXT15;
  117::463     2e-11  29%  555 aa  GHT3_SCHPO RecName: Full=High-affinity gluconate transporter
  118::463     2e-11  26%  564 aa  HXT13_YEAST RecName: Full=Hexose transporter HXT13;
   68::496     3e-11  27%  535 aa  GHT6_SCHPO RecName: Full=High-affinity fructose transporter
  118::463     4e-11  26%  564 aa  HXT17_YEAST RecName: Full=Hexose transporter HXT17;
   56::437     4e-11  26%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
   15::365     5e-11  24%  400 aa  YCEI_BACSU RecName: Full=Putative metabolite transport protein
   92::421     5e-11  26%  584 aa  ITR1_YEAST RecName: Full=Myo-inositol transporter 1;
   77::457     5e-11  28%  463 aa  ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7;
   16::475     1e-10  23%  493 aa  PLT6_ARATH RecName: Full=Probable polyol transporter 6;
  125::522     1e-10  27%  567 aa  HXT9_YEAST RecName: Full=Hexose transporter HXT9;
  115::592     1e-10  25%  609 aa  ITR2_YEAST RecName: Full=Myo-inositol transporter 2;
  174::487     1e-10  26%  570 aa  HXT1_YEAST RecName: Full=Low-affinity glucose transporter HXT1;
    4::522     2e-10  27%  533 aa  QUTD_EMENI RecName: Full=Quinate permease;AltName: Full=Quinate
  125::522     2e-10  27%  567 aa  HXT11_YEAST RecName: Full=Hexose transporter HXT11;AltName:
  180::530     2e-10  30%  574 aa  GAL2_YEAST RecName: Full=Galactose transporter;AltName:
   80::474     3e-10  26%  478 aa  EDL15_ARATH RecName: Full=Sugar transporter ERD6-like 15;
   25::447     4e-10  31%  500 aa  PROP_SALTY RecName: Full=Proline/betaine transporter;AltName:
  154::556     9e-10  26%  558 aa  XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3;
  144::514     2e-09  26%  551 aa  S22A6_RAT RecName: Full=Solute carrier family 22 member 6;AltName:
  138::508     2e-09  25%  545 aa  S22A6_MOUSE RecName: Full=Solute carrier family 22 member
  147::509     3e-09  24%  551 aa  S22AD_MOUSE RecName: Full=Solute carrier family 22 member
  109::508     3e-09  25%  546 aa  HXT10_YEAST RecName: Full=Hexose transporter HXT10;
  140::471     3e-09  28%  548 aa  ORCT_DROME RecName: Full=Organic cation transporter protein;
   21::172     8e-09  29%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
  130::513     1e-08  28%  524 aa  PLST1_ARATH RecName: Full=Probable plastidic glucose transporter 1;
   61::405     1e-08  27%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
   74::474     1e-08  27%  548 aa  SVOP_RAT RecName: Full=Synaptic vesicle 2-related protein;       
  185::430     1e-08  29%  468 aa  GLCP_SYNY3 RecName: Full=Glucose transport protein;
  117::463     1e-08  28%  557 aa  GHT4_SCHPO RecName: Full=High-affinity hexose transporter ght4;    
  182::467     2e-08  28%  531 aa  GHT2_SCHPO RecName: Full=High-affinity glucose transporter
  195::474     2e-08  28%  482 aa  EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16;
   33::457     2e-08  26%  472 aa  ARAE_ECOLI RecName: Full=Arabinose-proton symporter;AltName:
   33::457     2e-08  26%  472 aa  ARAE_ECO57 RecName: Full=Arabinose-proton symporter;AltName:
   70::457     2e-08  25%  458 aa  EDL10_ARATH RecName: Full=Sugar transporter ERD6-like 10;
   74::474     3e-08  25%  548 aa  SVOP_BOVIN RecName: Full=Synaptic vesicle 2-related protein;       
  136::442     4e-08  26%  727 aa  SV2C_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2C;
  132::483     4e-08  25%  514 aa  STP4_ARATH RecName: Full=Sugar transport protein 4;AltName:
    4::490     4e-08  26%  537 aa  QAY_NEUCR RecName: Full=Quinate permease;AltName: Full=Quinate
  200::482     5e-08  27%  510 aa  HEX6_RICCO RecName: Full=Hexose carrier protein HEX6;
   84::465     5e-08  26%  470 aa  ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8;
  144::476     7e-08  27%  551 aa  S22A6_RABIT RecName: Full=Solute carrier family 22 member
   11::495     7e-08  24%  495 aa  GTR3_CANFA RecName: Full=Solute carrier family 2, facilitated
    9::400     9e-08  23%  452 aa  YDJE_ECOLI RecName: Full=Inner membrane metabolite transport
  171::468     9e-08  27%  567 aa  HXT3_YEAST RecName: Full=Low-affinity glucose transporter HXT3;
   79::466     9e-08  25%  467 aa  EDL11_ARATH RecName: Full=Sugar transporter ERD6-like 11;
  267::525     1e-07  30%  535 aa  S22A7_RAT RecName: Full=Solute carrier family 22 member 7;AltName:
  158::479     1e-07  27%  554 aa  S22A1_RABIT RecName: Full=Solute carrier family 22 member
  132::484     2e-07  24%  513 aa  STP7_ARATH RecName: Full=Sugar transport protein 7;AltName:
  106::452     2e-07  26%  523 aa  GTR2_MOUSE RecName: Full=Solute carrier family 2, facilitated
  136::694     2e-07  27%  727 aa  SV2C_RAT RecName: Full=Synaptic vesicle glycoprotein 2C;       
  144::552     2e-07  23%  563 aa  S22A6_HUMAN RecName: Full=Solute carrier family 22 member
   25::555     2e-07  28%  580 aa  INT3_ARATH RecName: Full=Probable inositol transporter 3;
  103::451     3e-07  27%  471 aa  YNCC_BACSU RecName: Full=Putative metabolite transport protein
  199::474     3e-07  27%  491 aa  XYLE_ECOLI RecName: Full=D-xylose-proton symporter;AltName:
  199::474     3e-07  27%  491 aa  XYLE_ECO57 RecName: Full=D-xylose-proton symporter;AltName:
  136::694     3e-07  27%  727 aa  SV2C_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2C;       
   33::209     3e-07  34%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
   33::209     3e-07  34%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   33::209     3e-07  34%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
   61::552     4e-07  25%  554 aa  YKT8_SCHPO RecName: Full=Uncharacterized MFS-type transporter
  139::371     4e-07  27%  514 aa  STP3_ARATH RecName: Full=Sugar transport protein 3;AltName:
   68::400     6e-07  23%  457 aa  XYLT_LACBR RecName: Full=D-xylose-proton symporter;AltName:
    4::490     6e-07  25%  536 aa  QAY_NEUTR RecName: Full=Quinate permease;AltName: Full=Quinate
  105::451     6e-07  27%  522 aa  GTR2_RAT RecName: Full=Solute carrier family 2, facilitated glucose
  121::412     7e-07  27%  457 aa  YIR0_YEAST RecName: Full=Putative transporter-like protein YIL170W;
  119::488     7e-07  23%  526 aa  STP13_ARATH RecName: Full=Sugar transport protein 13;AltName:
    4::490     7e-07  26%  536 aa  QAY_NEUAF RecName: Full=Quinate permease;AltName: Full=Quinate
   33::209     7e-07  34%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   33::209     7e-07  34%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   33::209     7e-07  34%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   33::209     7e-07  34%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   33::209     7e-07  34%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   11::163     7e-07  28%  466 aa  BENK_ACIAD RecName: Full=Benzoate transport protein;
   74::519     9e-07  25%  548 aa  SVOP_MOUSE RecName: Full=Synaptic vesicle 2-related protein;       
  144::480     1e-06  25%  547 aa  S22A6_PIG RecName: Full=Solute carrier family 22 member 6;AltName:
   81::461     1e-06  24%  470 aa  ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5;
  152::478     2e-06  27%  540 aa  S22A7_MOUSE RecName: Full=Solute carrier family 22 member
  190::433     2e-06  23%  509 aa  INT1_ARATH RecName: Full=Probable inositol transporter 1;
  195::545     2e-06  28%  592 aa  HXT5_YEAST RecName: Full=Probable glucose transporter HXT5;
  200::488     2e-06  26%  534 aa  HUP3_CHLKE RecName: Full=H(+)/hexose cotransporter 3;
  147::527     3e-06  23%  551 aa  S22AD_HUMAN RecName: Full=Solute carrier family 22 member
  346::480     3e-06  29%  549 aa  S22A6_BOVIN RecName: Full=Solute carrier family 22 member
  148::433     3e-06  27%  518 aa  GHT7_SCHPO RecName: Full=Probable high-affinity hexose transporter
   84::459     4e-06  26%  482 aa  YFIG_BACSU RecName: Full=Putative metabolite transport protein
  133::485     4e-06  25%  522 aa  STP1_ARATH RecName: Full=Sugar transport protein 1;AltName:
  107::432     5e-06  26%  514 aa  STP11_ARATH RecName: Full=Sugar transport protein 11;AltName:
  104::425     5e-06  26%  495 aa  PLST3_ARATH RecName: Full=Probable plastidic glucose transporter 3;
  144::476     6e-06  24%  550 aa  S22A6_MACFA RecName: Full=Solute carrier family 22 member
  152::542     6e-06  24%  551 aa  S22A4_PAPAN RecName: Full=Solute carrier family 22 member
  159::480     6e-06  29%  555 aa  S22A2_HUMAN RecName: Full=Solute carrier family 22 member
   89::492     6e-06  26%  546 aa  GHT5_SCHPO RecName: Full=High-affinity glucose transporter
  140::477     8e-06  25%  567 aa  OCTL_DROME RecName: Full=Organic cation transporter-like protein;
  153::518     1e-05  24%  563 aa  S22A1_BOVIN RecName: Full=Solute carrier family 22 member
  178::463     1e-05  26%  557 aa  GHT1_SCHPO RecName: Full=High-affinity glucose transporter
  262::528     2e-05  25%  556 aa  S22A1_MOUSE RecName: Full=Solute carrier family 22 member
   62::145     2e-05  32%  403 aa  MHPT_ECOLI RecName: Full=Putative 3-hydroxyphenylpropionic acid
   63::149     2e-05  30%  450 aa  GUDP_ECOLI RecName: Full=Probable glucarate transporter;AltName:
   61::141     2e-05  31%  456 aa  GUDP_PSEPU RecName: Full=Probable glucarate transporter;AltName:
  202::486     3e-05  27%  517 aa  STP9_ARATH RecName: Full=Sugar transport protein 9;AltName:
  256::477     3e-05  24%  557 aa  S22A5_HUMAN RecName: Full=Solute carrier family 22 member
  214::451     3e-05  27%  510 aa  GTR2_BOVIN RecName: Full=Solute carrier family 2, facilitated
   42::135     3e-05  40%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   42::135     3e-05  40%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
  323::430     4e-05  32%  522 aa  STA_RICCO RecName: Full=Sugar carrier protein A;
  322::491     4e-05  31%  547 aa  GHT8_SCHPO RecName: Full=Probable high-affinity hexose transporter
  140::464     5e-05  24%  742 aa  SV2A_PONAB RecName: Full=Synaptic vesicle glycoprotein 2A;
  132::449     5e-05  28%  547 aa  S22AF_HUMAN RecName: Full=Solute carrier family 22 member
  154::403     5e-05  26%  554 aa  S22A2_RABIT RecName: Full=Solute carrier family 22 member
   75::158     5e-05  33%  466 aa  PROP_STAAW RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAAS RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAAR RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAAN RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAAM RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAAC RecName: Full=Putative proline/betaine transporter;
   75::158     5e-05  33%  466 aa  PROP_STAA1 RecName: Full=Putative proline/betaine transporter;
  157::238     5e-05  30%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   73::498     7e-05  30%  503 aa  XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1;
  140::464     7e-05  24%  742 aa  SV2A_MACFA RecName: Full=Synaptic vesicle glycoprotein 2A;
  140::464     7e-05  24%  742 aa  SV2A_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2A;
  202::485     7e-05  23%  514 aa  STP10_ARATH RecName: Full=Sugar transport protein 10;AltName:
   80::470     7e-05  24%  502 aa  GTR5_RAT RecName: Full=Solute carrier family 2, facilitated glucose
  132::452     9e-05  27%  544 aa  S22AF_MOUSE RecName: Full=Solute carrier family 22 member 15;
  346::514     9e-05  26%  550 aa  S22A6_PONAB RecName: Full=Solute carrier family 22 member
   21::159     9e-05  31%  432 aa  KGTP_SHIFL RecName: Full=Alpha-ketoglutarate permease;
   21::159     9e-05  31%  432 aa  KGTP_ECOLI RecName: Full=Alpha-ketoglutarate permease;
  333::464     1e-04  31%  742 aa  SV2A_RAT RecName: Full=Synaptic vesicle glycoprotein 2A;       
  333::464     1e-04  31%  742 aa  SV2A_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2A;       
   73::451     1e-04  24%  473 aa  IOLT_BACSU RecName: Full=Major myo-inositol transporter iolT;
  252::524     2e-04  27%  558 aa  S226A_XENLA RecName: Full=Solute carrier family 22 member
  187::552     2e-04  27%  580 aa  INT2_ARATH RecName: Full=Probable inositol transporter 2;
  454::556     2e-04  33%  582 aa  INT4_ARATH RecName: Full=Inositol transporter 4;AltName:
   15::112     2e-04  33%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
  186::473     2e-04  24%  478 aa  EDL18_ARATH RecName: Full=Sugar transporter ERD6-like 18;AltName:
  147::231     2e-04  32%  517 aa  ANTR6_ARATH RecName: Full=Probable anion transporter 6,
  140::464     3e-04  24%  742 aa  SV2A_BOVIN RecName: Full=Synaptic vesicle glycoprotein 2A;AltName:
   22::154     3e-04  30%  438 aa  SHIA_ECOLI RecName: Full=Shikimate transporter;
  263::538     3e-04  25%  546 aa  PLST4_ARATH RecName: Full=Plastidic glucose transporter 4;       
   69::149     3e-04  32%  455 aa  GUDP_BACSU RecName: Full=Probable glucarate transporter;AltName:
   43::131     4e-04  31%  427 aa  YDFJ_ECOLI RecName: Full=Putative inner membrane metabolite
  336::427     4e-04  29%  502 aa  NANT2_ECOL6 RecName: Full=Putative sialic acid transporter
   91::336     6e-04  24%  580 aa  YN41_SCHPO RecName: Full=Uncharacterized transporter C36.01c;
  156::479     6e-04  25%  554 aa  S22A1_HUMAN RecName: Full=Solute carrier family 22 member
  118::209     6e-04  28%  495 aa  S17A5_SHEEP RecName: Full=Sialin;AltName: Full=Solute carrier
   66::149     6e-04  28%  464 aa  PROP_STAEQ RecName: Full=Putative proline/betaine transporter;
  198::435     7e-04  22%  498 aa  STP2_ARATH RecName: Full=Sugar transport protein 2;AltName:
  262::528     7e-04  24%  556 aa  S22A1_RAT RecName: Full=Solute carrier family 22 member 1;AltName:
  376::470     7e-04  32%  477 aa  GTR8_HUMAN RecName: Full=Solute carrier family 2, facilitated
  251::385     0.001  29%  399 aa  YXAM_BACSU RecName: Full=Uncharacterized MFS-type transporter yxaM;
   13::162     0.001  26%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
    1::587

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLTAGGNSAFKNFHNQFAHIQDPNERRRLALAEIDKAPFGWYHIRAIVVAGIGFFTDAYDIFAINLAS
PHO84_YEAST     ---LTEGGNMAFHNHLNDFAHIEDPLERRRLALESIDDEGFGWQQVKTISIAGVGFLTDSYDIFAINLGI
PHT17_ORYSJ     --------------------------------LSALDSAKTQWYHFTAIVIAGMGFFTDAYDLFCISLVT
PHT13_ARATH     --------------------------------LKALDVAKTQLYHFTAIVIAGMGFFTDAYDLFCVSLVT
PHT17_ARATH     --------------------------------LNALDVAKTQWYHFTAIIIAGMGFFTDAYDLFCISLVT
PHT15_ORYSJ     -----------------------------RKVLDALDTAKTQWYHFTAVVIAGMGFFTDAYDLFSISLVT
PHT12_ORYSJ     --------------------------------LVKLDQAKTQWYHFMAIVIAGMGFFTDAYDLFCIALVT
PHT11_ORYSJ     --------------------------------LSTLDQAKTQWYHFMAIVIAGMGFFTDAYDLFCISLVT
PHT11_ARATH     --------------------------EQQLGVLKALDVAKTQLYHFTAIVIAGMGFFTDAYDLFCVSLVT
PHT12_ARATH     --------------------------EQQLGVLKALDVAKTQLYHFTAIVIAGMGFFTDAYDLFCVSLVT
PHT18_ORYSJ     --------------------------------LSALDAAKTQWYHFTAIVVAGMGFFTDAYDLFCISLVT
PHT16_ARATH     -------------------------NEEQGSILKALDVAKTQWYHVTAVVVSGMGFFTDSYDLFVISLIT
PHT14_ORYSJ     --------------------------------LNALDSAKTQWYHFTAIVIAGMGFFTDAYDLFSISLVT
PHT14_ORYSI     --------------------------------LNALDSAKTQWYHFTAIVIAGMGFFTDAYDLFSISLVT
PHT13_ORYSJ     --------------------------------LTTLDHARTQWYHFMAIVIAGMGFFTDAYDLFCISLVS
PT112_ORYSJ     --------------------------------LNALDAAKTQWYHFTAIIVAGMGFFTDAYDLFCISLVT
PHT15_ARATH     --------------------------------LNALDAAKTQMYHFTAIVIAGMGFFTDAYDLFSISLVT
PHT14_ARATH     --------------------------------LNALDVAKTQWYHFTAIIIAGMGFFTDAYDLFCISLVT
PHT19_ARATH     --------------------------------LSALDAARIQWYHFKAIIVAGMGLFTDAYDLFCIAPIM
YHD1_SCHPO      ----------------------------------------------RLMMLAGVGFFLDSYDLFIINLVT
PT111_ORYSJ     --------------------------------LDALDSARTQMYHMKAIVIAGMGFFTDAYDLFCISTVS
YBN1_SCHPO      ----------------------------------------------KLMMLAGVGFFLDSYDLFIINLVT
PHT16_ORYSJ     --------------------------------LHALDVAKTQWYHFTAIVVAGMGFFTDAYDLFCISLVT
PT113_ORYSJ     -------------------------NQQLRV-LHALDIARTQLYHFIAIVIAGMGFFTDAYDLFSISLVA
PHT18_ARATH     --------------------------------LSSLDVARTQWYHFKAIIVAGMGLFTDAYDLFCIAPVM
YAEC_SCHPO      ---------------------------------------------------AGAGFFLDSYDLFIINLVS
YCX2_SCHPO      ----------------------------------------------KLLAIAGTGFLLDSYDLFIINLVS
PT110_ORYSJ     --------------------------------LTALDQARTQYYHFKAIVIAGMGLFTDSYDLFCIAPVM
PHT19_ORYSJ     --------------------------------LAALDQARTQYYHFKAIVIAGMGLFTDSYDLFCISPVM
YAAU_ECOLI      ------------------------------------DDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVAL
GIT1_YEAST      ------------------------------------------WKNIVTIIASGFALISDGY----VNGSM
YHM9_SCHPO      ------------------------------------------WKHFLNVAVAGVALMSDGY-------CS
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
ITR2_SCHPO      --------------------------------------------------VAGISGLLFGYDTGVISGAL
SVOPL_MOUSE     -----------------------------------VETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVS
ARAE_BACSU      ----------------------------------------------------------------------
SVOPL_HUMAN     -----------------------------------VETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVS
YYAJ_BACSU      -------------------------------AANRLDRLPISRVHFQVLTALGIVYFFDLADLFTLNVAP
PROP_ECOLI      ----------------------------------------------KAITAASLGNAMEWFDFGVYGFVA
PROP_ECO57      ----------------------------------------------KAITAASLGNAMEWFDFGVYGFVA
YWTG_BACSU      ----------------------------------------------------------------------
EDL14_ARATH     ----------------------------------------------------------------------
SV2B_HUMAN      -----------------------------------MDECGHGRFQWILFFVLGLALMADGVEVFVVSFA-
YOU1_CAEEL      ----------------------RSPDSEKTFTVDEVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLIS
PLT5_ARATH      ----------------------------------------------------------------------
HXT2_YEAST      ---------------------------------AELPAKPIAWTVICLCLMIAFGGFVFGWDTGTIS---
HGT1_KLULA      ------------------------------------------WLLLRDIQYEGTFYFPHVYNIYVIGFIA
SVOP_PONAB      -----------------------------------VEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILA
SVOP_HUMAN      -----------------------------------VEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILA
HXT16_YEAST     ----------------------------------------------------------------------
ARAE_KLEOX      -----------------------------------------------------------------VSIAA
HXT15_YEAST     ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
HXT13_YEAST     ----------------------------------------------------------------------
GHT6_SCHPO      ----------------------------------------------------------------------
HXT17_YEAST     ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
YCEI_BACSU      --------------------------------------------------VAGLGWLFDAMDVGILSFII
ITR1_YEAST      --------------------------------------------------VASISGFMFGYDTGYIS--S
ERDL7_ARATH     ----------------------------------------------------------------------
PLT6_ARATH      -------------------------------------------FALQCAIVASIVSIIFGYD------TG
HXT9_YEAST      ----------------------------------------------------------------------
ITR2_YEAST      --------------------------------------------------VASISGFMFGYDTGYIS--S
HXT1_YEAST      ----------------------------------------------------------------------
QUTD_EMENI      ------------------------------LALVEDRPTPREVYNWRVYLLAAVASFTSCM----IGYDS
HXT11_YEAST     ----------------------------------------------------------------------
GAL2_YEAST      ----------------------------------------------------------------------
EDL15_ARATH     ----------------------------------------------------------------------
PROP_SALTY      ----------------------------------------------KAITAASLGNAMEWFDFGVYGFVA
XYLL3_ARATH     ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
S22AD_MOUSE     ----------------------------------------------------------------------
HXT10_YEAST     ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
PCAK_ACIAD      -------------------------------AQALINDAPLSRYQWLIAIVCFLIVFVDGIDTAAMGFIA
PLST1_ARATH     ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
SVOP_RAT        -----------------------------------VEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILA
GLCP_SYNY3      ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
EDL10_ARATH     ----------------------------------------------------------------------
SVOP_BOVIN      -----------------------------------VEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILA
SV2C_HUMAN      --------------------------QQYELIIQECGHGRFQW---ALFFVLGMALMADGVEVFVVG---
STP4_ARATH      ----------------------------------------------------------------------
QAY_NEUCR       ------------------------------LALKEDRPTPKAVYNWRVYTCAAIASFASCM----IGYDS
HEX6_RICCO      ----------------------------------------------------------------------
ERDL8_ARATH     ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
GTR3_CANFA      ---------------------------------------------IFALSIATIGSFQFGYNTGVINAPE
YDJE_ECOLI      ---------------------------------ARLDRLPLARFHYRIFGIISFSLLLTGFLSYSGNVVL
HXT3_YEAST      ----------------------------------------------------------------------
EDL11_ARATH     ----------------------------------------------------------------------
S22A7_RAT       ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
GTR2_MOUSE      ----------------------------------------------------------------------
SV2C_RAT        --------------------------QQYELIIQECGHGRFQW---ALFFVLGMALMADGVEVFVVG---
S22A6_HUMAN     ----------------------------------------------------------------------
INT3_ARATH      -------------------------------------------YIMRLALSAGIGGLLFGYNTGVI--AG
YNCC_BACSU      ----------------------------------------------------------------------
XYLE_ECOLI      ----------------------------------------------------------------------
XYLE_ECO57      ----------------------------------------------------------------------
SV2C_MOUSE      --------------------------QQYELIIQECGHGRFQW---ALFFVLGMALMADGVEVFVVG---
NANT_YERPY      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERPE      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERPA      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
YKT8_SCHPO      ---------------------------KSRILSNAMNEIGFGRYQWYLFFVAGFGWMSDNIWPVCTSL--
STP3_ARATH      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
QAY_NEUTR       ------------------------------LALKEDRPTPKAVYNWRVYTCAAIASFASCM----IGYDS
GTR2_RAT        ----------------------------------------------------------------------
YIR0_YEAST      ----------------------------------------------------------------------
STP13_ARATH     ----------------------------------------------------------------------
QAY_NEUAF       ------------------------------LALKEDRPTPKAVYNWRVYTCAAIASFASCM----IGYDS
NANT_YERPS      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERPP      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERPG      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERPB      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
NANT_YERP3      ----------------------------------------------KAFVAAWIGYALDGFDFVLITLVL
BENK_ACIAD      -----------------------------------IDDSKLTPFHWRVIILSTLIIIFDGYDLVIYGVAL
SVOP_MOUSE      -----------------------------------VEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILA
S22A6_PIG       ----------------------------------------------------------------------
ERDL5_ARATH     ----------------------------------------------------------------------
S22A7_MOUSE     ----------------------------------------------------------------------
INT1_ARATH      ----------------------------------------------------------------------
HXT5_YEAST      ----------------------------------------------------------------------
HUP3_CHLKE      ----------------------------------------------------------------------
S22AD_HUMAN     ----------------------------------------------------------------------
S22A6_BOVIN     ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
STP1_ARATH      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
S22A6_MACFA     ----------------------------------------------------------------------
S22A4_PAPAN     ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
S22A1_MOUSE     ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SV2A_PONAB      ----------------------QRRKEREELALRECSHGRFQW---TLYFVLGLALMADGVEVFVVG---
S22AF_HUMAN     ----------------------------------------------------------------------
S22A2_RABIT     ----------------------------------------------------------------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     -----------------------------------------------------------------MSLKS
SV2A_MACFA      ----------------------QRRKEREELALRECGHGRFQW---TLYFVLGLALMADGVEVFVVG---
SV2A_HUMAN      ----------------------QRRKEREELALRECGHGRFQW---TLYFVLGLALMADGVEVFVVG---
STP10_ARATH     ----------------------------------------------------------------------
GTR5_RAT        ----------------------------------------------------------------------
S22AF_MOUSE     ----------------------------------------------------------------------
S22A6_PONAB     ----------------------------------------------------------------------
KGTP_SHIFL      ---------------------------------------------IWAIVGASSGNLVEWFDFYVYSFCS
KGTP_ECOLI      ---------------------------------------------IWAIVGASSGNLVEWFDFYVYSFCS
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      ----------------------------------------------------------------------
S226A_XENLA     ----------------------------------------------------------------------
INT2_ARATH      ----------------------------------------------------------------------
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      --------------------------------------------------IAAMAFFMQALDATILNTAL
EDL18_ARATH     ----------------------------------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------QRRKEREELALRECGHGRFQW---TLYFVLGLALMADGVEVFVVG---
SHIA_ECOLI      ----------------------------------------------RAALGSFAGAVVDWYDFLLYGITA
PLST4_ARATH     ----------------------------------------------------------------------
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ---------------------------------AFVDSQPIGRRQRIIVLMVFLIMVADGMDI---TLAS


                         .         .         *         .         .         .         .:140
query           AMLGVVFWLDAKDKPGKIPSSADTAIKVATSGGTVIGQVGFGWLADVVGRKKMYGLELMVIIFATLAQAL
PHO84_YEAST     TMMSYVYW------HGSMPGPSQTLLKVSTSVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTT
PHT17_ORYSJ     KLIGRVYYTDGASKPGSLPPNVSAAVNGVAFVGTLTGQLFFGWLGDRVGRKSVYGMTLLLMIICSVASGL
PHT13_ARATH     KLLGRLYYFNPTSKPGSLPPHVAAAVNGVALCGTLAGQLFFGWLGDKLGRKKVYGITLIMMILCSVASGL
PHT17_ARATH     KLLGRIYYVDGSEKPGTLPPNVSAAVNGVAFCGTLAGQLFFGWLGDKLGRKKVYGMTLMVMVLCSIASGL
PHT15_ORYSJ     KLLGRIYYFNPASKPGSLPPNVSAAVNGVAFCGTLAGQLFFGWLGDKMGRKKVYGMTLMLMVICCLASGL
PHT12_ORYSJ     KLLGRLYYTDTKPNPGTLPPNVSSAVTGVALCGTLAGQLFFGWLGDKLGRKSVYGFTLILMVVCSIASGL
PHT11_ORYSJ     KLLGRIYYTDSKDTPGALPPNVSAAVTGVALCGTLAGQLFFGWLGDKLGRKSVYGFTLILMVVCSVASGL
PHT11_ARATH     KLLGRIYYFNPESKPGSLPPHVAAAVNGVALCGTLSGQLFFGWLGDKLGRKKVYGLTLVMMILCSVASGL
PHT12_ARATH     KLLGRIYYFNPESKPGSLPPHVAAAVNGVALCGTLSGQLFFGWLGDKLGRKKVYGLTLIMMILCSVASGL
PHT18_ORYSJ     KLLGRIYYTDAKENPGSLPPXXXXXXXXXXFCGTLAGQLFFGWLGDKLGRKSVYGMTLLMMVICSIASGL
PHT16_ARATH     KLLGRIYYVXXXXXXXXXXXXXXAAVSGVAFAGTFIGQIFFGCLGDKLGRKRVYGLTLLIMTICSICSGL
PHT14_ORYSJ     KLLGRIYYFNPASKPGSLPPNVSAAVNGVAFCGTLAGQLFFGWLGDKMGRKKVYGMTLMLMVICCLASGL
PHT14_ORYSI     KLLGRIYYFNPASKPGSLPPNVSAAVNGVAFCGTLAGQLFFGWLGDKMGRKKVYGMTLMLMVICCLASGL
PHT13_ORYSJ     KLLGRIYYTDAGDNPGSLPPNVSAAVNGVALCGTLAGQLFFGWLGDKLGRKSVYGFTLVLMVVCSVASGL
PT112_ORYSJ     KLLGRIYYTDASPTPGSLPPNIAAAVNGVALCGTLSGQLFFGWLGDKLGRKSVYGMTLLLMVICSIASGL
PHT15_ARATH     KLLGRIYYVDSSKKPGTLPPXXXXXXXXXXFCGTLAGQLFFGWLGDKLGRKKVYGITLMLMVLCSLGSGL
PHT14_ARATH     KLLGRIYYVEGAQKPGTLPPXXXXXXXXXXFCGTLAGQLFFGWLGDKLGRKKVYGMTLMVMVLCSIASGL
PHT19_ARATH     KMISQIYY--HKDSIGTALLSTSYAIALL---GTALGQLIFGYLGDRVGRRKVYGLSLLIMVFSSFGCGF
YHD1_SCHPO      PIFEYLYWGGIEKGPGHYPSGIRGLVNAASNIGNIFGQLMFGFMGDFFGRKFVYGKEMXXXXXXXXXXXX
PT111_ORYSJ     KLLGRLYYQSTDSKPGALSKTANNMVIGVALVGTLMGQLVFGYFGDKLGRKRVYGVTLILMAACAIGSGL
YBN1_SCHPO      PIFEYLYWGGIEKGPGHYPSGIRGLVNASANIGNIFGQLLFGFMGDFFGRKFVYGKEMXXXXXXXXXXXX
PHT16_ORYSJ     KLLGRIYYVDGSPSPGTLPPHVSASVNGVAFVGTLSGQLFFGWLGDKLGRKRVYGITLMLMVLCSLASAL
PT113_ORYSJ     DLLGHVYY------HGELPRNIHAAVTGIALCGTVPGQLVFGWLGDKMGRKRVYGITLLLMVVSSLASGL
PHT18_ARATH     KMISHVYYNGDSINTAVLSTSYAIALL-----GTATGQLVFGYLGDRVGRRRVYGLCLIIMILSSFGCGF
YAEC_SCHPO      PIYEYLYWGGLEGKKPHYPSGIHGLVNAAANIGNVFGQILFGFMGDFFGRKFVYGKEMXXXXXXXXXXXX
YCX2_SCHPO      PILAYLYWGGLTGHQD-YPSGIRGVVNAATNIGNIMXXXXXXXXXXXXXRKFVYGKEMMVVIIATILIIC
PT110_ORYSJ     KIVGRVYYSDGGARPGVTPPAVVSATVGVALLGAVIGNVVFGALGDRVGRRRVYGACLLLMXXXXXXXXX
PHT19_ORYSJ     KIFGRVYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRVGRRRVYGAXXXXXXXXXXXXXX
YAAU_ECOLI      EQLTPALKLDA---------DWIXXXXXXXXXXXFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMF
GIT1_YEAST      SMLNKVFVMEYGKK--NYSSKVSTRVSNAALVGIIFGQFFMGIAADYYSRKSCILVATAILV---IGSAL
YHM9_SCHPO      NSIGTVITILRKLYPEETTHNKSLQIGMIAYVGTIVGQLSFGWYSDRFGRKNGMITATIILIVST---AL
GALP_ECOLI      --------------------------------GAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSL---F
GALP_ECOL6      --------------------------------GAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSL---F
ITR2_SCHPO      AVLG-------SDLGHVLSSGQKELITSATSFAALISATTSGWLADWVGRKRLLLCADAIFVIGSVIMAA
SVOPL_MOUSE     PVIRCEWQLE---------NWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKIL---LLSFLWGAYFSLL
ARAE_BACSU      ----------------------------------------------------------------------
SVOPL_HUMAN     PVIRCEWQLE---------NWQVALVTTMVFFGYMVFSILFGLLADRYGRWKIL---LISFLWGAYFSLL
YYAJ_BACSU      AL--IEHW--------GIPLSTIANVTAASFLGMFLGASLGGRLSDRIGRKKALNLFVFVFSIASLCNAA
PROP_ECOLI      YALGKVFF------PGADPSVQMVAALATFSVPFLIRPLGFGMLGDKYGRQKILAITIVIMSISTFCIGL
PROP_ECO57      YALGKVFF------PGADPSVQMVAALATFSVPFLIRPLGFGMLGDKYGRQKILAITIVIMSISTFCIGL
YWTG_BACSU      --------------------------------GAILGSGAAGKLTDRFGRKKAIMAAALLFCIGGLGVAL
EDL14_ARATH     --------------------------------GLILGALICGKLADLVGRVYTIWITNILVLIGWLAIAF
SV2B_HUMAN      --------LPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAV------NASF
YOU1_CAEEL      PALACEWG---------ISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRK--GLTFSTLV-ACIMGVI
PLT5_ARATH      ---------------------------------SLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGL
HXT2_YEAST      ---GFVNQTDFKRRFGQMKSDGTYYLSDVRTGGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIA
HGT1_KLULA      CISGLMFGFDIASMSSMIGSNPDSGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA
SVOP_PONAB      PQLHCEW---------RLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKT--GLKISVL-WTLYYGIL
SVOP_HUMAN      PQLHCEW---------RLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKT--GLKISVL-WTLYYGIL
HXT16_YEAST     ------------------------------SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQIS
ARAE_KLEOX      AVAGLLFGLDIGVIAGALPFITDHFVLVVSSMGAAIGALFNGWLSFRLGRK--YSLMVGAVLFV----AG
HXT15_YEAST     ------------------------------SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQIS
GHT3_SCHPO      ----------------------------------------------------------------------
HXT13_YEAST     --------------------------------GCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQIS
GHT6_SCHPO      --------------------------------GTTVGCLLSSPLGDRFGKRKCIMGWTLVYITGVIVQLT
HXT17_YEAST     --------------------------------GCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQIS
CSBC_BACSU      --------------------------------GAIFGSALSGTCSDRWGRRKVVFVLSIIFIIGALACAF
YCEI_BACSU      AALHVEWNLSPEEMKW---------IGSVNSIGMXXXXXXXXXXXDRIGRKKVFIITLLCFSIG------
ITR1_YEAST      ALISIGTDLDHK----VLTYGEKEIVTAATSLGALITSIFAGTAADIFGRKRLMGSNLMFVIGAIL--QV
ERDL7_ARATH     --------------------------------GAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIF
PLT6_ARATH      VMSGAMVFIEEDLKTNDVQIEVLTGILNLCA---LVGSLLAGRTSDIIGRR--YTIVLASILFM-LGSIL
HXT9_YEAST      -------------------------------GGIVLSKVG-----DIYGRRIGLITVTAIYVVGILIQIT
ITR2_YEAST      ALISINRDLDNK----VLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQIT
HXT1_YEAST      ----------------------------------------------------------------------
QUTD_EMENI      AFIGTTLSLQSFQNEFNWESLNTDLISAAFFGALFAYPIGHFW-----GRR--WGLMFSALIFF-LGAGM
HXT11_YEAST     -------------------------------GGIVLSKVG-----DIYGRRIGLITVTAIYVVGILIQIT
GAL2_YEAST      ----------------------------------------------------------------------
EDL15_ARATH     --------------------------------GLILGALICGKLTDLVGRVKTIWITNILFVIGWFAIAF
PROP_SALTY      YALGKVFF------PGADPSVQMIAALATFSVPFLIRPLGFGMLGDKYGRQKILAITIVIMSISTFCIGL
XYLL3_ARATH     --------------------------------GALLGSISVYGVADFLGRRRELIIAAVLYLLGSLITGC
S22A6_RAT       --------------------------------GVLLGAMVFGYLADRLGRRKVLILNYLQ---TAVSGTC
S22A6_MOUSE     --------------------------------GVLLGAMMFGYLADRLGRRKVLILNYLQ---TAVSGTC
S22AD_MOUSE     --------------------------------GLLVGALVFGPVCDWIGRRPSLLMQVLLSGITSMATAF
HXT10_YEAST     --------------------------------GCALGGLTLGRLGDIYGRKIGLMCVILVYVVGIVIQIA
ORCT_DROME      --------------------------------GVLLGSLIFGQMSDKLGRKPTFFASLVLLIFGVLA-AV
PCAK_ACIAD      PALAQDWGVD-RSQLGPVMSAA--------LGGMIIGALVSGPTADRFGRKIVLSMSMLVFGGFTLACAY
PLST1_ARATH     --------------------------------GAFIGSIVAGPLVDKFGYRRTFQIFTIPLILGALAQAH
MUCK_ACIAD      -----------------------------TLAGMAIGGIFGGWACDRFGRVRIVVISILTFSILTCGLGL
SVOP_RAT        PQLHCEW---------RLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKT----GLKISVFWTLYYGL
GLCP_SYNY3      ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
ARAE_ECOLI      ---GLLFGLDIGVIAGALPFITDHFVLTSRLQGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAF
ARAE_ECO57      ---GLLFGLDIGVIAGALPFITDHFVLTSRLQGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAF
EDL10_ARATH     --------------------------------GGAVGALFSGQLAVILGRRRTLWACDLFCIFGWLSIAF
SVOP_BOVIN      PQLHCEW---------RLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKT--GLKISVL-WTLYYGIL
SV2C_HUMAN      ------FVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAF---L
STP4_ARATH      ----------------------------------------------------------------------
QAY_NEUCR       AFIGTTLALPSFTKEFDFASYTPGALALLQSNIVSVYQAGFGCLSYFLGRRKLIAFSVVFIIGAAIMLAA
HEX6_RICCO      ----------------------------------------------------------------------
ERDL8_ARATH     --------------------------------GAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYL
S22A6_RABIT     --------------------------------GVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAF
GTR3_CANFA      TIIKDFLNYTLEEKSENLPTEVSLSVAIFSVGG-MIGSFSVGLFVNRFGRRNSM---LMVNLLAVAGGCL
YDJE_ECOLI      AKLVSNGWSN---------NFLNAAFTSALMFGYFIGSLTGGFIGDYFGRRRAFRINLLIVGIAATGAAF
HXT3_YEAST      ----------------------------------------------------------------------
EDL11_ARATH     --------------------------------GGAVGALFSGQLAVILGRRRTLWACDFFCVFGWLSIAF
S22A7_RAT       ----------------------------------------------------------------------
S22A1_RABIT     --------------------------------GFFLGSLGVGYIADRFGRK-------LCLLLTTLINAV
STP7_ARATH      ----------------------------------------------------------------------
GTR2_MOUSE      -------------------------------GGMVASFFG-GWLGDKLGRIKAMLAANSLSLTGALLMGC
SV2C_RAT        ------FVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAF---L
S22A6_HUMAN     --------------------------------GVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAF
INT3_ARATH      ALLYI------KEEFGEVDNKTQEIIVSMTXXXXXXXXXXXXWYNDKFGRRMSVLIADVLFLLGALVMVI
YNCC_BACSU      ----------------------------------------------------------------------
XYLE_ECOLI      ----------------------------------------------------------------------
XYLE_ECO57      ----------------------------------------------------------------------
SV2C_MOUSE      ------FVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAF---L
NANT_YERPY      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMIISIVLFSFGTLACGL
NANT_YERPE      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
NANT_YERPA      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
YKT8_SCHPO      ----ILMRLDEVDGPHPPAEGRAPYLTLSQNLGLLVGAMVWSLSADTIGRRWAFNLTLFTGVFAVIAGA-
STP3_ARATH      ----------------------------------------------------------------------
XYLT_LACBR      ---------------------------------------------DRFGRRKLLLLSAIIFFVGALGSAF
QAY_NEUTR       AFIGTTLALPSFKKEFDFASYTPGALALLQSNIVSVYQXXXXXXXXXXXRKSLIAFSVVFIIGAAIMLAA
GTR2_RAT        -------------------------------GGMVASFFG-GWLGDKLGRIKAMLAANSLSLTGALLMGC
YIR0_YEAST      ----------------------------------------------------------------------
STP13_ARATH     -------------------------------------------------------------VFFIIGVAL
QAY_NEUAF       SFIGTTLALPSFTKEFDFASYTPGALALLQSNIVSVYQXXXXXXXXXXXRRSLIAFSVVFIIGAAIMLAA
NANT_YERPS      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
NANT_YERPP      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
NANT_YERPG      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
NANT_YERPB      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
NANT_YERP3      T--------DIKQEFGLTLIQATSLISAAFIGGLVLGAMG-----DRYGRKLAMITSIVLFSFGTLACGL
BENK_ACIAD      PLLMKEWAID--------PVTAGFIGSIALFG-MMFGALIFGTIADKVSRKKVIAVCIILFSLCTVLCGF
SVOP_MOUSE      PQLHCEW---------RLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKT--GLKISVL-WTLYYGIL
S22A6_PIG       --------------------------------GVLLGAMIFGYLANRLGRRKVLILNYLQTAVSGTCAAF
ERDL5_ARATH     --------------------------------GAMIGAAMSGRIADMIGRRATMGFSEMFCILGWLAIYL
S22A7_MOUSE     --------------------------------GVLLGAVVYGYLSDRFGRRRL----LLVAYVSTLALGL
INT1_ARATH      ----------------------------------------------------------------------
HXT5_YEAST      ----------------------------------------------------------------------
HUP3_CHLKE      ----------------------------------------------------------------------
S22AD_HUMAN     --------------------------------GLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAF
S22A6_BOVIN     ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
YFIG_BACSU      --------------------------------------------SDRHGRRKTILYLALLFIAATLGCTF
STP1_ARATH      ----------------------------------------------------------------------
STP11_ARATH     ---------------------------------------------------RLFGRKVSMVILAFLSGAL
PLST3_ARATH     -------------------------------GGAFIGSLFSGLVADGVGRRRAFQLSALPMIVGASVSAS
S22A6_MACFA     --------------------------------GVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAF
S22A4_PAPAN     --------------------------------GVLLGSFVSGQLSDRFGRKN--------VLFATMAVQT
S22A2_HUMAN     --------------------------------GFFIGSMSIGYIADRFGRKLCL---LTTVLINAAAGVL
GHT5_SCHPO      ----------------------------------------------------------------------
OCTL_DROME      --------------------------------GVLLGSIVFGQLSDKYGRKPILFASLVIVLFGVLAGVA
S22A1_BOVIN     --------------------------------GFFLGSLGVGYIADRFGRKVXXXXXXXXXXSLGVLTAV
GHT1_SCHPO      ----------------------------------------------------------------------
S22A1_MOUSE     ----------------------------------------------------------------------
MHPT_ECOLI      --------------------------------GLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAI
GUDP_ECOLI      ----------------------------AFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSMFTLLQGF
GUDP_PSEPU      ----------------------------------VLGQIPGGWLLDRFGSKKVYAGSIFTWSLFTLLQGY
STP9_ARATH      ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
EMRB_ECOLI      ---------------GNLGSSLSQGTWVITSFGVAISIPLTGWLAKRVGEVKLF-------LWSTIAFAI
EMRB_ECO57      ---------------GNLGSSLSQGTWVITSFGVAISIPLTGWLAKRVGEVKLF-------LWSTIAFAI
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SV2A_PONAB      ------FVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLXXXXXXXXXXXX
S22AF_HUMAN     -------------------------------------------LSDRFGRKKVYLTGFALDILFAIANGF
S22A2_RABIT     ----------------------------AVNIGFFIGSVGIGYLADRFGRKLCL---LVTILINAAAGVL
PROP_STAAW      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAAS      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAAR      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAAN      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAAM      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAAC      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
PROP_STAA1      -----------------------------------IGGVVFGIIGDKYGRKVVLTSTIILMAFSTLTIGL
AQR1_YEAST      -----------------------------------------GGLADCFGRRPIILAGMLIYVIASIGLAC
XYLL1_ARATH     PTLSGISWYDL--------SSVDVGI--ITSGGALIGSIVAFSVADIIGRRK----ELILAAFLYLVGAI
SV2A_MACFA      ------FVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLXXXXXXXXXXXX
SV2A_HUMAN      ------FVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLXXXXXXXXXXXX
STP10_ARATH     ----------------------------------------------------------------------
GTR5_RAT        --------------------------------GGFIGSLMVGFLVNNLGRK---GALLFNNIFSILPAIL
S22AF_MOUSE     -------------------------------------------LSDRFGRRKVYLTGFALDILFAVANGF
S22A6_PONAB     ----------------------------------------------------------------------
KGTP_SHIFL      LYFAHIFF----------PSGNTTTQLLQTAGGFLMRPIGFGRIADKHGRKKSMLLSVCMMCFGSLVIAC
KGTP_ECOLI      LYFAHIFF----------PSGNTTTQLLQTAGGFLMRPIGFGRIADKHGRKKSMLLSVCMMCFGSLVIAC
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      -------------------------------------------MSDFNGRRKNILFLAVIFFISTIGCTF
S226A_XENLA     ----------------------------------------------------------------------
INT2_ARATH      ----------------------------------------------------------------------
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      PAIA--------HSLNRSPLAMQSAIISYTLTVAMLIPVS-GWLADRFGTRRIFTLAVSLFTLGSLACAL
EDL18_ARATH     ----------------------------------------------------------------------
ANTR6_ARATH     --------------------------------GYALSQLPGGWLSKIFGGRKVLEIGVFTWSFATLVPLL
SV2A_BOVIN      ------FVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLXXXXXXXXXXXX
SHIA_ECOLI      ALV-----FNREFFPQVSPAMGTLAAFATFGVGFLLGGVIFGHFGDRLGRKRMLMLTVWMMGIAT---AL
PLST4_ARATH     ----------------------------------------------------------------------
GUDP_BACSU      ----------------------------------VIGQLPGGWLLDRFGSKTIIALSIFFWSFFTLLQAI
YDFJ_ECOLI      ----------------------------------IVGAFIFGKMGDRIGRKKVLFITIMMGICTTLIGVL
NANT2_ECOL6     --------------------------------GSAAGSCIGGFMGDWLGTRKAYVISLLIGQLVIIPVFL
YN41_SCHPO      ----------------------------------------------------------------------
S22A1_HUMAN     ------------------------------NAGFFFGSLGVGYFADRFGRKLCL---LGTVLVNAVSGVL
S17A5_SHEEP     --------------------------------GYIITQIPGGYVASRSGGKLLLGFGIFATAIFTLFTPL
PROP_STAEQ      -----------------------------------IGGIVFGIIGDKYGRKIVLTTTIILMAFSTLLIGV
STP2_ARATH      ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      HLFPPVI------RDWGVPVSAVTLVVSLGVVAMAIGALVSGPVADRWGRKGVTVVGFVLFCLATAGLGL


                         +         .         .         .         .         *         .:210
query           SSDSPGVSIVGLLIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMGAVFAMQGIGQFXXXXXXXXXX
PHO84_YEAST     VAHSPAINFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILV
PHT17_ORYSJ     SFGDTPTSVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFXXXXXXXXXXXXX
PHT13_ARATH     SLGNSAKGVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGVGILAGGFVALAVS
PHT17_ARATH     SFGSNPKTVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILTGGIFAIIVS
PHT15_ORYSJ     SFGSSAKGVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLTGGIVAIIVS
PHT12_ORYSJ     SFGHTPKSVIATLCFFRFWLGFGIGGDYPLSATIMSEYASKKTRGAFIAAVFAMQGFGILFGAIVALVVS
PHT11_ORYSJ     SFGSSAKGVVSTLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGILFGAIVALAVS
PHT11_ARATH     SFGHEAKGVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGVGILAGGFVALAVS
PHT12_ARATH     SFGNEAKGVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGVGILAGGFVALAVS
PHT18_ORYSJ     SFSHTPTSVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILAGGIVTLIIS
PHT16_ARATH     SLGRDPKTVMVTLCFFRFWLGFGIGGDYPLSATIMSEYSNKRTRGAFIAAVFGMQXXXXXXXXXXXXXXX
PHT14_ORYSJ     SFGSSAKGVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLTGGIVAIIVS
PHT14_ORYSI     SFGSSAKGVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLTGGIVAIIVS
PHT13_ORYSJ     SFGRTAKGVVATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGILFGAIVALVVS
PT112_ORYSJ     SFSHTPTSVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILAGGVVTLAMS
PHT15_ARATH     SFGHSANGVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILAGGIVSLIVS
PHT14_ARATH     SFGHEPKAVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFVSAVXXXXXXXXXXXXXXXXXXX
PHT19_ARATH     SVCTTRRSCVMVSLFFRFVLGLGIGGDYPLSATIMSEFANKRTRGAFIAAVFSMQGLGILMSSAVTMVVC
YHD1_SCHPO      SIHSP-LSKMMWVFCWRWLLGVGIGGDYPMSAAITSERSKLNRRGTLISLIFAFQGFGTLAGAIVTIILL
PT111_ORYSJ     SFGSSRKAVIGTLCFFRFWLGFGIGGDYPLSATIMSEYSNKKTRGAFIAAVFAMQGVGIIFAGLVSMIVS
YBN1_SCHPO      SIHSP-LSKMMWVFCWRWLLGVGIGGDYPMSAAITSERSKIKRRGTLISLIFAFQGFGTLAGAIVTIILL
PHT16_ORYSJ     SFGHTPTSVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGIITGGLVAILVX
PT113_ORYSJ     SSKHEGMNIIAVLCFFRFWLGVSIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLAAGIIGMIVS
PHT18_ARATH     SVCTTRRSCVMVXXXXXXXXXXXXXXDYPLSATIMSEFANKRTRGAFIAAVFSMQGLGILVSSAVTMAVC
YAEC_SCHPO      XPKSIPTPLGKMMIFWRWLLGLGIGGDYPMSATITXXXXXXXXXXXXXXIVFSFQGFGTLAGAIVTIILL
YCX2_SCHPO      LPDTPTAKMMWLFAF-RVMLGIGIGGDYPMSASITSEQSLINRRGALLAWIFSNQGWGTLAGCVATLIIL
PT110_ORYSJ     XXXRTRRCALASLCFFRFXXXXXXXXDYPLSATIMSEFANRRTRGAFIAAVFSMQGFGXXXXXXXXFDHY
PHT19_ORYSJ     XXXRTRRCALASLCFFRFXXXXXXXXDYPLSATIMSEFANRRTRGAFIAAVFSMQGFGXXXXXXXXFDHY
YAAU_ECOLI      VS-----SPVELLVM-RVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATC---------
GIT1_YEAST      CAASHGTTVPGM--FWRGLVGIGVGAEYPTSTLSANESATTTKRGGILVMVTNLPLA--FGGPFATIIFL
YHM9_SCHPO      CTGAYGYSINGMLIAYRFFLGIGIGAEYPCGSVAASE-SSNELKSGLRHAAFIVVTDGAI---------D
GALP_ECOLI      SAAAPNVEV---LILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYL------
GALP_ECOL6      SAAAPNVEV---LILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYL------
ITR2_SCHPO      SRN------VAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLRGRLVIIYVVFITGGQL----------
SVOPL_MOUSE     TSFSPSYI---WFVFLRTMVGCGVSG-HAQGLIIKTEFLPTKYRGYMLSQVFWLAG--------------
ARAE_BACSU      ----------------------------------------------------------------------
SVOPL_HUMAN     TSFAPSYI---WFVFLRTMVGCGVSG-HSQGLIIKTEFLPTKYRGYMLSQVFWLAG--------------
YYAJ_BACSU      AWDIPS------LMTFRFLTGFGVAAAMVITNSYLAEFFPSSVRGKYISAMIGLIGV-------------
PROP_ECOLI      SYDTIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRG-FMGSWLDFGSI-------XXXXXX
PROP_ECO57      SYDTIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRG-FMGSWLDFGSI-------XXXXXX
YWTG_BACSU      APNT------GVMVLFRIILGLAVGTSTTIVPLYLSELAPKHKRGALSSLNQLMITVG----------IL
EDL14_ARATH     AKD------VRLLDLGRLLQGISVGISSYLGPIYISELAPRNLRGAASSLMQLFVGVG------------
SV2B_HUMAN      ASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSGIFWMTGGLYASAMAWSIIPH
YOU1_CAEEL      SGMSPHFYV---LLFFRGLTGFGIGG-VPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVM
PLT5_ARATH      SPN------YAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLNSEVFINAGI------------M
HXT2_YEAST      SSDKWYQYFIG-----RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIF----------
HGT1_KLULA      AQDQ------AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVG------IMVLFY
SVOP_PONAB      SAFAPVYSWILVL---RGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTV----------
SVOP_HUMAN      SAFAPVYSWILVL---RGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTV----------
HXT16_YEAST     SNHKWYQYFVG-----KIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY---
ARAE_KLEOX      SVGSAFATSVEMLLVARIVLGVAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVMAF-------
HXT15_YEAST     SNHKWYQYFVG-----KIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY---
GHT3_SCHPO      ----------------KILAGVGIGALSVLSPGYQSEVAPPQIRGA----VVATYQIFSTGAALVAACIN
HXT13_YEAST     SNHKWYQYFVG-----KIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY---
GHT6_SCHPO      TIPSWVQMMVA-----KIWTGLGIGALSVIAPGYQSESSPPHIRGAIVTTYQLFITLGIFIAACINMGTH
HXT17_YEAST     SNHKWYQYFVG-----KIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY---
CSBC_BACSU      SQT------IGMLIASRVILGLAVGGSTALVPVYLSEMAPTKIRGTLMNNLMIVTGI------------L
YCEI_BACSU      SGISAFVTSLSAFLILRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVI
ITR1_YEAST      SAHTFWQMAVG-----RLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLV---------
ERDL7_ARATH     AKG------VVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGA------------------------
PLT6_ARATH      MGWGPNYPV---LLSGRCTAGLGVGFALMVAPVYSAEIATASHRGLLASLPHLCISIGILLGYIVNYFFS
HXT9_YEAST      SINKWYQYFIG-----RIISGLGVGGIAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFL---------
ITR2_YEAST      AHK-----------FWRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGC-----
HXT1_YEAST      ----------------RIISGLGVGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIF----------
QUTD_EMENI      MLGANGDRGLGLIYGGRVLAGIGVGAGSNICPIYISEMAPPAIRGRLVG----VYELGWQIGGVVGFWIN
HXT11_YEAST     SINKWYQYFIG-----RIISGLGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFL---------
GAL2_YEAST      ----------------RIISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAGIF----------
EDL15_ARATH     AKG------VWLLDLGRLLQGISIGISVYLGPVYITEIAPRNLRGAASSFAQLFAGVG------------
PROP_SALTY      SYATIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRKRG-FMGSWLDFGSI-------XXXXXX
XYLL3_ARATH     APD------LNILLVGRLLYGFGIGLAMHGAPLYIAETCPSQIRGTLISLLFIVLGI------------L
S22A6_RAT       AAYAPNYTVYCV---FRLLSGMSLASIAINCMTLNVEWMTRAYVGTLIGYVYSL---GQFLL--------
S22A6_MOUSE     AAYAPNYTVYCI---FRLLSGMSLASIAINCMTLNMEWMTRAYVGTLIGYVYSL---GQFLL--------
S22AD_MOUSE     ------VSSFELYLALRFVLATANAGFLLSTNVLISEWVGPSWRTQAVVLAQSNVALGQMVLAGLAY---
HXT10_YEAST     SSDKWYQYFIG-----RIVSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGIF----------
ORCT_DROME      APEYFSYTIS------RMIVGATTSGVFLVAYVIALEMVGSSYR------LFAGVAMQMFFSV-------
PCAK_ACIAD      STN------LDSLVIFRFLTGIGLGAAMPNATTLFSEYCPARIRSLLVTCMFCGYNLG------------
PLST1_ARATH     SLDE--------ILCGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLLGIIFSL----------------
MUCK_ACIAD      TQSFIQFGVL------RFFASLGLGSLYIACNTLMAEYVPTKYRTTVLGTLQAGWTVGYIVATLLAGW--
SVOP_RAT        SAFAPVYSWILVL---RGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTV----------
GLCP_SYNY3      ----------------------------------------------------------------------
GHT4_SCHPO      ----------------KLFTGLTIGALSVLSPGYQSEVAPPQIRGAVVSTYQLFQTCGTLIAACINM---
GHT2_SCHPO      ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
ARAE_ECOLI      ATS------VEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFL------
ARAE_ECO57      ATS------VEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFL------
EDL10_ARATH     AKN------VLWLDLGRISLGIGVGLTSYVVPVYIAEITPKHVRGAFSASTLLLQNSG------------
SVOP_BOVIN      SAFAPVYSWILVL---RGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTV----------
SV2C_HUMAN      SSFVQGY---GFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAII
STP4_ARATH      ---------IAMLLIGRILLGFGVGFANQSVPVYLSEMAPPNLRGAFNNGFQVAIIFGIVVATIINYF--
QAY_NEUCR       DGQGRGIDPI---IAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVG----IYELGWQIGGLVGFWIN
HEX6_RICCO      ----------------------------------------------------------------------
ERDL8_ARATH     AKDVP-------LDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALLNQLFIVIGLASMFL--------
S22A6_RABIT     S---PNFTVY---CTFRLLSGMSLAGIALNCMTLNVEWMTRAYVGTLAGYVYST---GQFLL--------
GTR3_CANFA      MGFCKIAQSVEMLILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFLGIVIGILVAQIF----------
YDJE_ECOLI      VPD------MYWLIFFRFLMGTGMGALIMVGYASFTEFIPATVRGKWSA---RLSFVGNW----------
HXT3_YEAST      ----------------RIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIF----------
EDL11_ARATH     AKN----------VFWRISLGIGVGLISYVVPVYIAEITPKHVRGAFTASNQLLQNSG------------
S22A7_RAT       ----------------------------------------------------------------------
S22A1_RABIT     SGVLTAVAYTSMLLF-RLLQGLVSKGSWMSGYTLITEFVGSGYRRTVAILYQVAFSVGLVAL--------
STP7_ARATH      -----GAVNLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAPTHLRGGLNMMFQLATTIGIF----------
GTR2_MOUSE      SKFGPAHA---LIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGAL-GTLHQL----------------
SV2C_RAT        SSFVQG---YGFFLLCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAII
S22A6_HUMAN     APNFP------IYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLL--------
INT3_ARATH      AH-APWVIILG-----RLLVGFGVGMASMTSPLYISEMSPARIRGALVSTNGLLITGGQFL---------
YNCC_BACSU      ---------VFIMAVFRFLLGLAVGGASAMVPAFLAEMAPHEKRGRMVTQNELMIVGGQFL---------
XYLE_ECOLI      ----------------------------------------------------------------------
XYLE_ECO57      ----------------------------------------------------------------------
SV2C_MOUSE      SSFVQG---YGFFLVCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAII
NANT_YERPY      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERPE      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERPA      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
YKT8_SCHPO      ---SPNFASI---CVFDALWSFGVGGNLPVDSAIFLEASSHQWLLTVMSFWWA---IGQ----VIANLVS
STP3_ARATH      ---------VAMLIIARLLLGVGVGFANQSVPLYLSEMAPAKYRGAISNGFQLCIGIGFL----------
XYLT_LACBR      SPE------FWTLIISRIILGMAVGAASALIPTYLAELAPSDKRGTV-SSLFQLMVMTGILLAYITNYSF
QAY_NEUTR       DGQGRGIAPI---IAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVG----IYELGWQIGGLVGFWIN
GTR2_RAT        SKFGPAHA---LIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGAL-GTLHQL----------------
YIR0_YEAST      ----------------------------------------------------------------------
STP13_ARATH     NA---GAQDLAMLIAGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNY---
QAY_NEUAF       DGQRRGVDPI---IAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVG----IYELGWQIGGLVGFWIN
NANT_YERPS      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERPP      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERPG      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERPB      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
NANT_YERP3      A---PGYTT---LFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIG------------
BENK_ACIAD      SETTTQFSI------FRFLAGVGIGGVMPNVIALVSEYAPKKFKSFFVTLMFSGYAIG------------
SVOP_MOUSE      SAFAPVYSWILVL---RGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTV----------
S22A6_PIG       APNFP------VYCAFRLLSGMSLAGISLSCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLL--------
ERDL5_ARATH     SKVAIWLDV------GRFLVGYGMGVFSFVVPVYIAEITPKGLRG-------------------------
S22A7_MOUSE     MS-AASVNYI-MFVTTRMLTGSALAGFTIIVLPLELEWLDVEHR-TVAGVIST-----------------
INT1_ARATH      ----------------------------------------------------------------------
HXT5_YEAST      ----------------RIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIF----------
HUP3_CHLKE      ----------------------------------------------------------------------
S22AD_HUMAN     ------VPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAY---
S22A6_BOVIN     ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
YFIG_BACSU      S---PNASV---MIAFRFLLGLAVGCASVTVPTFLAEISPAERRGRIVTQNELMIVIGQLLAYT------
STP1_ARATH      ---------VWMLIVGRILLGFGIGFANQAVPLYLSEMAPYKYRGAL----------------------N
STP11_ARATH     LN---GLAILEMLIIGRLFLGVGVGFANQSVPLYLSEMAPAKIRGALNIGFQLAITIG------------
PLST3_ARATH     TE-----SLMGMLL-GRFLVGIGMGIGPSVTALYVTEVSPAYVRGTYGSSTQIATCIGLLG---------
S22A6_MACFA     APNFP------IYCAFRLLSGMSLAGIALNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLL--------
S22A4_PAPAN     GFSFLQIFSISWEMFTVLFLIVGMG---QISNYVVAFILGTEILGKSVRIIFSTLGVCTFFAVGYMLLPL
S22A2_HUMAN     MAISP--TYTWMLIF-RLIQGLVSKAGWLIGYILITEFVGRRYR----------RTVGIFYQXXXXXXXX
GHT5_SCHPO      ------------IMFWTIVYLIGI---------ILQVTAVPSWVQIMVAKIWTGLSIGALSVLAP-----
OCTL_DROME      PE-------YFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKR--LYAGIFVMMFFS------------
S22A1_BOVIN     APD-----YTSLLIF-RLLQGLVSKGSWTAGYTLITEFVGLGYRRTV-AILYQM----------------
GHT1_SCHPO      ----------------------------------------------------------------------
S22A1_MOUSE     ----------------------------------------------------------------------
MHPT_ECOLI      AWDFPS------LVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMY------------------
GUDP_ECOLI      VDIFSGFGIIVALFTLRFLVGLAEAPSFPGNSRIVAAWFPAQERG-------------------------
GUDP_PSEPU      IGEFGISTAVVLLFLLRFMVGLAEAPSFPGNARIVASWFPTKERG-------------------------
STP9_ARATH      ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
EMRB_ECOLI      ASWACGVSSLNMLIFFRVIQGIVAGPLIPLSSLLLNNYPPAK----------------------------
EMRB_ECO57      ASWACGVSSLNMLIFFRVIQGIVAGPLIPLSSLLLNNYPPAK----------------------------
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SV2A_PONAB      XQG------YGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAII
S22AF_HUMAN     SPSYEFFAVT------RFLVGMMNGGMSLVAFVLLNEVGTAYWALASIGGLFFAVGIAQYALLGYFI---
S22A2_RABIT     MAVSPNYT---WMLIFRLIQGLVSKAGWLIGYILITEFVGLNYR-RTVGILY------------------
PROP_STAAW      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAAS      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAAR      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAAN      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAAM      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAAC      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
PROP_STAA1      SYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSL-----------------------
AQR1_YEAST      APS------YGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQ-----------
XYLL1_ARATH     V--TVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGRMI----------------------
SV2A_MACFA      XQG------YGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAII
SV2A_HUMAN      XQG------YGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAII
STP10_ARATH     ----------------------------------------------------------------------
GTR5_RAT        MGCSKIAKSFEIIIASRLLVGICAGISSNVVPMYLGELAPKNLRGA-LGVVPQL-----FITVGILVAQL
S22AF_MOUSE     SPSYEFFAVT------RFLVGMMNGGMSLVAFVLLNEVGTTYWALASIGGLFFAVGIAQYALLGYFI---
S22A6_PONAB     ----------------------------------------------------------------------
KGTP_SHIFL      ---LPGYETIGXXXXXXXFQGLSVGGEYGTSATYMSEVAVEGRKG-------------------------
KGTP_ECOLI      ---LPGYETIGXXXXXXXFQGLSVGGEYGTSATYMSEVAVEGRKG-------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      A---PNVTV---MIISRFVLGIAVGGASVTVPAYLAEMSPVESRGRMVTQNELMIVSGQLLAFV------
S226A_XENLA     ----------------------------------------------------------------------
INT2_ARATH      ----------------------------------------------------------------------
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      SNSLP------QLVVFRVIQGIG-----------------------------------------------
EDL18_ARATH     ----------------------------------------------------------------------
ANTR6_ARATH     AGFMPG------LIFSRILVGIGEGVSPSAATDLIARTIPVKERSRAVGFVF------------------
SV2A_BOVIN      XQG------YGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAII
SHIA_ECOLI      IGILPSFSTIGLLVTLRAIQGFAVGGEWGGAALLSVESA-------------------------------
PLST4_ARATH     ----------------------------------------------------------------------
GUDP_BACSU      GFFSAGTAII-LLFALRFLVGLSEAPSFPGNGRVVASWFPSSERG-------------------------
YDFJ_ECOLI      PTYAQGVFAPILLVTLRIIQGLGAGAEISGAGTMLAEYAPKGKRGIISSFV-------------------
NANT2_ECOL6     V-DRDYVWLLGLLIFTQQVFGQGIGALVPK---IISGYFNVEQRAAGLGFIYNVGSLG------------
YN41_SCHPO      ----------------------------------------------------------------------
S22A1_HUMAN     MAFSP--NYMSMLLF-RLLQGLVSKGNWMAGYTLITEFVGSGSRRAIMYQMAFTVGL----------VAL
S17A5_SHEEP     AADFG----VGALVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLLSISYAGAQLG------------
PROP_STAEQ      TYNEIGVWAPILLLLARVLQGFSTGGEYAGAMVYVAESSPDRKRNSL-----------------------
STP2_ARATH      ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      TGDIHSFAAL------RIISCFGLGAVMPVALTIVADWMPKARRAQMVSIAFAGVGVG------------


                         .         .         .         +         .         .         .:280
query           XGFKESLKTAESESQCSGVCQVAVDKMWRVVIGFGAVPGCIALYYRLTIPETPRYTFDVQRDVVKGAEDT
PHO84_YEAST     AAYKGELEYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKXXXXXXXX
PHT17_ORYSJ     XXXXXXXXXXXXXXXXXXXXXXQADYVWRLILMFGALPAALTFYWRMRMPETARYTAIVAKNAERAAADM
PHT13_ARATH     SIFDKKFPSPTYEQDRFLSTPPQADYIWRIIVMFGALPAALTYYWRMKMPETARYTALVAKNIKQATADM
PHT17_ARATH     AAFEAKFPAPTYQIDALASTVPQADYVWRIILMVGALPAAMTYYSRSKMPETARYTALVAKDAKLAASNM
PHT15_ORYSJ     AAFKLRFDAPAYRDDRAGSTVPQADYAWRIVLMFGAIPALLTYYWRMKMPETARYTXXXXXXXXXXXXXX
PHT12_ORYSJ     AGFRHAYPAPSYAQNPAASLAPQADYTWRLILMFGTIPAGLTYYWRMKMPETARYTALVARNAKQAAADM
PHT11_ORYSJ     AGFRHAYPAPSYSDNHAASLVPQADYVWRIILMFGTVPAALTYYWRMKMPETARYTALIARNAKQAAADM
PHT11_ARATH     SIFDKKFPAPTYAVNRALSTPPQVDYIWRIIVMFGALPAALTYYWRMKMPETARYTALVAKNIKQATAD-
PHT12_ARATH     SIFDKKFPAPTYAVNRALSTPPQVDYIWRIIVMFGALPAALTYYWRMKMPETARYTALVAKNIKQATAD-
PHT18_ORYSJ     SAFRAGFPAPAYQDDRAGSTVRQADYVWRIILMLGAMPALLTYYWRMKMPETARYTXXXXXXXXXXXXDM
PHT16_ARATH     XXFESKFPSRAYILDGAASTVPQADYVWRIILMVGALPALLTYYWRMKMPETARYTALVSKNAEQAALDM
PHT14_ORYSJ     AAFKSRFDAPAYRDDRTGSTVPQADYAWRIVLMFGAIPALLTYYWRMKMPETARYTXXXXXXXXXXXXDM
PHT14_ORYSI     AAFKARFDAPAYRDDRAGSTVPQADYAWRIVLMFGAIPALLTYYWRMKMPETARYTXXXXXXXXXXXXDM
PHT13_ORYSJ     AGFRNAYPAPSYADGRAASLVPEADYVWRIILMFGTVPAALTYYWRMKMPETARYTALIARNAKQAAADM
PT112_ORYSJ     AGFQAAFPAPAYEVNAAASTVPQADYVWRIILMLGALPAILTYYWRMKMPETARYTALVAKDAKQASSDM
PHT15_ARATH     STFDHAFKAPTYEVDPVGSTVPQADYVWRIVLMFGAIPALLTYYWRMKMPETARYTALVARNTKQAASDM
PHT14_ARATH     XXXEAKFPSPAYADDALGSTIPQADLVWRIILMAGAIPAAMTYYSRSKMPETARYTALVAKDAKQAASDM
PHT19_ARATH     LAFKNAGEGSSEKTNVAGLETLASDIAWRLILMIGALPAALTFYWRMLMPETARYTALVENNVVQAAKDM
YHD1_SCHPO      GCFEHPLNREGHYRKLEGV--------WRLQFGLALVPAIGVLIPRLMMEETQKFKNSQQLELVKNPSVT
PT111_ORYSJ     SIFLTYNKAPSYKGNHDLSRQMAADYVWRIVLMIGAFPALATFYWRMKMPETARYT--------------
YBN1_SCHPO      GCFEHPLNREGHYHKLEGV--------WRLQFGLALVPAIGVLIPRLIMKESKSYENSKALNSAEG-KDP
PHT16_ORYSJ     XXXXXXXXXXXYGEDPVASTPPQADFVWRIILMLGALPAALTYYWRTKMPETARYTXXXXXXXXXXXXDM
PT113_ORYSJ     AAFKHSSAS-------------KIDYAWRIILMFGAIPAALTYHWRMKMPETARYTALISKNAKKAAKDM
PHT18_ARATH     VAFKRSGGGLEVDA----AAPTEADLAWRLILMIGALPAALTFYWRMLMPETARYTALVENNIVQAAKDM
YAEC_SCHPO      ACFEKPLNQRGEYTKLEGV--------WRLQMGXXXXXXXXXXXXXXTMKESKSYE---QSKALNKYTDN
YCX2_SCHPO      ACFEKPLNDRGEYTKLNGV--------WRIQFGIALFPAVIVLIPRLRMQESEQ--FKNSKNMLDSASQI
PT110_ORYSJ     TGYPAPLDTPE-----------CADLAWRIILMAGAVPAALTYYWRMSMPETARYTALVERDVVKATNDI
PHT19_ORYSJ     TGYPAPLDTPE-----------CADLAWRIILMAGAVPAALTYYWRMSMPETARYTALVERDVVKATND-
YAAU_ECOLI      -------------ADLVGYWLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWL--LRKGRVKECEEM
GIT1_YEAST      IVYKI----------CSGTKHL--EAIWRTVFAIGCFWPLSVFYFRWKTATTEVY---------------
YHM9_SCHPO      FGFVVGALVPYILVCIFGEHHLRI--VWRLSIGLGLVIPCVLLPFRIAM------------------KDP
GALP_ECOLI      ---------SDTAFSYTGA--------WRWMLGVIIIPAILLLIGVFFLPDSPRW-FAAKRRFV----DA
GALP_ECOL6      ---------SDTAFSYTGA--------WRWMLGVIIIPAILLLIGVFFLPDSPRW-FAAKRRFV----DA
ITR2_SCHPO      --IAYSLNAAFEH----------VHQGWRIMFGIGAAPALGQLISLFWTPESPRY-------LLRHNHVE
SVOPL_MOUSE     -----SLLIISMAS-------VVIPTIWRWLIRIASIPGIILIMAFKFIPESARFNVST-----------
ARAE_BACSU      --------------QRSGTYEWGVHTGWRWMLAYGMVPSVIFFLVLLVVPESPRW-------LAKAGKTN
SVOPL_HUMAN     ------------SLLIIGLASVIIPTIWRWLIRVASIPGIILIVAFKFIPESARFNVST-----------
YYAJ_BACSU      --------------PITNIVSAFVIPLWRLVFVWGAV-GLIYFFFIHRLEESPRWHENAKADAILTRIEE
PROP_ECOLI      XXXXXXISTIVGEAN-------FLDWGWRIPFFIALPLGIIGLYLRHALEETPAF----QQHVDKLEQ--
PROP_ECO57      XXXXXXISTIVGEAN-------FLDWGWRIPFFIALPLGIIGLYLRHALEETPAF----QQHVDKLEQ--
YWTG_BACSU      LSYIVNYIFADAEA-------------WRWMXXXXXXXXXXXXIGILFMPESPRWLF------TNGEESK
EDL14_ARATH     ---------------LSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLAKVGRE--KEVEGV
SV2B_HUMAN      YGWGFSMGTNYHFHS------------WRVFVIVCALPCTVSMVALKFMPESPRFLLEMGKHILKQVHDT
YOU1_CAEEL      ESFG-----------------------WRALMFLSSLPLGIFAVASFWLPESAR--FDMAS---------
PLT5_ARATH      LGYVSNLAFSNLPLKVG----------WRLMLGIGAVPSVILAIGVLAMPESPRWL------VMQGRLGD
HXT2_YEAST      LGYCTNYGTKDYSNSV----------QWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGR-----YEDA
HGT1_KLULA      IGY-----------GCHFIDGAAA---FRITWGLQMVPGLILMVGVFFIPESPRWLANHDR-----WEET
SVOP_PONAB      --FEVVLAVF-----------VMPSLGWRWLLILSAVPLLLFAVLCFWLPESARY------DVLSGNQEK
SVOP_HUMAN      --FEVVLAVF-----------VMPSLGWRWLLILSAVPLLLFAVLCFWLPESARY------DVLSGNQEK
HXT16_YEAST     -GTRKYSNTAQ----------------WRIPVGLCFLWALIIIVGMLLVPESPRYLIECERH-----EEA
ARAE_KLEOX      --------LSDTAFSYSG--------NWRXXXXXXXXXXXXXXXXXXXXPNSPRWLAEKGRHV--EAEEV
HXT15_YEAST     -GTRKYSNTAQ----------------WRIPVGLCFLWALIIIVGMLLVPESPRYLIECERH-----EEA
GHT3_SCHPO      MGTHKLRKTAS----------------WRTSFGINMLWGILLMVGVLFLPESPRYLIYKGRD-----EEA
HXT13_YEAST     -GTRKYDNTAQ----------------WRVPLGLCFLWALIIIIGMLLVPESPRYLIECERH-----EEA
GHT6_SCHPO      K------YTTHPEAQ------------WRVPIGINLLWGILMFFGMLFLPESPRYL------AVKGRNEE
HXT17_YEAST     -GTRKYDNTAQ----------------WRVPLGLCFLWTLIIIIGMLLVPESPRYLIECERH-----EEA
CSBC_BACSU      LAYIVNYLFTPFEA-------------WRWMXXXXXXXXXXXXXXXXFMPESPRWL------VKRGSEEE
YCEI_BACSU      PSFG-----------------------WQXXXXXXXXXXXXXXXXRTSLPDSPKY------------ESL
ITR1_YEAST      -------------AYGCGAGLNYVNNGWRILVGLSLIPTAVQFTCLCFLPDTPRY-YVMKGDLARATEVL
ERDL7_ARATH     ------LTTLNQILICTGVSVIGTLVTWRVLALIGIIPCAASFLGLFFIPESPRWLAKVGRDTEFEAALR
PLT6_ARATH      --------------------KLPMHIGWRLMLGIAAVPSLVLAFGILKMPESPRWL--IMQGRLKEGKEI
HXT9_YEAST      -GYCTNYGTKNYHNATQ----------WRVGLGLCFAWTTFMVSGMMFVPESPRYLIEVGKD-----EEA
ITR2_YEAST      -----------------GAGLNHVKNGWRILVGLSLIPTVLQFSFFCFLPDTPRYY--VMKGDLKRAKMV
HXT1_YEAST      LGYCTNFGTKNYSNSV----------QWRVPLGLCFAWALFMIGGMMFVPESPRYLVEAGR--IDEARAS
QUTD_EMENI      YGVDETLAPSH--------------KQWIIPFAVQXXXXXXXXXXXXXXRESPRWLF-LRGNREKGIE-T
HXT11_YEAST     -GYCTNYGTKNYHNATQ----------WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKD-----EEA
GAL2_YEAST      LGYCTNYGTKSYSNSV----------QWRVPLGLCFAWSLFMIGALTLVPESPRYLCEVNK-----VEDA
EDL15_ARATH     ---------------ISVFYALGTIVAWRNLAILGCIPSLMVLPLLFFIPESPRWLAKVGREM-----EV
PROP_SALTY      XXXXXXISTIVGEEN-------FLEWGWRIPFFIALPLGIIGLYLRHALEETPAF----QQHVDKLEQ--
XYLL3_ARATH     LGFSV------------GSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLL---LRAVQGKGQL
S22A6_RAT       ----------------AGIAYAVPH--WRHLQLVVSVPFFIAFIYSWFFIESARYSSSGRLDLTLRALQR
S22A6_MOUSE     ----------------AGIAYAVPH--WRHLQLAVSVPFFVAFIYSWFFIESARYSSSGRLDLTLRALQR
S22AD_MOUSE     -----------------GV------RNWRLLQITGTAPVLLLFFYFWVLPESPRWLLSQGREEAKQLVQK
HXT10_YEAST     LGYCTNYGTKKYSNSI----------QWRVPLGLCFAWAIFMVIGMVMVPESPRYL--VEKGKYEEARRS
ORCT_DROME      -GFMLT----------AGFAYFIHDWRWQIAI---TLPGLLFLCYYWIIPESARWL------LMKGRKDE
PCAK_ACIAD      ----------------------------------------------------------------------
PLST1_ARATH     ---------------LLGIPAEDDPHWWRTMLYVASMPGFLLALGMQFAVESPRWLCKVGR-----LDDA
MUCK_ACIAD      ---------------------LIPDHGWRVLFYVAIIPVLMAVLMHFFVPEPAAW---------------
SVOP_RAT        --FEVLLAVF-----------VMPSLGWRWXXXXXXXXXXXXXXXCFWLPESARY------DVLSGNQEK
GLCP_SYNY3      ---------------------------WRWMFWTELIPALLYGVCAFLIPESPRYL------VAQGQGEK
GHT4_SCHPO      -GTHKLRKTAS----------------WRTSFGINILWGIFLMVGVLFLPESPRYLIYKGRD-----EEA
GHT2_SCHPO      ---------------------------WRVSIGINLLWGIITMIGILFLPESPRYLIQVGKD-----EEA
EDL16_ARATH     ---------------------------WKTLALTGLAPCIVLLFGLCFIPESPRWLAKA------GHEKE
ARAE_ECOLI      ---------SDTAFSYSG--------NWRAMXXXXXXXXXXXXXXXXXXXNSPRWLAEKGRHIE--AEEV
ARAE_ECO57      ---------SDTAFSYSG--------NWRAMXXXXXXXXXXXXXXXXXXXNSPRWLAEKGRHIE--AEEV
EDL10_ARATH     ---------------ISLIYFFGTVINWRVLAVIGALPCFIPVIGIYFIPESPRWLAKI--GSVKEVENS
SVOP_BOVIN      --FEVVLAVF-----------VMPSLGWRWLLILSAVPLLLFAVLCFWLPESARY------DVLSGNQEK
SV2C_HUMAN      PHYGWSFSMGSAYQFHS----------WRVFVIVCALP-CVSSVVALTMPESPRFLLEVGKHILKLIHDT
STP4_ARATH      --------TAQMKGNIG----------WRISLGLACVPAVMIMIGALILPDTPNSL--IERGYTEEAKEM
QAY_NEUCR       YGVNTTMAPTRSQ--------------WLIPFAVQLIPAGLLFLGSFWIPESPRWLYNGKREEIRNLEPT
HEX6_RICCO      ---------------------------WRISLAMAAVPAAILTFGALFLPETPNSLIQRSND-----HER
ERDL8_ARATH     ---------------------IGAVVNWRTLALTGVAPCVVLFFGTWFIPESPRWLEMV------GRHSD
S22A6_RABIT     ----------------AGVAYAVPH--WRYLQLLVSVPFFAFFVYSWFFIESARYSTPGRLDLTLKALQK
GTR3_CANFA      -GLKVIMGTEE---------------LWPLLLGFTIIPAVLQSAALPFCPESPRFLL-INRKEEENAKEI
YDJE_ECOLI      ---------SPMLSAAIGVVVIAFFS-WRIMFXXXXXXXXXAWFLSKYFIESPRWL--AGKGQIAGAECQ
HXT3_YEAST      LGYCTNFGTKNYSNSV----------QWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQ-----IDEA
EDL11_ARATH     ---------------VSLIYFFGTVINWRVMAVIGAIPCILQTIGIFFIPESPRWLAKIR--LSKEVESS
S22A7_RAT       ------------------------------------VPGIISIWW---VPESARWLLTQGR-----VEEA
S22A1_RABIT     ----------------SGVAYAIPN--WRWLQLTVSLPTFLCLFYYWCVPESPRWLLSQKRDAVK-IMDN
STP7_ARATH      -----------TANMVNYGTQQLKPWGWRLSLGLAAFPALLMTLGGYFLPETPNSL------VERGLTER
GTR2_MOUSE      -----ALVTGILISQIAGLSFILGNQHWHILLGLSAVPAXXXXXXXXFCPESPRYLYIKLEEEVRAKKSL
SV2C_RAT        PHYGWSFSMGSAYQFHS----------WRVFVIVCALP-CVSSVVALTMPESPRFLLEVGKHILKLIHDT
S22A6_HUMAN     ----------------AGVAYAVPH--WRHLQLLVSAPXXXXXXXXXXXIESARWHSSSGRDLTLRALQR
INT3_ARATH      -------------SYLINLAFVHTPGTWRWMLGVSAIPAIIQFCLMLTLPESPRWLY---------RNDR
YNCC_BACSU      ---------AYVFNAILGVTMANTGHVWRYMLVICAVPAIMLFASMLKVPESPRWLISKGKNVLKQIRED
XYLE_ECOLI      ---------------------------WRYMFASECIPALLFLMLLYTVPESPRWLMS------RGKQEQ
XYLE_ECO57      ---------------------------WRYMFASECIPALLFLMLLYTVPESPRWLMS------RGKQEQ
SV2C_MOUSE      PHYGWSFSMGSAYQFHS----------WRVFVIVCALP-CVSSVVALTMPESPRFLLEVGKHILKLIHDT
NANT_YERPY      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERPE      -----AVLAAQAYS------YVVLAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERPA      -----AVLAAQAYS------YVVLAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
YKT8_SCHPO      WGLISNFSCPDDES----VCHRADNKGWRYFLFTGMTLLMFAARFLVSVYESPKF-YLAKGDDYKAVETI
STP3_ARATH      -----SANVINYETQ-------NIKHGWRISLATAAIPASILTLGSLFLPETPNSIIQTTGDVHK-----
XYLT_LACBR      SGFYTG---------------------WRWMLGFAAIPAALLFLGGLILPESPRF-------LVKSGHLD
QAY_NEUTR       YGVNTTMAPTRSQ--------------WLIPFAVQLIPAGLLFLGSFWIPESPRWLFNGKREEMRNLEPT
GTR2_RAT        -----ALVTGILISQIAGLSFILGNQYWHILLGLSAVPAXXXXXXXXFCPESPRYLYLNLEEEVRAKKSL
YIR0_YEAST      ---------------------------WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKD-----EEA
STP13_ARATH     -----------------GTAKIKGGWGWRLSLGLAGIPXXXXXXXXXXXXETPNSL------VERGRLDE
QAY_NEUAF       YGVNTTMAPTRSQ--------------WLIPFAVQLIPAGLLFLGSFWIPESPRWLFANGRREIRNLEPT
NANT_YERPS      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERPP      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERPG      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERPB      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
NANT_YERP3      -----AVLAAQAYS------YVVPAFGWRMLFYIGLLPIIFALWLRKNLPE-------------------
BENK_ACIAD      ----------------------------------------------------------------------
SVOP_MOUSE      --FEVLLAVF-----------VMPSLGWRWXXXXXXXXXXXXXXXCFWLPESARY------DVLSGNQEK
S22A6_PIG       ----------------AGVAYAV--PRWRHLQMLVSVPXXXXXXXXXXXIESARYSSSGRLDLTLKALQR
ERDL5_ARATH     -GFT----TVHQLLICLGVSVTYLLGSWRILALIGMIPCVVQMMGLFVIPESPRWLFEIALQRLRGESAD
S22A7_MOUSE     --------TFWXXXXXXXXXXXYLIRSWRWLLTLPCVPGIISIWW---VPESARWLLTQGR-----VEEA
INT1_ARATH      ---------------------------WRWMLGVSGVPAVIQFILMLFMPESPRWLFMKNRKAEAIQVLA
HXT5_YEAST      LGYCTNFGTKNYSNSV----------QWRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGK--IEEAKRS
HUP3_CHLKE      ------------------------DNGWRLSLGLAAVPGLILLLGAIVLPESPNFL------VEKGRTDQ
S22AD_HUMAN     -GFRN----------------------WRLLQITGTAPGLLLFFYFWALPESARWL------LTRGRMDE
S22A6_BOVIN     ----------------------------------------------------------------------
GHT7_SCHPO      ---------------------------WRISIGINLLWGIITLVGIIFLPESPRYLIAI------GKDDE
YFIG_BACSU      --FNAIIGSTMGESA----------NVWRYMLVIATLPAVVLWFGMLIVPESPRWL------AAKGRMGD
STP1_ARATH      IGFQLSITIGILVAEVLNYAKIKGGWGWRLSLGGAVVPALIITIGSLVLPDTPNSMIE------RGQHEE
STP11_ARATH     ------ILAANIVNYVTPKLQNGIG--WRLSLGLAGVPAVMMLVGCFFLPDTPNSILE------RGNKEK
PLST3_ARATH     -------------SLFAGIPAKDNLGWWRICFWISTVPAAMLAVFMELCVESPQWLF--KRGRAAEAEAV
S22A6_MACFA     ----------------AGVAYAVPH--WRHLQLLISVPXXXXXXXXXXXIESARWHSSSGRDLTLRALQR
S22A4_PAPAN     FAY--------------------FIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRDIIQKA--A
S22A2_HUMAN     XXXXXXXXXPH----------------WRWLQFTVALPNFFFLLYYWCIPESPRWLISQN----KNAEAM
GHT5_SCHPO      -GFQSEVAPADLRGTIVTTYQLAVTAQWRVSMGINLLWGIITFIGISFLPESPRYLISVGRD------EE
OCTL_DROME      VGFMLTAVFAYFVHD------------WRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQ
S22A1_BOVIN     -AFTVGLVLL------SGLAYILPH--WRWLQLAVSLPIFLLLFRFWFVPESPRWLLSQKRNTE--AIKI
GHT1_SCHPO      ---------------------------WRVSIGINLLWGIITLVGVSFLSESPRYLVSIGKD-----DEA
S22A1_MOUSE     ---------------------------WRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKR--TTQAVRI
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      ---------------------------WRVSLGLAAVPAVIMVIGSFVLPDTPNSMLE------RGKYEQ
S22A5_HUMAN     ---------------------------WRMLLVALTMPGCVALWW--FIPESPRWLFEEAEVIIRKAAKA
GTR2_BOVIN      -------------------------ELWHILLGLSAVPAILQCLLLFFCPESPRYLY------IKLDEEA
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SV2A_PONAB      PHYGWSFQMGSAYQFHS----------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
S22AF_HUMAN     -------------------------RSWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGR--LSEAEEA
S22A2_RABIT     -------QXXXXXXXXXXXXXXXXXPRWRWLQLTVTLPYFCFLLYYWCIPESPRWLIS-QNKNAKAMRIM
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SV2A_MACFA      PHYGWSFQMGSAYQFHS----------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
SV2A_HUMAN      PHYGWSFQMGSAYQFHS----------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
STP10_ARATH     ---------------------------WRVSLGLAAVPAVVMVIGSFILPDTPNSMLE------RGKNEE
GTR5_RAT        FGLRSVLASEEG---------------WPILLGLTGVPAGLQLLLLPFFPESPRYLL-IQKKNESAAEKA
S22AF_MOUSE     -------------------------RSWRTLAVLVNLQGTLVFLLSLFIPESPRWLYSQGR--LSEAEEA
S22A6_PONAB     ----------------------------------------------------------------------
KGTP_SHIFL      ----------------------------------------------------------------------
KGTP_ECOLI      ----------------------------------------------------------------------
SV2A_RAT        ---------------------------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
SV2A_MOUSE      ---------------------------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
IOLT_BACSU      --FNAILGTTMGDNS----------HVWRFMLVIASLPALFLFFGMIRMPESPRWL------VSKGRKED
S226A_XENLA     ---------------------------WRWLQLCVSLPFFIFFLYSWWFPESARWLV-LSGKTERAVKEM
INT2_ARATH      ---------------------------WRWMLGIAGIPALLQFVLMFTLPESPRWLYR------KGREEE
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL18_ARATH     ---------------------------WRILALLGALPCFIQVIGLFFVPESPRWLAKVGSD--KELENS
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      PHYGWSFQMGSAYQFHS----------WRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHVLKQVHDT
SHIA_ECOLI      ----------------------------------------------------------------------
PLST4_ARATH     ---------------------------WRTMFGVAVIPSVLLAIGMAFSPESPRWL--VQQGKVSEAEKA
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      -------------------------------------------------------------------EPP
S22A1_HUMAN     TGLAYALPH------------------WRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNT--EAIKI
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      ---------------------------WRYSLGGAAVPALILLIGSFFIHETPASLIE------RGKDEK
S22A1_RAT       ---------------------------WRWLQLAVSLPTFLFLLYYWFVPESPRWLLS-QKRTTRAVRIM
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAYMLGKPEGSPDELQRIATLEQSQSQLQVPKASWSDFWTHYKQWKHGKVLLGTAGSWFFLDVAFYGLGL
PHO84_YEAST     XXDGEKKIHDTSDEDMAINGLERASTAVEPPKASFKDFCRHFGQWKYGKILLGTAGSWFTLDVAFYGLSL
PHT17_ORYSJ     SKV-----------LQVKITAEQAEMASPVDKPFTSGLFSGEFARRHGFHLLGTTSTWLLLDIAYYSQNL
PHT13_ARATH     SKVL----------QTXXXXXXXXXXXXXXPKKNYGLFSKEFLR-RHGLHLLGTTSTWFLLDIAFYSQNL
PHT17_ARATH     SKVLQ-------------VEIEAEQQGTEDKSNSFGLFSKEFMK-RHGLHLLGTTSTWFLLDIAFYSQNL
PHT15_ORYSJ     XRVLNVE---LVDEQEKXXXXXXXXXXXXXXRREQYGLFSREFARRHGHHLLGTTVCWFVLDIAYYSQNL
PHT12_ORYSJ     SKVLHAEIEERP---------EVVESQV-VAGETWGLFSRQFMK-RHGMHLLATTSTWFLLDIAFYSQNL
PHT11_ORYSJ     SKVLHTQIEESADRAETVA----------VGGESWGLFSRQFLR-RHGLHLLATTSTWFLLDIAFYSQNL
PHT11_ARATH     ----MSKVLQTDIELE-----ERVEDDVKDPKQNYGLFSKEFLR-RHGLHLLGTTSTWFLLDIAFYSQNL
PHT12_ARATH     ----MSKVLQTDIELE-----ERVEDDVKDPRQNYGLFSKEFLR-RHGLHLLGTTSTWFLLDIAFYSQNL
PHT18_ORYSJ     SKVLQVEIQEEQDKLEQMVTRNSS---------SFGLFSRQFAR-RHGLHLVGTATTWFLLDIAFYSQNL
PHT16_ARATH     TKVLNVDIEAS----------AAKNDQARVSSDEFGLFSMKFLR-RHGLHLLGTASTWFLLDIAFYSQNL
PHT14_ORYSJ     ------------TQVLNVEIVEEQEKADEVARREQFGLFSRQFLRRHGRHLLGTTVCWFVLDIAFYSSNL
PHT14_ORYSI     ------------TQVLNVEIVEEQEKADEVARREQFGLFSRQFLRRHGRHLLGTTVCWFVLDIAFYSSNL
PHT13_ORYSJ     SKVL-------DTEIQXXXXXXXXXXXXXXXN-EWGLFSRQFVR-RHGVHLVATTSTWFLLDIAFYSQNL
PT112_ORYSJ     AKVLQVEIEVEEEKLQDITR-----------GRDYGLFSARFAK-RHGAHLLGTAATWFLVDVAYYSQNL
PHT15_ARATH     SKVL---------QVDLIAEEEAQXXXXXXXXXFTFGLFTREFARRXXXXXXXXXXXWFLLDIAYYSSNL
PHT14_ARATH     SKVLQVEIEPEQQKLEEISK-EKSKAFGLFSKEFMS---------RHGLHLLGTTSTWFLLDIAFYSQNL
PHT19_ARATH     QRVM------SVSMISQITEDXXXXXXXXXXXXXYKLFSRRFLS-LHGRDLFAASANWFLVDVVFY----
YHD1_SCHPO      K----GHPESSENYLSRSNTVENEPENIEKQPANRSGFIQYFRQWHHFKHLLGTSVCWFLLDIAFYGVNL
PT111_ORYSJ     -AIIDGNAKQAANDMQKVLSIEIEAEQEKLAKFNAANNYPLLSMRRHGLHLIGTTTTWFLLDIAFYSQNL
YBN1_SCHPO      KAFFNTDDEGDSEVVEEVDNIEKQFAAVTTPENS-SGFITYFRQWRHFKHLLGTSVCWFLLDIAFYGVNL
PHT16_ORYSJ     SKVL------QVVEMRNIGNNGGSRR----PFGLFSGEFVR----RHGLHLVGTSATWLLLDIAFYSQNL
PT113_ORYSJ     SAVLNVNITPDDEVINELARQDE------------YGLFSFEFXXXXXXXXXXTTVCWFVLDVTFYSLNI
PHT18_ARATH     QRVM------SRSHISDEATTDXXXXXXXXSYKLFSRCFFRL----HGRDLFAASFNWFLVDIVFYTSNL
YAEC_SCHPO      DTYIADDDEPKKDEEKQINLTTSSDSHSTVPTSNTSGFIEYFSQWHHFKHLLATAVSWFLLDIAFYGVNL
YCX2_SCHPO      ELHDFKKKESLTAEFTTSSPSTASLSDKKNPGSTGSSFVSYFKEWRHAKLLIGSALSWFLLDIAFYGINL
PT110_ORYSJ     GRVLADLDLGXXXXXXXXXXXXXXXXXXXXXXXXXXXRFVR----QHGRDLFACAAAWFLLDIPYYSSTL
PHT19_ORYSJ     ----IGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGLFQHGRDLFACAAAWFLLDIPYYSSTL
YAAU_ECOLI      MIKLFGEPVAFDEE--------------QPQQTRFRDLFNR----RHFPFVLFVAAIWTCQVIPMFAIYT
GIT1_YEAST      ---------------------EKGRIKRNIPYFLALKFY-----WKR---LLGTCGTWFMYDFVTFPNGI
YHM9_SCHPO      KTYV--------------------KHKVPLTKIPWLLVLKMY-----GFRLFILCLIWFVYDLSAFAFGL
GALP_ECOLI      ERVLLRLRDTSAEAKRELDEIRES---LQVKQSGWALFKSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPK
GALP_ECOL6      ERVLLRLRDTSAEAKRELDEIRES---LQVKQSGWALFKSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPK
ITR2_SCHPO      KVYKILSPEAKPAEIAYKVSLIQEGVKVDFPEGNKFQHFFHSL-----KVLFTVPSNRRSLFIGCFLQWF
SVOPL_MOUSE     -----GNTQAALNTLESIAKMNRSEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVIL
ARAE_BACSU      EALILTRINGETVAKEELKNIENSLKIEQMGSLSQL-----FKPGLRKALVIGILLALF-----------
SVOPL_HUMAN     -----GNTRAALATLERVAKMNRSEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVIL
YYAJ_BACSU      QVEKEKGPLPAASQPKVSETVKQNAGYAGLLKG------------RNLKITIVLSAVWIFETFGFYGFAS
PROP_ECOLI      -----GDREGLQDG----------------PKVSFKEIATKY--WRS---LLTCIGLVIATNVTYYML--
PROP_ECO57      -----GDREGLQDG----------------PKVSFKEIATKY--WRS---LLTCIGLVIATNVTYYML--
YWTG_BACSU      AKKILEKLRGTKDIDQEIHDIKEAEKQDEGGLKELFDPWVR-------PALIAGLGLAFLQQF----IGT
EDL14_ARATH     LLSLRGAKSDVSDEAATILEYTKHVEQQDI-----------------------DSRGFFKLFQRKYALPL
SV2B_HUMAN      NMRAKGTPE-KVFTVSNIKTPKQMDEEIQSSTGTWYQRWTIFKQWDNGPYRMNTAVVWFAMAFSYYGL--
YOU1_CAEEL      -----GHPERALETLQAAARMNRVQSSTKAGSESRGDIANLLSDLRKTTILLWCI--WAITAFSYYGMVL
PLT5_ARATH      AKRVLDKTSDSPTE--ATLRLEDIKHAAGIPADCHDDVVQVSRRNSHGRVMIAAIGIHFFQQAS----GI
HXT2_YEAST      KRSLAKSNKVTIEDPSIVAEMDTIMANVETERASWGELFSN-KGAILPRVIMGTGNNYFF----YYGTTI
HGT1_KLULA      SLIVANVANGDVNNEQVRFQLEEIKEQVIIDSAAKNGYKDLFRKKTLPKTIVGVSAQMWGMNVMMYYI--
SVOP_PONAB      AIATLKRENGAPMPLGKLIISRQED------RGKMRDLFTPHFRWT--TLLLWFI--WFSNAFSYYGLVL
SVOP_HUMAN      AIATLKRENGAPMPLGKLIISRQED------RGKMRDLFTPHFRWT--TLLLWFI--WFSNAFSYYGLVL
HXT16_YEAST     CVSIAKIDKVSPEDPWVLKQADEINAQRELGEASWKELFS-VKTKVLQRLITGTGENYFF----FYG---
ARAE_KLEOX      LRMLRDTSEKARDELNEI------RESLKLKQGGWALFKVNRNVRR--AVFLG-----MLLQAMQQFTGM
HXT15_YEAST     CVSIAKINKVSPEDPWVLKQADEINAQRELGEASWKELFS-VKTKVLQRLITGTGENYFF----FYG---
GHT3_SCHPO      LRIMCNMAELSPESEIIQTNFNTIKSDIEIEMAGGKARWIEFGKDIRYRTCLG------FLVMLFRELIG
HXT13_YEAST     RASIAKINKVSPEDPWVLKQADEINAQRELGEASWKELFS-VKTKVLQRLITGTGENYFF----FYG---
GHT6_SCHPO      CMKILTRNAGLPADMQKEYNAIQAEAELAGGPCSWPQIFSNEIRY---RTLLGTGNNYFFYTQVFRGTGL
HXT17_YEAST     RASIAKINKVSPEDPWVLKQADEINAQRELGEASWKELFS-VKTKVLQRLITGTGENYFF----FYG---
CSBC_BACSU      ARRIMNITHDPKDIEMELAEMKQGEAELGVLKA----------KWIRPMLLIGVG-----LAIFQQAVGI
YCEI_BACSU      SA--------------------KKRSMWENVKSVWA------RQYIRPTVMLSIV--WFCVVFSYYGMFL
ITR1_YEAST      KSYTDTSEEIIERKVEELVTLNQSIPGKNVPEKVWNTIKELHTVPSNLRALIIGCG----LQAIQQFTGW
ERDL7_ARATH     K--LRGKKADISEEAAEIQDYIETLERL--PKAKMLDLF----QRRYIRSVLIAFGLMVFQQFGINGICF
PLT6_ARATH      LELVSNSPEEAELRFQDIKAAAGIDPKCVDDVVKMEGKKTHGEGWKERRVLLTALGIHFFQHASIEAVLL
HXT9_YEAST      KRSLSKSNKVSVDDPALLAEYDTIKAGIELEKASWSELLS-TKTKVFQRVLMGTGDNYFF----YYGTTI
ITR2_YEAST      RSYVNTEDEIIDQKVEELSSLNQS-----IPKNPITKFWNMVKE-------LHTVPSNFRALIIGCGLAI
HXT1_YEAST      LAKVNKCPPDHPYIQYELETIEASVEEMRAATASWGELFTG-KPAMFQRTMMGTGDNYFF----YYG---
QUTD_EMENI      LAWIRNLPADHIYMVEEINMIEQSLEQQRVKIGL--GFWKPFKAWTNKRILYRLLGSMLFLWQNGSGINA
HXT11_YEAST     KRSLSKSNKVSVDDPALLVEYDTIKAGIELEKASWSELLS-TKTKVFQRVLMGTGDNYFF----YYGTTI
GAL2_YEAST      KRSIAKSNKVSPEDPAVQAELDLIMAGIEAEKASWGEFSTKTKVFQ--RLLMGTGNNYFF----YYG---
EDL15_ARATH     EAVLL--------------SLRGEKSDVSDEAAEILEYTEHVKQQQD----IDDRG-FFKLFQRKYAFSL
PROP_SALTY      -----GDREGLQDG----------------PKVSFKEIAT-----KHWRSLLSCIGLVIATNVTYYML--
XYLL3_ARATH     QEYLRGRPPGDKISEKLVDDAYLSVKTAYEDEKSGGNFLEVF-QGPNLKALTIGGGLVLFQQITGQPSVL
S22A6_RAT       VARINGKQEGAKLSIEVLRTSLQKELTLSKGQASAMEL-LRCPTLRH--LFLCLSMLWFATSFAYYGL--
S22A6_MOUSE     VARINGKQEGAKLSIEVLQTSLQKELTLNKGQASAMEL---LRCPTLRRLFLCLSMLWFATSFAYYGL--
S22AD_MOUSE     AALVNGRPL-SPELLNQLVPEKTG------PSGNALDLFRHPHLRKVTLILIAV---WFVDSLVYYSLSF
HXT10_YEAST     LAKSNKVTVTDPGVVFEFDTIANMELERAVGNASWHELFSN-KGAILPRVIMGTGCNYFF----YYGTTI
ORCT_DROME      AFVIIEKAAKEPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLFDWFVNSGVYYGLSW
PCAK_ACIAD      ----------------------------------------------------------------------
PLST1_ARATH     KVVIRNIWGGSEVE----KAVEDFQSVMKNSGSNLNSRWLELLDKPHSRVAF-IGGSLFVLQAGINGVLY
MUCK_ACIAD      -------------QQSRLAPSKQTET------VKTSAFKLIFQDKRNRNMFILWALTAGFLQFGYYGV--
SVOP_RAT        AIATLKRENGAPMPLGKLIISRQED------RGKMRDLFTPHFRWT--TLLLWFI--WFSNAFSYYGLVL
GLCP_SYNY3      AAAILWKVEGG-DVPSRIEEIQATVSLDHKPR--FSDLLS-----RRGGLLLSALQQFVGINVIFY----
GHT4_SCHPO      LRIMCQTAELDPESIQTNFNTIKSDIEMEMAKARWPEVFGKEVRYRTVRELIGNNYYFYYATQVFKGTGM
GHT2_SCHPO      VRVLSESAELFPDSEEVQNEYHRLKSSIDEEFASWASIFGKDIRYRTGMFVMSTGNNYFF----YYGFSV
EDL16_ARATH     FRVALQKLRGKDADITNEADIQVSIQALEIPKARIQDLVSK----KYGRVIIGVSLMVFQQFVGINGIGF
ARAE_ECOLI      LRMLRDTSEKAREELNEI------RESLKLKQGGWALFKINRNVRR--AVFLG-----MLLQAMQQFTGM
ARAE_ECO57      LRMLRDTSEKAREELNEI------RESLKLKQGGWALFKINRNVRR--AVFLG-----MLLQAMQQFTGM
EDL10_ARATH     LHRLRGKDADVSDEAAEIQVMTKMLE--EDSKSSFCDMF----QKKYRRTLVVGIGLMLIQQLSG-----
SVOP_BOVIN      AIATLKRENGAPMPLGKLIISRQED------RGKMRDLFTPHFRWT--TLLLWFI--WFSNAFSYYGLVL
SV2C_HUMAN      NMRARGQPE-KVFTVNKIKTPKQIDELIEIE----SDTGTWYRRC-FVRIRTELYGIWLTFMRCFNYPVR
STP4_ARATH      LQSIRGTNE-VDEEFQDLIDASEESKQVKHP-------WKNIMLPRYRPQLIMTCFIPFFQQITFYA---
QAY_NEUCR       DRYIVQEVSFIDADLERYTR--------QVGNGFWKPFLSLKQRKVQWRFFLG--GMLFFWQ---NGSGI
HEX6_RICCO      AKLMLQRVRGTTDELDDLIKASIISRTIQHP-------FKNIMRRKYRPQLVMAVAIPFFQQVAFYA---
ERDL8_ARATH     FEIALQKLRGPQANITREAIQEYLASLAHLPKATLMDLIDK----KNIRFVIVGVGLMFFQQF----VGI
S22A6_RABIT     VARINGKQEGAKLSMEVLRTNLQKELTMSKGQASAMEL-LRCPALRH--LFLCLSLLWFATSFAYYGL--
GTR3_CANFA      LQRLWGTQDVSQDEMKDESARMAQEKQVTVLELFRS---RSYRQPXXXXXXXXXXXXXXXXNAVFY----
YDJE_ECOLI      LREVEQQIEREKSIRLPPLTSYQSNSKVKVIKGT---FWLLFKGEMLRRTLVAIT-VLIAMNISLYTI--
HXT3_YEAST      RASLSKVNKVAPDHQQELEVIEASVEEARAASASWGELFTMFKRTMMGIMIQSTGDNYFF----YYGTTV
EDL11_ARATH     LHRLRGKDSGEAAEIQVMTKMLEEDS-----KSSFSDMF----QKKYRRTLVVGIGLMLIQQLSG-----
S22A7_RAT       KKYLLGRPVGSQEALNNVVTMERA---LQRP--SYLDLF-RTSQLRH--ISLCCMMVWFGVNFSYYGLTL
S22A1_RABIT     IAQKNGKL--PPADLKMLSLDEDVTEKL---SPSLADLFRTPNLRKHTFILMFL---WFTCSVLYQGLIL
STP7_ARATH      GRRVLVKLRGTENELQDMVDASELANSIKHP------FRNILQKRHRPQLVMAICMPMFQILTGINSILF
GTR2_MOUSE      K-----RLRGTEDVTKDINEMKKEKEEASTQKVSVIQLFTNYRQPILVALMLHMAQQFSGINGIFY---Y
SV2C_RAT        NMRARGQPE-KVFTVNKIKTPKQIDELIEIE----SDTGTWYRR---------------FIDSEFQNCSF
S22A6_HUMAN     VARINGKEEGAKLSMEVLRASLQKELTMGKGQASAMEL-LRCPTLRH--LFLCLSMLWFATSFAYYGL--
INT3_ARATH      KA-------ESRDILERIYPAEMVEAEIAALKESGHTFSDKLRGALSNPVVRHGLAAGITVQVAQQFVGI
YNCC_BACSU      K-----RAEAECREIQ-----EAVEKDTALEKASLKDFSTPWLR----RLL------WIGIGVAI----V
XYLE_ECOLI      AEGILRKIMGNTLATQAVQEIKHSLD--------------------HGRK---TGGRLLMFXXXXXXXXX
XYLE_ECO57      AEGILRKIMGNTLATQAVQEIKHSLD--------------------HGRK---TGGRLLMFXXXXXXXXX
SV2C_MOUSE      NMRARGQPE-KVFTVNKIKTPKQIDELIEIE----SDTGTWYRR---------------FIDSEFQNCSF
NANT_YERPY      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
YKT8_SCHPO      HARINGKTTLTVEELYAIDRQEQEETNLIVEKLRKYNF-EHIRQC-FGSRKLAISSILVILSWAVIGLAL
STP3_ARATH      TELMLRRVRGTNDVQDELTDLVEASSGSDTD----SNAFLKLLQRKYRPELVMALVIPFFQQVAFYA---
XYLT_LACBR      EARHVLDTMNKHDQVAVNKEINDIQESAKIVSGGWSELF--------GKMVRPSLIIGIGLAIFQQVMGC
QAY_NEUTR       DRYIVEEVSYIDADLERYAR--------EVGKGFWKPFLSLKQRKVQWRFFLG--GMLFLWQ---NGSGI
GTR2_RAT        K-----RLRGTEDITKDINEMRKEKEEASTQKVSVIQLFTNYRQPIVVALMLHLAQQFSGINGIFY---Y
YIR0_YEAST      KHSLSKSNKVSVDDPALLAEYDTIKAGIEIEKASWSELLS-TKTKVFQRVLMGTGDNYFF----YYGTTI
STP13_ARATH     GKAVLRRIRGTDNVEPEFADLLEAS---RLAKEVKHPFXXXXXXXXXXXXVIAVALQIFQQCTGINAIMF
QAY_NEUAF       DRYIVEEISYIDADLQRYAR--------EVGKGFWKPFLSLKQPKVRWRFFLG--GMLFLWQ---NGSGI
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
SVOP_MOUSE      AIATLKRENGAPMPLGKLIISRQED------RGKMRDLFTPHFRWT--TLLLWFI--WFSNAFSYYGLVL
S22A6_PIG       VAWINGKRE------------EGASLSMEVLRASLNKELTMDKGQASAMELLXXXXXWFATSFAYYGL--
ERDL5_ARATH     ISYESNEIK---DYTRRLTDLSEG-SIVDLFQPQYAKSXXXXXXXXXXXXXXXXNGIAFYASSIFESAGV
S22A7_MOUSE     KKYLSGRPISSQEALNKVITMERVSQ-----RPSYLDLF-RTSQLRH--VSLCCMMMWFGVNFSYYGLTL
INT1_ARATH      RTYDISRLE---DEIDHLSAAEEEEKQRKRTVGYLDVFRSELRXXXXXXXXXXXXXXXXXINTVMY----
HXT5_YEAST      LARANKTTEDSP-----LVTLEMENYQSSIESASWGELVTG-KPQMFRRTLMGTGDNYFF----YYG---
HUP3_CHLKE      GRRILEKLRGTSHEIARPITMRQSWRSLYMPQLLTSFVIQFFQQFTGINAIIFYVPVLFXXXXXXXXXXX
S22AD_HUMAN     AIQLIQKAASVNRRKLSPELMNQLVPEKTGPSGNALDLFRHPQL---RKVTLIIFCVWFVDSLGYYGLSL
S22A6_BOVIN     ---------------------------------------------------------WFATSFAYYGL--
GHT7_SCHPO      ALKIMCYNNDLPLEHEIIQTKSDCDAELAGGPARWPEIFNRYRTFLGMAVMMFTGANYYFYTQVFRGTGM
YFIG_BACSU      ALRVLRQ------------IREDSQAQQEI------------KEIKH--AIEGTAKKAGFHDILFIGIGI
STP1_ARATH      AKTKLRRIRGVDDVSQEFDDLVAASKESQ----SIEHPWRNLLRRKYRPHLTMAVMIPFFQQLT----GI
STP11_ARATH     AKEMLQKIRGTMEEFNELCNACEAAKKVKHP-------WTNIMQARYRPQLTFCTFIPFFQQLT----GI
PLST3_ARATH     FEKLLG----------------GSYVKAAMAELVKSDRGDDADSAKLSELLFGRSFRVVFIGSTLFALQQ
S22A6_MACFA     VARINGKEEGAKLSMEVLRASLQKELTMGKGQASAMEL-LRCPTLRH--LFLCLSMLWFATSFAYYGL--
S22A4_PAPAN     KMNNIAVPAVIFDSVEELNPLKQQ-------KAFILDL---FRTWNIAIMTIMSLLLWMLTSVGYFALSL
S22A2_HUMAN     RIIKIAKKNGKPASLQRLRLEEETGKKL---NPSFLDLVRTPQIRKHTMILM---YNWFTSSVLYQGL--
GHT5_SCHPO      ALQIMAKNNDLPIEHEVIQTKSDCEAELAGGPATWPEIFIRYRTFLGLGVLTGDNXXXXXXXXXXXXTGM
OCTL_DROME      KAARFNKVEISDEALSELQKLEDQELDEGPPPSVWDLFC--YPNLRRKTLLIFL--DWLVTSGVYYGLSW
S22A1_BOVIN     MDHIAQKNGKLPPADLKMLSLEEDVTEKLSP--SFIDLFRTPNLRKYTFILMYL---WFTSSVVYQGLIM
GHT1_SCHPO      IQVMCKNAELPPDSDIIQTEYKQIKSDCEAAPCTWPEIFIRYRTFLGMAILTGCNYYFYYGTQVFKGTGM
S22A1_MOUSE     MEQIAQKNRKVPPADLKMMCLEEDASERRSP--SFADLFRTPSLRKHTLILMYL---WFSCAVLYQGL--
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      AREMLQKIRGADEEFQDLCDACEAAKKVDNP---WKNI---FQQAKYRPALVFCSAIPFFQQIT----GI
S22A5_HUMAN     NGIVVPSTIFDPSELQDLSSKKQQSHNIL----------DLLRTWNIRMVTIMSIMLWMTISVGYFGLSL
GTR2_BOVIN      KAKSLKRLRGSDDITKDITEMRKEREEANEKKVSIIQLFTNYRQPILVALMLHAAQQFSGINGIFY---Y
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SV2A_PONAB      NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGTWYQRWEYRRITLMMMGVWFTMSFSYYGL--
S22AF_HUMAN     -LYLIAKRN---RKLKCTFSLTHPANRSCRETGSFLDLFRYRVLLGHTLILMFI---WFVCSLVYYGLTL
S22A2_RABIT     EHIAKKNGKSLPVSLQSLRAAEDVGEKL---NPSFLDLVRTPQIRKHTCILM---YNWFTSSVLYQGL--
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SV2A_MACFA      NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGTWYQRWEYRRITLMMMGVWFTMSFSYYGL--
SV2A_HUMAN      NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGTWYQRWEYRRITLMMMGVWFTMSFSYYGL--
STP10_ARATH     AKQMLKKIRGADNEFQDLIDAVEAAKKVENP-------WKNIMESKYRPALIFCSAIPFFQQIT----GI
GTR5_RAT        LQTLRGDVDMEMEEIRKEDEAEKAAGFISV----WKLFRMQSLRWQAGQQLSGVNAIYYYADQIYLSAGV
S22AF_MOUSE     -LYFIAKRNR---KLKCTFSLTHPANRSYRATGSFLDLFRYRILLGHTLILMFI---WFVCSLVYYGLTL
S22A6_PONAB     ---------------------------------------------------------WFATSFAYYGL--
KGTP_SHIFL      ----------------------------------------------------------------------
KGTP_ECOLI      ----------------------------------------------------------------------
SV2A_RAT        NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGTWYQRWEYRRITLMMMGVWFTMSFSYYGL--
SV2A_MOUSE      NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGTWYQRWEYRRITLMMMGVWFTMSFSYYGL--
IOLT_BACSU      ALRVLKKEKRAAAELQEIEFAFKKEDQLE--KATFKDLSV---PWVRRIVFIG------------LGIAI
S226A_XENLA     KK--VAKLNGKEEEGEKI-TLESMRSDMIKELACAKSSYTVIDLIRTSRISCALSLVWFSTSFAYYGLAM
INT2_ARATH      AKAILRRIYSAEDVEQEIRALKDS-VETEILEEGSSEKINMIKLCKAKTVRRGIAGVGLQVFQQFVGINY
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL18_ARATH     LLRLRG---GNADISREASDIEVMTKMVEDSKSSFCDLF----QRKYRYTLV--VGIGLMLIQQFSG---
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      NMRAKGHPE-RVFSVTHIKTIHQEDELIEIQ----SDTGAWYQRWEYRRITLMMMGVWFTMSFSYYGL--
SHIA_ECOLI      ----------------------------------------------------------------------
PLST4_ARATH     IKTLYGKER----VVELVRDLSASGQGSSEPEAGWFDLFSS----RYWKVVSVGAALFLFQQLA----GI
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      MAKLLSDPDFQGKQFPTVEAPELFIFELAPDSPSIALNWTFWRKMKTTSIY-----AYASLTIAW-----
S22A1_HUMAN     MDHIAQKNGKLPPADLKMLSLEEDVTEKLSP--SFADLFRTPRLRKRTFILMYL---WFTDSVLYQGLIL
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      GKQVLRKIRGIEDIELEFNEIKYATEVATKVKSPFKELFT--KSENRPPLVCGTLLQFFQQFTGINVVMF
S22A1_RAT       EQIAQKNGKVPPADLKMLC-LEEDASEKRSP--SFADLFRTPNLRKHTVILMYL---WFSCAVLYQGL--
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NNSIILSAIGYTGGKDMYEIMYNTAVGNLILICAGAIPGYWVTVATVDTLGRKPIQIMGFTMLTVLFIVI
PHO84_YEAST     NSAVILQTIGYAGSKNVYKKLYDTAVGNLILICAGSLPGYWVSVFTVDIIGRKPIQLAGFIILTALFCVI
PHT17_ORYSJ     FQKDIFSAIGWPEAKTMSALLYHIARAQTLIALCGTVPGYWFTVALIDVVGRFKIQAAGFFVMTAFMLAL
PHT13_ARATH     FQKDIFSAIGWATMNAIHEVFKIARAQTLIALCS-TVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAI
PHT17_ARATH     FQKDIFSAIGWIPPAQIQEVFKIARAQTLIALCS-TVPGYWFTVAFIDVIGRFAIQXXXXXXXXXXXXAL
PHT15_ORYSJ     FQKDIYTAVQWLPKADALEEMFKISRAQTLVALCGTIPGYWFTVLFIDIVGRFAIQLGGFFLMTAFMLGL
PHT12_ORYSJ     FQKDIFSKVGWAKTMNALEELYRISRAQALIALCGTIPGYWFTVAFIDIVGRFWIQIMGFFMMTVFMLAL
PHT11_ORYSJ     FQKDIFSKVGWAKTMNALEELYRIARAQALIALCGTIPGYWFTVAFIEIMGRFWIQIMGFAMMTAFMLGL
PHT11_ARATH     FQKDIFSAIGWATMNATHEVFRIARAQTLIALCS-TVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAI
PHT12_ARATH     FQKDIFSAIGWATMNATHEVFRIARAQTLIALCS-TVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAI
PHT18_ORYSJ     FQKDIFTSINWPKAKTMLEEVFRIARAQTLIALCGTVPGYWFTVFLIDIVGRFAIQLLGFFMMTVFMLGL
PHT16_ARATH     FQKDIFTTIGWPSAKTMNAILYMIAKAQTIIACCSTVPGYFFTVGFIDYMGRKKIQIMGFAMMTIFMLSL
PHT14_ORYSJ     FQKDIYTAVQWLPKADALEEMFKISRAQTLVALCGTIPGYWFTVFFIDIIGRFVIQLGGFFFMTAFMLGL
PHT14_ORYSI     FQKDIYTAVQWLPKADALEEMFKISRAQTLVALCGTIPGYWFTVFFIDIIGRFVIQLGGFFFMTAFMLGL
PHT13_ORYSJ     FQKDIFSKVGWARTMNAVEEVFRIARAQALIALCGTIPGYWFTVAFIDVAGRFAIQLMGFAMMTVFMLGL
PT112_ORYSJ     FQKDIFTSIHWIPKSELEEVFRISRAQTLIALC-GTVPGYWFTVFLIDIIGRFKIQLLGFAGMTAFMLGL
PHT15_ARATH     FQKDIYTAIGWIPAAEIHEVFTVSKAQTLIALC-GTVPGYWFTVAFIDILGRFFIQLMGFIFMTIFMFAL
PHT14_ARATH     FQKDIFSAIGWAQSMNAIQEVFKIARAQTLIALCSTVPGYWFTVAFIDVIGRFAIQXXXXXXXXXXXXAL
PHT19_ARATH     TSNLLLSQIFNFSNKNVYDSAFEVAKLAAIVAACSTIPGYWFTVYFIDKIGRVKIQMMGFFLMAVVYLVA
YHD1_SCHPO      NQSVILKNIGFSSGTNEYRTLMKNAIGNLIIAVAGYVPGYWFNVFLVEILGRKWIQLQGFVITGLMFAIL
PT111_ORYSJ     TQKDIFPAMGLISGANALTEMFQISKASFLVALLGTFPGYWVTVALIDKMGRYMIQLIGFFMMSMFMLAM
YBN1_SCHPO      NQSVILKNIGFSTGTNEYRTLMKNAIGNLIIAVAGYVPGYWFNVFLVEILGRKWIQLQGFVITGLMFAIL
PHT16_ORYSJ     FQKDIFSAVGWAATMSALEELFRIARAQTLIALCGTVPGYWFTVALIDVVGRFKIQAVGXXXXXXXXXXX
PT113_ORYSJ     FMKNIFTEVGLLPRLDLQRMITMTAVHTFISLC-GALPGYFFTVAFVDRIGRVKIQLIGFTMMTVFMLCL
PHT18_ARATH     LLSHIFSHYSKSTAENVYDAAFEVAELGAIIAACSTIPGYWFTVYFIDKIGRVKIQIMGFFFMAVIYLVA
YAEC_SCHPO      NQSVILKAIGFSSGKNEYHTLMRXXXXXXXXXXXXYVPGYWFTVFLVEKLGRKWIQLQGLFITGLMFAIL
YCX2_SCHPO      NQSVILQEMGFNKGVNEYHILQKNAIGNLIIAVAGYIPGYWVSVVLIEVMGRKWIQIQGFLICCLLFGVL
PT110_ORYSJ     FQSQIYRPLFPAPGLNAFQEAFNVAKFQAVIAVASTIPGYFVAVLLIDRVGRRCLQXXXXXXXXXXXXXX
PHT19_ORYSJ     FQSQIYRPWFPPAAKNAFQEAFNVAKFQAVIAVASTIPGYFAAMLLIERAGRRRLQXXXXXXXXXXXXXX
YAAU_ECOLI      FGPQIVGLLGLGVGK-------NAALGNVVIFMLGCIP----PMLWLNTAGRRPLLIGSFAMMTLALAVL
GIT1_YEAST      FSSTIISSV-IKDQNDLVKVAEWNXXXXXXXXXXXPIGAY-----LSDRIGRKYTLMFGFSGYIIFGLII
YHM9_SCHPO      YSSTIVDGVLPADASTARSFGWN------VLINTFYLPGALLGGVFSDLLGPKYCLITGLVLQSIFFFMS
GALP_ECOLI      ----IFELAGYT---NTTEQMWGTVIVGLTNVLAT-----FIAIGLVDRWGRKPTLTLGFLVMAAGMGVL
GALP_ECOL6      ----IFELAGYT---NTTEQMWGTVIVGLTNVLAT-----FIAIGLVDRWGRKPTLTLGFLVMAAGMGVL
ITR2_SCHPO      QQFSGTNAIQYFSAIIFQSVGFKNSISVSIVVGATNFVFTIVAFMFIDRIGRRRILLCTSAVMIAGLALC
SVOPL_MOUSE     ASAELLERDLVCGSKEVVETTGDSGEGLSPCYCHIFAPSDYRTISTLGEIALNPLNILGINFLLSLSITM
ARAE_BACSU      NQVIGMNAITYYGPEIFKMMGFGQNAGFVTTCIVGVVEVIFTVIAVIDKVGRKKLMSIGSAFMAIFMILI
SVOPL_HUMAN     ASAELLERDLVCGSKSDSAVVVDSGESQSPCYCHMFAPSDYRTISTIGEIALNPLNILGINFLLSLSITM
YYAJ_BACSU      WVPSLLKSNGVTMENTLYNVLHSVGLGALLSMISERFQRKWILAASAFLTAIAGL-LYGMTFIPIMIIVF
PROP_ECOLI      --------LTYMPSYLSHNLHYSEDHGVLIIIAIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLFILI
PROP_ECO57      --------LTYMPSYLSHNLHYSEDHGVLIIIAIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLFILI
YWTG_BACSU      NTIIYYAPKTFTGFGNSASILGTVGIGTVNVLMT------LVAIKIIDKIGRKPLLLFGNAGMVISLIVL
EDL14_ARATH     TIGVVLISMPQLGGLNGYTIFTSTGVSSFILTSIVQMTGGVLGVLLVDISGRRSLLL--FSQAGMFLGCL
SV2B_HUMAN      ----------------------------------------------------------------------
YOU1_CAEEL      FTTVLFQSHDECHGMEVCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLL
PLT5_ARATH      DAVVLFSRIFKTAGTDHQQLLATVAV--------GVVKTSFILVATLDRIGRRPLLLTSVGGMVLSLAAL
HXT2_YEAST      FNAV--------GMKDSFQTSIVLGIVN--------FASTFVALYTVDKFGRRKCLLGGSASMAICFVIF
HGT1_KLULA      --VYIFNMAGYTGNTNLVSIQY---VLNVVM----TIPALFL----IDKFGRRPVLIIGIFMFTWLFSVA
SVOP_PONAB      LTTELFQACGISSRKKAVEAKCSLACEDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSLLFICV
SVOP_HUMAN      LTTELFQACGISSRKKAVEAKCSLACEDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSLLFICV
HXT16_YEAST     --TTIFKSVGLTDGFETSIVLGTVNFFSTI-----------IAVMVVDKIGRRKCLLFGAASMMACMVIF
ARAE_KLEOX      NIIMIFKMAGFTTTEQQ---MVATLVVGLTFMFA-----TFIAVFTVDKAGRKPALKIGFSVMAIGTLVL
HXT15_YEAST     --TTIFKSVGLTDGFETSIVLGTVNFFSTI-----------IAVMVVDKIGRRKCLLFGAASMMACMVIF
GHT3_SCHPO      NNYYFYYATQVFKGTGMTDIFLPAVI--LGAINFGTTFG---ALYTIDNLGRRNPLIFGAAFQSICFFIY
HXT13_YEAST     --TTIFKSVGLTDGFETSIVLGTVNFFSTI-----------IAVMVVDKIGRRKCLLFGAAGMMACMVIF
GHT6_SCHPO      NSPFLAALI-------LDAVNFGCTFGAIFVL---------------EYFGRRGPLIVGGVWQSICFFIY
HXT17_YEAST     --TTIFKSVGLTDGFETSIVLGTVNFFSTI-----------IAVMVVDKIGRRKCLLFGAAGMMACMVIF
CSBC_BACSU      NTVIYYAPTIFTGLGTSASALGTMGIGILVIMCITA-------MILIDRVGRKKLLIWGSVGITLLAALS
YCEI_BACSU      WLPSVMLLKGFSMIQSFEYVL---------LMTLAQLPGYFSAAWLIEKAGRKWI------LVVYLIGTA
ITR1_YEAST      N------SLMYFSGTIFETVGFKNSSAVSIIVSGTNFIFTLVAFFSIDKIGRRTILLIGLPGMTMALVVC
ERDL7_ARATH     YTSSIFEQAGFPTRLGM--IIY--AVLQVVITALNA--------PIVDRAGRKPLLLVSATGLVIGCLIA
PLT6_ARATH      YGPRIFKKAGITTKDKLF----------LVTIGVGIMKTTFIFTATLDKVGRRKLLLTSVGGMVIALTML
HXT9_YEAST      FKSV--------GLKDSFQTSIIIGVVNFF--------SSFIAVYTIERFGRRTCLLWGAASMLCCFAVF
ITR2_YEAST      QQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGMTVALVIC
HXT1_YEAST      --TIVFQAVGLS---DSFETSIVFGVVNFFSTCC--------SLYTVDRFGRRNCLMWGAVGMVCCYVVY
QUTD_EMENI      INYYVFKSIGVSGGNTS---LLTTGIFGVV---KAVITFVWL-LYLIDHFGRRNLLLVGAAGGSVCLWIV
HXT11_YEAST     FKSV--------GLKDSFQTSIIIGVVNFF--------SSFIAVYTIERFGRRTCLLWGAASMLCCFAVF
GAL2_YEAST      --TVIFKSVGL---DDSFETSIVIGVVNF----ASTFFSLW----TVENLGHRKCLLLGATMMAVIYASV
EDL15_ARATH     TIGVVLIALPQLGGLNGYSIFISTGVSSFISTSVVQMFGGILGTVLVDVSGRRTLLLVSQAFLGCLTTAI
PROP_SALTY      --------LTYMPSYLSHNLHYSEDHGVLIIIAIGMLFVQPVMGLLSDRFGRRPFVIMGSXXXXXXXXVI
XYLL3_ARATH     YYASILQTAGFSAAADATRVSVIIGVFKLLMT--------WVAVAKVDDLGRRPLLIGGVSGIALSLFLL
S22A6_RAT       ----VMDLQGF--GVSMYLIQ--------VIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVN
S22A6_MOUSE     ----VMDLQGF--GVSMYLIQ--------VIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLAGICILVN
S22AD_MOUSE     QVGDF--------GLDIYVTQ--------LIFGAVEMPGRFLSVLMMEKLGRKWSQLCTLTLAGXXXXXX
HXT10_YEAST     FNAV--------GMQDSFE--------TSIVLGAVNFASTFVALYIVDKFGRRKCLLWGSASMAICFVIF
ORCT_DROME      NTNNL-------GGNQLVNFMISGAV---------EIPGYTLLLFTLNRWGRRSIMVAGISLLATIFVPS
PCAK_ACIAD      ----------------------------------------------------------------------
PLST1_ARATH     FSSLTFQNVGITSGA---QASLYVGVTNF----AGALCASYL----IDKQGRKKLLIGSYLGMAVMFLIV
MUCK_ACIAD      NNSYLESELGMKF-KEMTAYMVGTYTA---MILGKILAGFMA-----DKLGRRFTYAFG-AIGTAIFLPL
SVOP_RAT        LTTELFQACSISSRKKAVEAKCSLACEDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFVIFSLLFICI
GLCP_SYNY3      YSSVLWRSVGFTEEKSLLITVITGFINILTTL---------VAIAFVDKFGRKPLLLMGSIGMTILSVVF
GHT4_SCHPO      TDIFLPAVI-------LGAINFGTTFGALY---------------TIDNLGRRNPLIFGAAFQSICFFIY
GHT2_SCHPO      MQGAGINS-PYLSAMILDAVNFGCTFGGMYVL---------------ERFGRRNPLIIGGIWQSICFFIY
EDL16_ARATH     YASETFVKAGFTSGK----------LGTIAIACV-QVPITVLGTILIDKSGRRPLIMISAGGIFLGCILT
ARAE_ECOLI      NIIMIFKMAGFTTTEQQ---MIATLVVGLTFMFAT-----FIAVFTVDKAGRKPALKIGFSVMALGTLVL
ARAE_ECO57      NIIMIFKMAGFTTTEQQ---MIATLVVGLTFMFAT-----FIAVFTVDKAGRKPALKIGFSVMALGTLVL
EDL10_ARATH     -----ASGITYYSNAIFRKAGFSERLGSMI-FGVFVIPKALVGLILVDRWGRRPLLLASAVGMSIGSLLI
SVOP_BOVIN      LTTELFQACSISSRKKAVEAKCSLACEDLLWTTLSEFPGVLVTLWIIDRLGRKK------TMAXXXXXXX
SV2C_HUMAN      DNTIKLTIVWFT----------------------------------------------------------
STP4_ARATH      --PVLFQTLGFGSKASLLSAM---VTGIIELLCT------FVSVFTVDRFGRRILFLQGGIQMLVSQIMI
QAY_NEUCR       NSPTVFRSIGITGTDTGF---LTTGIFGVVKMVLTIIWLLWL----VDLVGRRRILFIGAAGGSLCMWFI
HEX6_RICCO      --PILFRTIGLEESASLLSSIVTGLVGS---------ASTFISMLIVDKLGRRALFIFGGVQMFVAQIMV
ERDL8_ARATH     NGVIFYAQVSAGASPTLGSILYS--IEQVVLTALGA-------TLLIDRLGRRPLLMASAVGMLIGCLLI
S22A6_RABIT     ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVN
GTR3_CANFA      ------YSTGIFKDAGVEEPIYAT-------IGAGVVNTIFTVVSLVERAGRRTLHMIGLGGMAVCSILM
YDJE_ECOLI      --TVWIPTIFVNSGIDVDKSILMTAV-----IMIGAPVGIFIAALIIDHF---PRRLFGSTLL-IIIAVL
HXT3_YEAST      FNAV--------GMSDSFETSIVFGVVNFFSTCC--------SLYTVDRFGRRNCLLYGAIGMVCCYVVY
EDL11_ARATH     -----ASGITYYSNAIFRKAGFSERLGSMI-FGVFVIPKALVGLILVDRWGRRPLLLASAVGMSIGSLLI
S22A7_RAT       DVSGL--------GLNVYQTQ--------LLFGAVELPSKIMVYFLVRRLGRRLTEA---GMLLGAALTF
S22A1_RABIT     H-------MGATGGNVYLDFFYSSLV---------EFPAAFVILVTIDRVGRYPMAAAGVASVILIFVPQ
STP7_ARATH      YAPVLFQTMGFGGNAS----LYSSALTGAVLVLS-----TFISIGLVDRLGRRALLITGGIQMIICQVIV
GTR2_MOUSE      STSIFQTA-------GISQPVYATGVGAINMIFTA------VSVLLVEKAGRRTLFLTGMMFFCTIFMSV
SV2C_RAT        LHNKTGCQITFDDDYSAYWIYFVNFLGTLAVL-----PGNIVSALLMDRIGR--LTMLGGSMISCFFLWF
S22A6_HUMAN     ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVGFLVINSLGRRPAQMXXXXXXGICILLN
INT3_ARATH      NSPTILQFAGYASNKTAMALALITSGLNAV--------GSVVSMMFVDRYGRRKLMIISFGIITCLVIL-
YNCC_BACSU      NQITGVNSIMYYGTQILKESGFGTKIGNGLISVIAVIFGIWL----VGKVRRRPXXXXXXXXXXXXXXXF
XYLE_ECOLI      MLSIFQQFVGYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLATVDKFGRKPLQIIGALGMAIGMFSL
XYLE_ECO57      MLSIFQQFVGYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLATVDKFGRKPLQIIGALGMAIGMFSL
SV2C_MOUSE      LHNKTGCQITFDDDYSAYWIYFVNFLGTLAVL-----PGNIVSALLMDRIGR--LTMLGGSMISCFFLWF
NANT_YERPY      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
YKT8_SCHPO      YNAFLPYYL-ETRGNANEPLSVAKTYRNSLIVSAIGVPGSLIAGVLVERIGRK-----GTLCLSLILTGV
STP3_ARATH      --PVLYRTVGFGESGSLMSTLVTGIVGTSSTL---------LSMLVVDRIGRKTLFLIGGLQMLVSQVTI
XYLT_LACBR      NTVLYYAPTIFTGFGVSAALLAHIGIGIFNVIVTA------IAVAIMDKIDRKKIVNIGAVSLFVMSIGM
QAY_NEUTR       NSPTVFRSIGITGTNTGF---LTTGIFGVVKMVLTIVWLLWL----VDLVGRRRMLFIGATGGSLCMWFI
GTR2_RAT        STSIFQTA-------GISQPVYATGVGAINMIFTA------VSVLLVEKAGRRTLFLAGMMFFCAVFMSL
YIR0_YEAST      FKSV--------GLKDSFQTSIIIGVVNFF--------SSFIAVYTIERFGRRTCLLWGAASMLCCFAVF
STP13_ARATH     YAPVLFSTLGFGSDASLYSAVVTGAVNVLSTL---------VSIYSVDKVGRRVLLLMFFSQVVIAIILG
QAY_NEUAF       NSPTVFRSIGITGTNTGF---LTTGIFGVVKMVLTIIWLLWL----VDLVGRRRILFVGATGGSLCMWFI
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
SVOP_MOUSE      LTTELFQACSISSRKKAVEAKCSLACEDLLWTTLSEFPGVLVTLWVIDRLGRKK------TMAXXXXXXX
S22A6_PIG       ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVGFLVINTMGRRPAQMASLLLAGICILIN
ERDL5_ARATH     SSKI-----------------------GMIAMVVVQIPMTTLGVLLMDKSGRRPLLLISATGTCIGCFLV
S22A7_MOUSE     D----ASGLGLT--------VYQTQ----LLFGAVEVPSKITVFFLVRLVGRRLTEA---GMLLATALTF
INT1_ARATH      YSPTIVQMAGFHSNQ--------LALFLSLIVAAMNAAGTVVGIYFIDHCGRKKLALSSLVIISLLILSV
HXT5_YEAST      --TTIFQAVGL---EDSFETAIVLGVVNFV--------STFFSLYTVDRFGRRNCLLWGCVGMICCYVVY
HUP3_CHLKE      XNTVVVGAVNV--GSTMIAVLLSDKFGRRFLLIEGGITCCLAMLAAGITLGVEFGQ--------------
S22AD_HUMAN     QVGDF--------GLDVYLTQ--------LIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIII
S22A6_BOVIN     ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVSFLVINNVGRRPAQMASLLLAGICILIN
GHT7_SCHPO      DSPYLAALIPDA-------------------VNCGCTFG---AIFVLEFFGRRSPLIVGGIWQYICFFIY
YFIG_BACSU      QQITGVNSIMYYGTEILREAGFQTLIGNIVISVIAVIFGIWL----LGKVRRRPMLIIGGTMTALLLIIL
STP1_ARATH      NAPVLFNTIGFTTDASLMSAVVTGSVN---------VAATLVSIYGVDRWGRRFLFLEGGTQMLICQAVV
STP11_ARATH     NAPVLFKTIGFGNDASLISAVITGLVNVLSTI---------VSIYSVDKFGRRALFLQGGFQMIVTQIAV
PLST3_ARATH     LSGI--NAVFYFSSTVFKKAGVPSASAN---ICVGVLLGSTVAVVLMDKLGRKVLLIGSFAGMAVSLGLQ
S22A6_MACFA     ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVGFLVINSLGRRPAQMXXXXXXGICILLN
S22A4_PAPAN     DTPNL----------------HGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAGGVLLFIQLVPV
S22A2_HUMAN     -----IMHMGLAGDNIYLDFFYSALV---------EFPAAFMIILTIDRIGRRSNMVAGAACLASVFIPG
GHT5_SCHPO      NSPYLSALI-------LDAVNFGCTFGGLFVL---------------EFFGRRMPLIIGALWQSITFFIY
OCTL_DROME      NTSNL-------GGNVLL---------NFVISGAVEIPAYIFLLLTLNRWGRRSI-LCGCLVMAGLSLLA
S22A1_BOVIN     H-------VGATGGNLYLDFLYSALV---------EFPAGFIILVTIDRFGRRPLATSNLAAGLACFLMI
GHT1_SCHPO      ESPYLASLI-------LDAVNFGCTFGGLFVL---------------EYCGRRVPLIIGGVWQSICFFIY
S22A1_MOUSE     -----IMHVGATGANLYLDFFYSSLV---------EFPAAFIILVTIDRIGRYPIAVAGAACLLMIFIPH
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      NAPVLFKTLGFADDASLISAVITGAVNVVSTL---------VSIYAVDRYGRRILFLEGGIQMIVSQIVV
S22A5_HUMAN     DTPNL----------------HGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRR------YSMATALFL--
GTR2_BOVIN      STSIFQTA-------GISQPVYAT-------IGVGAVNTVFVSVFLVEKAGRRSLFLIGMSGMFVIFMSV
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       --------------------LYSSAVTGAVL-CSST----FISIATVDRLGRRFLLISGITCQVIVAIIL
GHT8_SCHPO      ----------------------------------------------LEFFGRRMPLIIGGVWQSITFFIY
SV2A_PONAB      ----------------------------------------------------------------------
S22AF_HUMAN     -------SAGDLGG----SIYANLALSGLI-----EIPSYPLCIYLINQFGRKRLCLGGLACLIVMFLPT
S22A2_RABIT     -----IMHLGLAGGDIYLDFFYSALV---------EFPAAFLIIATIDRVGRR-----------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     ----ILQTAGFSAAADATRI--SILLGLLKLVMTG------VSVIVIDRVGRRPLLLCGVSGMVISLFLL
SV2A_MACFA      ----------------------------------------------------------------------
SV2A_HUMAN      ----------------------------------------------------------------------
STP10_ARATH     NAPVLFKTLGFGDDAALMSAVI-TGVVNML--------STFVSIYAVDRYGRRLLFLEGGIQMFICQLLV
GTR5_RAT        KSNDVQYVTAGTG-----------AVNXXXXXXXXXXXELW---------GRRNLLLIGFSTCLTACIVL
S22AF_MOUSE     S-------AGDLGGS----IYANLALSGLI-----EIPSYPLCIYLINQFGRKRTXXXXXXXXXXXXXIV
S22A6_PONAB     ----VMDLQGF--GVSIYLIQ--------VIFGAVDLPAKLVGFLVINSLGRRPAQMXXXXXXGICILLN
KGTP_SHIFL      ----------------------------------------------------------------------
KGTP_ECOLI      ----------------------------------------------------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      VQQITVNSIMYYGTEILRNSGFQTEAALIGNIANGVISATFVGIWLLGRVGRRPM-LMXXXXXXXXXXXX
S226A_XENLA     DLQ-----------------NFNVSI-YLIQVIFGAVPAKIFSTTAMIYVGRKFTQLMSLILGGVVILAN
INT2_ARATH      YSPTIVQLAGFASNRTALLLSLVTAGLNAF--------GSIISIYFIDRIGRKKLLIISFGVIISLGILT
INT4_ARATH      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL18_ARATH     -SSAVLSYASTILRKAGFSVTIGSTLLGLFM-----IPKAMIGVILVDKWGRRPLLLTSVSGMCITSMLI
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------------------------------------------------------
SHIA_ECOLI      ----------------------------------------------------------------------
PLST4_ARATH     NAVVYYSTSVFRSAGIQSDVAASALVG------ASNVFGTAVASSLMDKMGRKSLLLTXXXXXXXXXXXX
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      -GSSVLSPASATLAKK-YHIGMTTSLLNVSLFMLGYCLGPICWAPMSEITGRKTPLYIGLFLFSVFQIAV
S22A1_HUMAN     H-------MGATSGNLYLDFLYSALV---------EIPGAFIALITIDRVGRYPMALAGAACLVMIFISP
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      YAPVLFQTMGSGDNASLISTVVTNGVNAIATV---------ISLLVVDFAGRRCLLMEGALQMTATQMTI
S22A1_RAT       -----IMHVGATGANLYLDFFYSSLV---------EFPAAFIILVTIDRIGRYPIAVTGAACLLMIFIPH
GTR8_HUMAN      ----------------------------------------------------------------------
YXAM_BACSU      ----------------------------------------------------------GFTALVLLTLTI
PHDK_NOCSK      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFAYDKLLHSNNGLLALYVIAQFFFNFGPNSTTFIVPGECFPTRYRSTSHGLSAASGKVGAIIAQCVFGP
PHO84_YEAST     GFAYHKL--GDHGLLALYVICQFFQNFGPNTTTFIVPGECFPTRYRSTAHGISAASGKVGAIIAQTALGT
PHT17_ORYSJ     AVPYDHWTAAGNGFVVLYALTFFFANFGPNATTFIVPAEIYPARLRATCHGISAASGKVGAIVGSFGFSP
PHT13_ARATH     AFPYNHWILPDNGFVVMYSLTFFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVG--AFGF
PHT17_ARATH     AIPYDHWTHKENGFVAMYSLTFFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVAQSPDKT
PHT15_ORYSJ     AVPYHHWTTPGNGFVVMYAFTFFFANFGPNSTTFIVPAEIFPARLRSTCHGISSAAGKMGAIVGS--FGF
PHT12_ORYSJ     GVPYDHWTHHHTGFVVLYALTFFFANFGPNSTTFIVPAEIFPARLRSTCHXXXXXXXXXXXXXXXXLYAA
PHT11_ORYSJ     AIPYHHWTGHHTGFIVMYGFTFFFANFGPNSTTFIVPAEIYPARLRSTCHXXXXXXXXXXXXXXXXXXXX
PHT11_ARATH     AFPYNHWIKPENGFVVMYSLTFFFANFGPNATTFIVPAEIFPARLRSTCHXXXXXXXXXXLYAAQSQDKA
PHT12_ARATH     AFPYNHWIKPENGFVVMYSLTFFFANFGPNATTFIVPAEIFPARLRSTCHXXXXXXXXXXXXXXXXXXXX
PHT18_ORYSJ     AVPYHHWTTKGNGFVVMYAFTFFFANFGPNSTTFIVPAEIFPARLRSTCHXXXXXXXXXXXXXXXXXXLY
PHT16_ARATH     AIPYHTLPANRIGFVVLYSFTFFFSNFGPNATTFIVPAEIFPARIRSTCHGISAASGKAGAMVGSFGFSA
PHT14_ORYSJ     AVPYHHWTTPGNGFVVMYAFTFFFANFGPNSTTFIVPAEIFPARLRSTCHXXXXXXXXXXLYAAQSTDAS
PHT14_ORYSI     AVPYHHWTTPGNGFVVMYAFTFFFANFGPNSTTFIVPAEIFPARLRSTCHXXXXXXXXXXLYAAQSTDAS
PHT13_ORYSJ     AAPYHHWTTPGNGFVVMYGFTFFFANFGPNATTFIVPAEIYPARLRSTCHXXXXXXXXXXXXXXXXXXLY
PT112_ORYSJ     AIPYHHWTMPGNQVIFLYGFTFFFANFGPNATTFIVPAEIFPARLRSTCHXXXXXXXXXXLYAAQPQDKA
PHT15_ARATH     AIPYDHWRHRENGFLIMYSLTMFFANFGPNATTFVVPAEIFPARLRSTCH--XXXXXXXXXXXXXXXFGF
PHT14_ARATH     AIPYNHWTHKENGFVIMYSLTFFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLY
PHT19_ARATH     GIPYSKHEKTNKGFMVLYGLIFFFSNFGPNTTTFIIPAELFPARFRSTCHGISGAAGKFGAIVGTVGFLW
YHD1_SCHPO      AGRWNEI--STGGRFACFVIAQLFSNFGPNSTTFIYPAEVFPARVRGTAHGISAALGKCGAILASLLFNF
PT111_ORYSJ     GILYDYLKTHHFLFGLLYALTFFFANFGPNSTTFVLPAELFPTRVRSTCHXXXXXXXXXXXXXXXXXXQK
YBN1_SCHPO      AGRWNEI--STGGRFACFVIAQLFSNFGPNSTTFIYPAEVFPARVRGTAHGVSAALGKCGAILASLLFNF
PHT16_ORYSJ     ALPYHHWTAPGKNHVXXXXXXXXXXNFGPNSTTFIVPAEIFPARLRATCHGISAASGKLGAIVAQSPDRS
PT113_ORYSJ     AIPYDQWLRHKNGFAVMYGLTFFFANFGPNTTTFIIPAEIFPARLRSTCH---------------XXXXX
PHT18_ARATH     GIPYSKHEHNNKGFMVLYGLVFFFCNFGPNTTTFIIPAEHFPARFRSTCHGISGAAGKLGAIVG--TVGF
YAEC_SCHPO      AGSWDTI--STGGRFACFVIAQFFSNFGPNATTFLYPAEVFPARVRGTAHGLSAALGKCGAILASLLFNF
YCX2_SCHPO      AGTWETI--STGGRFACVALAQFFFNFGPNTTCFVIPAEVFPSRVRAFSHXXXXXXXXXXXXLSALLFNK
PT110_ORYSJ     XXPYDGYWRDHGGYIVLYSLTFFSANLGPNTTTFILPAELFPARFRSTCHXXXXXXXXXXXXXXS--IGF
PHT19_ORYSJ     XXPYDGYWRDHAGYIVLYSLTFFSANLGPNTTTFILPAELFPARFRSTCHXXXXXXXXXXXXXXS--IGF
YAAU_ECOLI      GLIPDMGIWLVVMAFAVYA----FFSGGPGNLQWLYPNELFPTDIRASA---------VGVIMSLSRIGT
GIT1_YEAST      GCAYDQLKKITPLFIIFYAFMNMLGNAGPGDMLGVISSEASATAVRGVFYGLSAVTGKIGSVVGVECFQP
YHM9_SCHPO      GF-YNQLVHKIAGFCVIYGIFLTLGEFGPGGNIGLLASKTSPTAIR------------------------
GALP_ECOLI      GTMMHIGIHSPSAAMLLMFIVGFAMSAGP--LIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLT
GALP_ECOL6      GTMMHIGIHSPSAAMLLMFIVGFAMSAGP--LIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLT
ITR2_SCHPO      AIAYDTTQNTNSGWQYVVLASIIIFLASYASGIGNIPAELFPMEVRALGAGFSTAINWVGNLIISASFLT
SVOPL_MOUSE     GFLLLNICTSSAGLIGFLFMLRALVAANFN-TIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQV
ARAE_BACSU      GTSFYFELTSGIMMIVLILVAAFCVSVGP--ITWIMISEIFPNHLRARAAGIAGANWAIGQFVPMMIFG-
SVOPL_HUMAN     GFLLLNICTSSAGLIGFLFMLRALVAANFN-TVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQV
YYAJ_BACSU      GFIVN--------------ITERVF----TSNLYAYTSEPYPTEYRSSGSGLAYGLGRFSNIFGSLLVGF
PROP_ECOLI      NSNVIGLIFA--GLLMLAVILNCF--TGVMASTL---PAMFPTHIR---YSALAAAFNISVLVAGLT--P
PROP_ECO57      NSNVIGLIFA--GLLMLAVILNCF--TGVMASTL---PAMFPTHIR---YSALAAAFNISVLVAGLT--P
YWTG_BACSU      AFFDNTPAASWTTVICLGVIVVFAVSWGP--VVWVMLPELFPLHVRGIGTGVSTLMLHVGTLIVSLTY--
EDL14_ARATH     ATAISFFLQKNNPIMALISVMVYFYGLGMGPIPWIIASEIYPVDVKGAAGTVCNLVTSISSWLVTYSFNF
SV2B_HUMAN      ----------------------------------------------------------------------
YOU1_CAEEL      YFCLDRFT-----VTVLIFVARAFIS-GAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVT-----P
PLT5_ARATH      GTSLTIIDQSEKKVMWAVVVAVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLP
HXT2_YEAST      STVGVTSLYPNNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGA--------------
HGT1_KLULA      GILASENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT-NWAFNFALAMFVP
SVOP_PONAB      G---------RNVLTLLLFIARAFIS-GGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALI-------
SVOP_HUMAN      G---------RNVLTLLLFIARAFIS-GGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALI-------
HXT16_YEAST     ASIGVKCLYSSKGAGNAMIVFTCFYIFCFATTAYIVVAESFPSKVKSKAMSISTA---------------
ARAE_KLEOX      GYC---LMQFDNGTMTMMCIAGYAMSAAP--VVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLT
HXT15_YEAST     ASIGVKCLYSSKGAGNAMIVFTCFYIFCFATTAYIVVAESFPSKVKSKAMSISTA---------------
GHT3_SCHPO      AAVGDKLIYKNGGSVMIVFSCLFLFSYGPMG--WVIVGETFPIRYRSKCASVATSGNWLGNFMIS-FFTP
HXT13_YEAST     ASIGVKCLYSSKGAGNAMIVFTCFYIFCFATTAYIVVAESFPSKVKSRAMSISTA---------------
GHT6_SCHPO      ASVGDRALTRPNGAVMIVFSCLFIFSFAQTPAAYVIVGESYPIRYRSKCAAVATASNWFWNFMIS-FFTP
HXT17_YEAST     ASIGVKCLYSSKGAGNAMIVFTCFYIFCFATTAYIVVAESFPSKVKSRAMSISTA---------------
CSBC_BACSU      GVLLTLGLSASTAWMTVVFLGVYFYQATWGPVVWVLMPELFPSKARGAATGFTTLVLSAANLIVSLVFPL
YCEI_BACSU      GSAYFFGTADXXXXXXXXXXXXXFFNLGAWGVLYAYTPEQYPTAIRATGSGTTAAFGRIGGIFGPLLVGT
ITR1_YEAST      SIAF------------------------------------------------------------------
ERDL7_ARATH     AVSFHDMAHEAVPVLAVVGIMVYIFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWFGAWAVSYTFNF
PLT6_ARATH      GFGLTMAQNAGGKLLVLSIVAAYFFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLS
HXT9_YEAST      GSSHQDITSQGAGNCMIVFTMFFIFSFATTGGCYVIVSETFPLRVKSRGMAIATA--------ANWMWGF
ITR2_YEAST      AIAFHFLGIKFNGADAV-VASDGFSSWGXXGTVPWQQSELFPQNVRGVGTSYATATNWAGSLVIASTFLT
HXT1_YEAST      ASVGVTRLWPNGQVFACFYIFCFATTWAP--IAYVVISECFPLRVKSKCMSIASAANWIWGFLIS-FFTP
QUTD_EMENI      G-GYIKIAKPENGIAAIFFFYLWTAFYTPNGTPWVINSEMFDPTVRSLAQACAAASN--------WLWNF
HXT11_YEAST     GSSHQDITSQGAGNCMIVFTMFFIFSFATTGGCYVIVSETFPLRVKSRGMAIATA--------ANWMWGF
GAL2_YEAST      GYPHGKSQPSSKGAGNCMIVFTCFYIFCYATTAWVITAESFPLRVKSKCMALASASNWVGFLIA--FFTP
EDL15_ARATH     SFKENHCWETGTPVLALFSVMVYFGSYGSGSIPWIIASEIYPVDVKGAAGTMCNLVSSISAWLVAYSFSY
PROP_SALTY      GLIF-------AGLLMLAVILNCF--TGVMASTL---PAMFPTHIR---YSALAAAFNISVLIAGLT--P
XYLL3_ARATH     S-AYYKFLGGXXXXXXXXXXXCYQISFGPIS--WLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSP
S22A6_RAT       GIIPKSIIRTSLAVLGKGCLASSF------NCIFLYTGELYPTVIRQTGLGMGSTMARVGSIVS-----P
S22A6_MOUSE     GIIPHTIIRTSLAVLGKGCLASSF------NCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVS-----P
S22AD_MOUSE     XXXPGDL----PTVVTVLAVVGKFASAAAFTISYVYTAELYPTIIRQTGMGLVSIFSRVGGIITPLVMLL
HXT10_YEAST     ATGKDQPSSQSAGNVMIVFTCFFIFSFAITPIAYVIVAETYPLRVKNRAMAIAGANWMWGFLIG--FFTP
ORCT_DROME      DMNWLIVACAMIGKLAITS------SYG---TIYIFSAEQFPTVVRNVGLGASSMVARVGGILA------
PCAK_ACIAD      ----------------------------------------------------------------------
PLST1_ARATH     GFPLDEDLSQSLSILGMYI---FSFAIGAGPVTGLIIPELSSNRTRGKIMGFSFSVHWVSNFLVGLFFLD
MUCK_ACIAD      IVFYN----SPDNILYLLVIFGFLYGYGVNATYMT---ESFPTAIRGTAIGGAYNVGRLGAAIAPATIGF
SVOP_RAT        G---------RNVLTLLLFIARAFIS-GGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALI-------
GLCP_SYNY3      GGATQPTLTGAAGIIALVTANLYVFSFGFSPIVWVLLGEMFNNKIRAAALSVAAGVQWIANFIISTTFPP
GHT4_SCHPO      AAVGDKLIYKNGGAVMIVFSCLFLFSYGPMG--WVIVGETFPIRYRSKCAAVATSGNWLGNFMVS-FFTP
GHT2_SCHPO      SAVGSRALYHKNGTSAVMIVMACLFIFGFAQTAYVIVGESYPVRYRSKCAAVATASNWLWNFLIS-FFTP
EDL16_ARATH     GTSF--LLKGQSLLLVLIYVAAFSIGMGP--VPWVIMSEIFPINVKGIAGSLVVLVNWSGAWAVSYTFNF
ARAE_ECOLI      GYC---LMQFDNGTMTMMCIAGYAMSAAP--VVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLT
ARAE_ECO57      GYC---LMQFDNGTMTMMCIAGYAMSAAP--VVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLT
EDL10_ARATH     GVSFTQEMNLFPEFIPVFVFINIFFAIGIGGLPWIIMSEIFPINIKVSAGSIVALTSWTTGWFVSYGFNF
SVOP_BOVIN      XXXXXXXICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALI-------
SV2C_HUMAN      ----------------------------------------------------------------------
STP4_ARATH      GVKFGVAGTGNIGLICIYV-AGFAWSWGP--LGWLVPSEISPLEIRSAAQAINVSVNMFFTFLVAQLFLT
QAY_NEUCR       G-AYIKIADTSGGIAAIFFFYLWFYTPSWNGTPWVINSEMFDQNTRSLGQA-SXXXXXXXXXXXXSRFTP
HEX6_RICCO      GSIMAAELGDHGGLICIYV-AGFGWSWGP--LGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFVVAQTFLS
ERDL8_ARATH     GNSFLLKAHG----LALDIIPALAFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNWLSSWLVSFTFNF
S22A6_RABIT     GVIPQSIVRTSLAVLGKGCLASSF------NCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVS-----P
GTR3_CANFA      TISL--LLKDNYNWMSFVCIGAIFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFP-
YDJE_ECOLI      GYIYS--IQTTEWAILIYGLVMIFFMYVCFASAVYIP-ELWPTHLRLRGSGFVNAVGRIVAV--------
HXT3_YEAST      ASVGVTRLWPNNGVFACFYIFCFATTWAP--IAYVVISETFPLRVKSKAMSIATAA--------------
EDL11_ARATH     GVSF--TLQQMNVLPELIPIFVFVFAFGIGGLPWVIMSEIFPINIKVSAGTIVALTSWTSGWFVSYAFNF
S22A7_RAT       GTSLLVSLETKSWITALVVVGKAFSE-AAFTTAYLFTSELYPTVLRQTGLGLTALMGRXXXXXXXXXXXX
S22A1_RABIT     DLHWLTIVLSCVGRMGATIVLQMI---------CLVNAELYPTFVRNLGVMVCSALCDVGGII-------
STP7_ARATH      AVILGVKFGDNQELSKGYSXXXXXWSWGPLGWT--IPSEIFPLETRSAGQSITVAVNLLFTIIAQAFLGL
GTR2_MOUSE      GLVLDKFAWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPTALALAAFSNWVNFVIALC----
SV2C_RAT        GTSESMMI----GMLCLYN----GLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGS
S22A6_HUMAN     GVIPQSIVRTSLAVLGKGCLAASF------NCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVS-----P
INT3_ARATH      ---------SKFGYLAIVFLGLYIIVYAPGMGTWIVNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLT
YNCC_BACSU      SIVLDGSMALPYVVLSLTVLFLAFMQGCVGPVTWLVIAEIFPQRLRGLGSGISVFFLWILNFVIGFAFPI
XYLE_ECOLI      GTAFYTQAPGIVALLSLFYVAAFAMSWGP--VCWVLLSEIFPNAIRGKXXXXXXXXXXXXNYFVSWTF--
XYLE_ECO57      GTAFYTQAPGIVALLSLFYVAAFAMSWGP--VCWVLLSEIFPNAIRGKXXXXXXXXXXXXNYFVSWTF--
SV2C_MOUSE      GTSESMMI----GMLCLYN----GLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGS
NANT_YERPY      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
YKT8_SCHPO      FLFASTTAKTSNAYLGWNCTFSFFSDI-MYGVLYAYTPEVFPSKVRGTAVGLAASANRILGI-----FSP
STP3_ARATH      G---------------------------------------------------------------------
XYLT_LACBR      KFSGGSQTAAIISVIALTVIAFFSATWGP--VMWVMIGEVFPLNIRGLGNSFASVINWTANMIVSLTFPS
QAY_NEUTR       G-AYIKIAGTSGGIAAIFFFYLWFYTPSWNGTPWVINSEMFDQNTRSLGQA-SXXXXXXXXXXXXSRFTP
GTR2_RAT        GLVLDKFTWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPTALALAAFSNWVNFIIALC----
YIR0_YEAST      GSSHQDITSQGAGNCMIVFTMFFIFSFATTGGCFVIVSETFPLRAKSRGMAIATA--------ANWMWGF
STP13_ARATH     VKVTDTSTNLSKGFAILVVVAAFAWSWGPLG--WLIPSETFPLETRSAGQSVTVCVNLLFTIIAQAFLSM
QAY_NEUAF       G-AYIKIAGTSGGIAAIFFFYLWFYTPSWNGTPWVINSEMFDQNTRSLGQA-SXXXXXXXXXXXXSRFTP
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
SVOP_MOUSE      XXXXXXXXXXGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALIT-----P
S22A6_PIG       GVVPQSIVRTALAVLGKGCLAASF------NCIFLYTGELYPTMIRQTGLGMGSTLARVGSIVS-----P
ERDL5_ARATH     GLSFSKQLSGDASYLALTGVLVYTFSLGMGGIPWVIMSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNF
S22A7_MOUSE     GISLLVSSDTKSWITALVVIGKAFSE-AAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLA------
INT1_ARATH      SFFKQSETSSDGGLLALYIV---FFAPGMGPVPWTVNSEIYPQQYRGICGGMSATVNWISNLIVAQTF--
HXT5_YEAST      ASVGVTRLWPNGQVFACFYIFCFATTWAP--VAYVLISESYPLRVR----------GKAMSIASACIWGF
HUP3_CHLKE      -YGTEDLPHPSAGVLAVIFIAGFAWSWGPMG--WLIPSEIFTLETRPAGTAVAVMGNFLSFVIGQAFVSM
S22AD_HUMAN     IFIPADL----PVVVTMLAVVGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILL
S22A6_BOVIN     GVVKDKIVRTSLAVLGKGCLASSF------NCIFLYTGEVYPTMIRQTGLGMGSTLARVGSIVS-----P
GHT7_SCHPO      AAVGDRALYHKNGTSAVMIVFSCLFIFSFSQTAYVIVGESYPVRYRSKCAAVATSANWFWNFLIS-FFTP
YFIG_BACSU      SIVLEGTPALPYVVLSLTILFLAFQQTAISTVTWLMLSEIFPMHVRGLGMGISTFCLWTANFLIGFTFPI
STP1_ARATH      AFGVDGTPGELPKWYAIVVVAGFAWSWGP--LGWLVPSEIFPLEIRSAAQSITVSVNMIFTFIIAQIFLT
STP11_ARATH     GSMIGWKFGFNGALICLYV-AGFAWSWGP--LGWLVPSEICPLEIRSAGQSLNVS---------------
PLST3_ARATH     AIAYTSLLFLSVGGMLLFVLS---FATGAGPVPSLLLSEICPGRLRATA---------------------
S22A6_MACFA     GVVPQSVIRTSLAVLGKGCLAASF------NCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVS-----P
S22A4_PAPAN     DYYF---LSIGLVMLGKFGITSAF------SMLYVFTAELYPTMVRNMAVGVTSMASRVGSIIAPY----
S22A2_HUMAN     DLQWLKIIISCLGRMGITMAYEI---------VCLVNAELYPTFIRNLGVHICSSMCDIGGII-------
GHT5_SCHPO      AAVGNRALTRKNGTVMIVFSCLFIFSFAQTPAAYVIVGESYPIRYRSKCAAVATTGNWLWGFLIS-FFTP
OCTL_DROME      TVIIPQRMHTLIVACAMLGKLAITASYG---TVYIFSAEQFPTVVRNVALGAASMVARISGMMA------
S22A1_BOVIN     FIPHDNIMVACVGRMGITIVFQM---------VCLVNAELFPTFIRNLGMMVCSSLCDLGGVLTPFLVFR
GHT1_SCHPO      AAVGNRALTRKNGTVMIVFSCLFIFSFAQTPAAYVIVGESYPIRYRSKCAAVATTSNWLWNFLIS-FFTP
S22A1_MOUSE     ELHWLNVTLACLGRMGATIVLQM---------VCLVNAELYPTFIRNLGMMVCSALCDLGGIFTPFMVFR
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      GTLIGKFGTTGSGTLTLYV-AGFAWSWGPLG--WLVPSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLT
S22A5_HUMAN     --GGSVLLFMQLVPPDLYYLATVLVMVGKFGVTYVYTAELYPTVVRNMGVGVSSTASRLGSILS------
GTR2_BOVIN      GLVLSKFPWMNYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALAIAAFSNWTGFIIALC----
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       GFGDNQQLSKSFSVLVVIMICLFVLAFGWSPLGWTVPSEIFPLETRSAGQSITVA---------------
GHT8_SCHPO      AAVGNRALTRKNGTVMIVFSCLFIFSFAQTPAAYVIVGESYPIRYRSKCAAVATTGNWLWGFLI-TFFTP
SV2A_PONAB      ----------------------------------------------------------------------
S22AF_HUMAN     GVFAVVNSHSLSLLGKLTISAAF-------NIVYIYTSELYPTVIRNVGLGTCSMFSRVGGIIA------
S22A2_RABIT     ----------------------------------------------------------------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     GYMFYKNXXXXXXXXXXXXXGCYQLSFGP--IGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSP
SV2A_MACFA      ----------------------------------------------------------------------
SV2A_HUMAN      ----------------------------------------------------------------------
STP10_ARATH     GFIGARFGTSGTGTLTCVYVAGFAWSWGP--LGWLVPSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLT
GTR5_RAT        TVAQNTISWMPXXXXXXXXXXXXGHAVGPSPIPALFITEIFLQSSRPSAYMIGGSVHWLSNFIVGLIF-P
S22AF_MOUSE     MFLPEKKSHSLSLLGKLTISAAF-------NIVYIYTSELYPTVIRNVGLGACSMFSRVGGIIAPFV---
S22A6_PONAB     GVIPQSIVRTSLAVPGKGCLAASF------NCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVS-----P
KGTP_SHIFL      ----------------------------------------------------------------------
KGTP_ECOLI      ----------------------------------------------------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      XXXFSLVLEGSPALLSLTVTFLAFQQGAISPVTWLMLSEIFPLRLRGLGMGVTVFCLWMVNFAVSFTFPI
S226A_XENLA     SFVPHEMQTVRTGM-AVFGKGCLAASF---SCVFLYTTELYPTVIRQSGLGLCSTMARIGGIVAPLVFLP
INT2_ARATH      GVFYEAATHA----LGLYII---FFSPGMGTVPWIVNSEIYPLRFRGICGGIAATANWISNLIVAQSF--
INT4_ARATH      ---------SKFGFLAIVFLGLYIVVYAPGMGTWIVNSEIYPLRYRGLGGGIAAVSNWVSNLIVSESFLS
HSRA_ECOLI      ----------------------------------------------------------------------
EDL18_ARATH     GVAFTQLLPELTPVFTFICVTLYIYAIGLGGLPWVIMSEIFPMNIKVTAGXXXXXXXXXXXXXXXYAFNF
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------------------------------------------------------
SHIA_ECOLI      ----------------------------------------------------------------------
PLST4_ARATH     XXXXTKALAAYSGTLALYVLS---FSXXXXXXXXXXXXEIFASRIRAKAVALSLGMHWISNFVIGLYFLS
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      ATAQD---------IQTIMICRFFGGYGACVPLCVVAADMYPNRYRGTAITIFAAVIFVGPLVA-----P
S22A1_HUMAN     DLHWLNIIIMCVGRMGITIAIQMI---------CLVNAELYPTFVRNLGVMVCSSLCDIGGII-------
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      GLAHLKLVGPITGILICVYVSGFAWSWGP--LGWLVPSEIYPLEVRNAGYFCAVAMNMVCTFI-------
S22A1_RAT       ELHWLNVTLACLGRMGATIVLQM---------VCLVNAELYPTFIRNLGMMVCSALCDLGGIFTPFMVFR
GTR8_HUMAN      ------------GSMCLF-IAGFAVGWGP--IPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSS
YXAM_BACSU      RF--EKKIEKNPGMVMTFLLSRAFRPLGIPCTAFLLAIEFFPDSYKNTLFSLNSGVGAIGEILSGVIFGI
PHDK_NOCSK      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LVSRGAKPGSSEKPWLKHVMQIFALFMLCGLITSFLIPETKRKTLEELAGEVPETPNYDPVTAGHARREG
PHO84_YEAST     LIDHNARDGKPTNCWLPHVMEIFALFMLLGIFTTLLIPETKRKTLEEI----------------------
PHT17_ORYSJ     VPAKAAAHGYPPGIGVRNSLFALAGCSLLGFLLTFLVPEPKGKSLEEMSRE-------------------
PHT13_ARATH     LYA--AQPQDKTKTGVKNSLIMLGVINFVGMLFTFLVPEPKGKSLEELSGE-------------------
PHT17_ARATH     KTEHGYPPGIG----VKNSLIVLGVVNLLGMVFTLLVPESKGKSLEEM----------------------
PHT15_ORYSJ     LAAQSTDPSKTDAGYPRGIGVRNSLFLLAGFLFTFLVPESKGKSLEELSGE--NEMEAEPAAATNSYRQT
PHT12_ORYSJ     QDQHNPDAGYSRGIGIRNALFVLAGTNFLGMLMTLLVPESKGLSLEEMS---------------------
PHT11_ORYSJ     XXQDQHKPGYPRGIGIKNALFVLAGTNFLGTIMTLLVPESKGMSLEVISQEVAD----------------
PHT11_ARATH     KVDAGYPPGIG----VKNSLIMLGVLNFIGMLFTFLVPEPKGKSLEELSGE-------------------
PHT12_ARATH     XVDAGYPPGIG----VKNSLIVLGVLNFIGMLFTFLVPEPKGKSLEELSGE-------------------
PHT18_ORYSJ     AAQDPHKPDAGYKPGIRNSLFVLAGCNLLGFICTFLVPESKGKSLEEMS---------------------
PHT16_ARATH     LV---------KALGMSNTLYIMAGINLLGLLLTFTIPETNGKSLEELSGE-------------------
PHT14_ORYSJ     KTDAGYPPGIG----VRNSLFFLAGCNVIGFFFTFLVPESKGKSLEELSGEVPEA----PATADH-----
PHT14_ORYSI     KTDAGYPPGIG----VRNSLFFLAGCNVIGFFFTFLVPESKGKSLEELSGEVPEAPS----TADH-----
PHT13_ORYSJ     AAQDPHKPEAGYKPGIRNALFVLAGTNFLGMLMTLLVPESKGMSLEEVSKE-------------------
PT112_ORYSJ     HVDAGYKPGIGVRN---------ALFVLAGLMTWMLVPESKGKSLEEMSGEADD----------------
PHT15_ARATH     LYA--AQSSDSEKTGVRNSLLMLACVNFLGIVFTLLVPESKGKSLEEISREDEEQSGGDTVVEMTVANSG
PHT14_ARATH     LAQNPDKAGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL-------------------------
PHT19_ARATH     ATRHHEEDGFPDVKRVRIAFLILGGVCIAGMIVTYLFTETMGRSLEENEDEIVST---------------
YHD1_SCHPO      LTSIIG---------YGNVMWIFCGCMWGGILFTLLLPETKGRDADEI----------------------
PT111_ORYSJ     LTY------NSQVXXXXXXXXXXXXTNMLGFFFTFLVPETMGRSLEEISGE-------------------
YBN1_SCHPO      LTG---------VIGYGNVMWIFCGCMWGGILFTLLLPETKGRDADEI----------------------
PHT16_ORYSJ     KTEHGYPPGIG----VRNSXXXXXXXXXXXXXXTFLVPESKGKSLEEMSGD-------------------
PT113_ORYSJ     XXXXXXXXXXXXXLYTEYHIRIFLFVLLVGFIFTLLLPESKGKSLEDLTG--------------------
PHT18_ARATH     LWATKKMESDDKNQIYPEVNRMRIAFLILGLVTYFFTKETMGRSLEE-----------------------
YAEC_SCHPO      LTS---------VIGYGNVMWIFCGCMWGAIFFTLLLPETKMRDADEIDRE-------------------
YCX2_SCHPO      L---------TEVIGFGNVLWIFFGCMVAGAVVTLILPETANR---------------------------
PT110_ORYSJ     LWASQQKDGAA-AGHLPGIGMMYALFVLGGILTYVFTPETMMRSLEENESDRAQT---------------
PHT19_ORYSJ     LWASQQKDGAA-AGHLPGIGMMYALFVLGGILTYAFTPETMTRSLEE-----------------------
YAAU_ECOLI      IVSTWALPIFINNYGISNTMLMGAGISLFGLLISVFAPETRGMSLAQ-----------------------
GIT1_YEAST      I---------------------------------------------------------------------
YHM9_SCHPO      ----------------------------------------------------------------------
GALP_ECOLI      MLN---TLGNANTFWV-----YAALNVLFILLTLWLVPETKHVSLEHI----------------------
GALP_ECOL6      MLN---TLGNANTFWV-----YAALNVLFILLTLWLVPETKHVSLEHI----------------------
ITR2_SCHPO      MMESITPTGT---------FALFAGFCFVGLVTSFTYPELAGMSIENI----------------------
SVOPL_MOUSE     LMSAS---------FLGALCLFSSVCVVCA-ISAFTLPETKGRALQQI----------------------
ARAE_BACSU      ---------------LAYTFWIFAVIILCFLFVVTICPETKNKSLEEI----------------------
SVOPL_HUMAN     LMSAS----------ILGALCLFSSVCVVCAISAFTLPETKGRALQQI----------------------
YYAJ_BACSU      I--------AVQLGYISVFLFIGGCWLACSLLLIFFGPNTNAKQI-------------------------
PROP_ECOLI      TLAAWLVESSQNLMMPAYYLMVVA---VVGLITGVTMKETANRPLK------------------------
PROP_ECO57      TLAAWLVESSQNLMMPAYYLMVVA---VVGLITGVTMKETANRPLK------------------------
YWTG_BACSU      -------PILMEAIGISYLFLIYAIGIMAFLFVRFKVTETKGRSLEEI----------------------
EDL14_ARATH     LLQWSS----------TGTFMMFATVMGLGFVTAKLVPETKGKSLEEIQSAFTDSTSED-----------
SV2B_HUMAN      ----------------------------------------------------------------------
YOU1_CAEEL      FIAQVASEKSLSLP--------------------------------------------------------
PLT5_ARATH      M-SKAMTTGG-------------AFYLFGGIATYTFLPETQGRMLEDM----------DELFSGFRWRDS
HXT2_YEAST      ----------------------------------------------------------------------
HGT1_KLULA      SAFKNIS-------WKTYI--IFGVFSVALTITFFMFPETKGKTLEEIVDNIPRTANYIPQLPIVKDEEG
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
HXT16_YEAST     ----------------------------------------------------------------------
ARAE_KLEOX      LLDAIGAAGTF---WLYTALNVAFIG-----VTFWLIPETKNVTLEHI----------------------
HXT15_YEAST     ----------------------------------------------------------------------
GHT3_SCHPO      FINNGFKLG-----YIYACINLFSSFMI-----FFLAKETKGLTLEEV----------------------
HXT13_YEAST     ----------------------------------------------------------------------
GHT6_SCHPO      FISNGFKYG-----------YVFAACNLCAAIIIFLFKETKGLTLEEI--NQLYLSNIKPWNTGAYQRDR
HXT17_YEAST     ----------------------------------------------------------------------
CSBC_BACSU      MLSAMG---------IAWVFMVFSVICLLSFFFAFMVPETKGKSLEEI----------------------
YCEI_BACSU      LAAR------------------------------------------------------------------
ITR1_YEAST      ----------------------------------------------------------------------
ERDL7_ARATH     LMS-----WSSYGTFLIYA----AINALAIVFVIAIVPETKGKTLEQI----------------------
PLT6_ARATH      LTSAITTXXXXXXXXXXXXXXWNFFF--------FLLPETKGKSLEEI----------------------
HXT9_YEAST      LI-------SFFTPFITGAINFYYGYVFLGCLXXXXXPETKGLTLEEV----------------------
ITR2_YEAST      MLQNITPTGT---------FSFFAVACLSTIFCYFCYPELSGLELEEVQTILKDGFNIKASKALAKKRKQ
HXT1_YEAST      FIT-------------------------------------------------------------------
QUTD_EMENI      LISRFTPQMFTSMGY--GVYFFFASLMILSIVVFFLIPETKGVPLESM-----ET-LFDKKPVWHA--HS
HXT11_YEAST     LI-------SFFTPFITGAINFYYGYVFLGCLXXXXXPETKGLTLEEV----------------------
GAL2_YEAST      FIT------SAINFYYGYVFMLVAMF----FYVFFFVPETKGLSLEEI----------------------
EDL15_ARATH     LLQ-----WSSTGTFL-----MFATVAGLGFVIAKLVPETKGKSLEEIQSLFTDSPPQD-----------
PROP_SALTY      TLAAWLVESSQDLMMPAYYLMVIAVI---GLITGISMKETANRPLK------------------------
XYLL3_ARATH     ---------------LKEFLGAENLFLLFGLFVILVVPETKGLSLEEIESKI------------------
S22A6_RAT       LVSMTAEFYPSMP------LFIFGAVPVVASAVTALLPETLGQPLPD-----------------------
S22A6_MOUSE     LISMTAEFYPSIP------LFIFGAVPVAASAVTALLPETLGQPLPD-----------------------
S22AD_MOUSE     EQYHQAIP-----------MVIFGSLPIGAGLLCALLPETRGQTLKD-----------------------
HXT10_YEAST     FITRSI---GFSYGYVFMGCLIFSYFYV-----FFFVCETKGLTLEEV----------------------
ORCT_DROME      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
PLST1_ARATH     LV---------EKYGVGTVYASFSVSLLAAAFSHLFTVETKGRSLEEI----------------------
MUCK_ACIAD      LASGGS-------IGLGFVV-MGAAYFICGVIPALFIKE-------------------------------
SVOP_RAT        ----------------------------------------------------------------------
GLCP_SYNY3      LL--------------------------------------------------------------------
GHT4_SCHPO      FISNGFKLG-----------YIYACINMTSAFQIFLMKETKGLTLEEV----------------------
GHT2_SCHPO      FISIGFKYG-----------YVFASCNLTGAIVIFLFKETKGLTLEEI----------------------
EDL16_ARATH     LMS-WSSPGT---------FYLYSAFAAATIIVAKMVPETKGKTLEEI----------------------
ARAE_ECOLI      LLD---SIGAAGTFWLYTALNIAFVG-----ITFWLIPETKNVTLEHI----------------------
ARAE_ECO57      LLD---SIGAAGTFWLYTALNIAFVG-----ITFWLIPETKNVTLEHI----------------------
EDL10_ARATH     MFEWSA----------QGTFYIFA--MVGGLSLLFLVPETKGQSLEELQASLTGT---------------
SVOP_BOVIN      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
STP4_ARATH      MLCHMKXXXXXXXXXXVVIMTIFIYLML---------PETKNVPIEEM----------------------
QAY_NEUCR       QMFIKMEYG---------VYFFFASLMLLSIVIYFFLPETKSIPLEAM----------------------
HEX6_RICCO      MLCHFKSXXXXXXXXXXXXMTAF---------VHFLLPETKKVPIEKM----------------------
ERDL8_ARATH     LMI-----------WSPHTFYVYGVCVLAIIFIAKLVPETKGRTLEEI----------------------
S22A6_RABIT     LVS-------------------------------------------------------------------
GTR3_CANFA      --SAAFYLGA-------YVFIIFTGFLIVFLVTFFKVPETRGRTFEEITRAF--------------EGQG
YDJE_ECOLI      ----------------------------------------------------------------------
HXT3_YEAST      ----------------------------------------------------------------------
EDL11_ARATH     MFEWSAQ-------------GTFYIFAAVGIFIWMLVPETKGQSLEELQASLTGT---------------
S22A7_RAT       XXXXXXXP--------KVAYGGIALVAAC---TALLLPETKKAQLPETIQDV------------------
S22A1_RABIT     ----------------------------------------------------------------------
STP7_ARATH      LCAFKFGIFLFFAGWVT-VMTIFVY---------FLLPETKGVPIEEM----------------------
GTR2_MOUSE      ----------------------------------------------------------------------
SV2C_RAT        LVS-------------------------------------------------------------------
S22A6_HUMAN     LVSMTAELYPSMP------LFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKG
INT3_ARATH      LTNAVGSSGT---------FLLFAGSSAVGLFFIWLVPETKGLQFEEV----------------------
YNCC_BACSU      LLS---SVGLSFTFFIFVALGVLAI----GFVYKFM-PETKGRTLEEL----------------------
XYLE_ECOLI      -------PMMDKNSWLAHFHNGFSYWVLAALFMWKFVPETKGKTLEEL----------------------
XYLE_ECO57      -------PMMDKNSWLAHFHNGFSYWVLAALFMWKFVPETKGKTLEEL----------------------
SV2C_MOUSE      LVS-------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
YKT8_SCHPO      VIAMRANLTTSAPIFVSG-----ALFIFAGILVVFFPYEPRGKS--------------------------
STP3_ARATH      ----------------------------------------------------------------------
XYLT_LACBR      LL--------------------------------------------------------------------
QAY_NEUTR       QMFIKMEYG---------VYFFFASLMLLSIVIYFFIPETKSIPLEAM----------------------
GTR2_RAT        ----------------------------------------------------------------------
YIR0_YEAST      LI-------SFFTPFITGAINFYYGYVFLGCLXXXXXPETKGLTLEEV----------------------
STP13_ARATH     LCH------------FKFGIFIFAWVLIMSVFVMFLLPETKNIPIEEMTERV------------------
QAY_NEUAF       QMFIKMEYG---------VYFFFASLMLLSVVIYFFIPETKSIPLEAM----------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
SVOP_MOUSE      FIAQVMLESS--------VYLTLAVYLLAGVASCFLPIETKGRALQE-----------------------
S22A6_PIG       LVSMTAE---------------------------------------------------------------
ERDL5_ARATH     LMNWN--PAGT----------FYVFATVCGATVIFLVPETKGRTLEEI----------------------
S22A7_MOUSE     ----------------------------------------------------------------------
INT1_ARATH      ----------------------------------------------------------------------
HXT5_YEAST      LI-------SFFTPFITSAINFYYGYVFMGCMXXXXXPETKGLTLEEV----------------------
HUP3_CHLKE      LCAMKFGVFLFFAGWL-------VIMVLCAI---FLLPETKGVPIERV----------------------
S22AD_HUMAN     GEYHAALP-----------MLIYGSLPIVAGLLCTLLPETHKDTLQDLLGPHPRSPKSVP----------
S22A6_BOVIN     LVSMTAE---------------------------------------------------------------
GHT7_SCHPO      FISIGFKYG-----------YIFASCNLTGAAIIFLVHETKGRTLEEI----------------------
YFIG_BACSU      LLNH---IGMSATFFIFVAMNILAI-----LFVKKYVPETKGRSLEQL----------------------
STP1_ARATH      MLCHLKFGXXXXXXXXXXXMSIFVYIFL---------PETKGIPIEEM----------------------
STP11_ARATH     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
S22A6_MACFA     LVS-------------------------------------------------------------------
S22A4_PAPAN     FVYLGA-----YNRMLPYIV-MGSLTVLIGILTLF-FPESLGMTLPETLEQMQKVKWF---------RSG
S22A2_HUMAN     ----------------------------------------------------------------------
GHT5_SCHPO      FISIGFKYG-----------YIFAACNLCAACIIFLFAETKGLTLEEISGAKPWMPR--PKNLGNFTKQQ
OCTL_DROME      ----------------------------------------------------------------------
S22A1_BOVIN     LM----------EVWQGSPLILFAALGLVAGGMTLLLPETKGVTLPE-----------------------
GHT1_SCHPO      FISIGFKYG-----------YIFASCNLCASIVTFLFAESKGLTLEEI----------------------
S22A1_MOUSE     LM----------EVWQALPLILFGVLGLSAGAVTLLLPETKGVALPETIEE-------------------
MHPT_ECOLI      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
STP9_ARATH      M--------------LCHMK--FGLFYFFGGMVAFLLPETKGVPIEEM----------------------
S22A5_HUMAN     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
STA_RICCO       ----------------------------------------------------------------------
GHT8_SCHPO      FISDGFKYG-----------YIFAACNLCAACIIFLFAETKGLTLEELSGAKPWMPR--PENLGQAAKQQ
SV2A_PONAB      ----------------------------------------------------------------------
S22AF_HUMAN     ----------------------------------------------------------------------
S22A2_RABIT     ----------------------------------------------------------------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
XYLL1_ARATH     ---------------LKELLGAGILFCAFGVIIYYIVPETKGLTLEEI----------------------
SV2A_MACFA      ----------------------------------------------------------------------
SV2A_HUMAN      ----------------------------------------------------------------------
STP10_ARATH     MLCH-----------MKFGLFYFSMVAIMTVFIYFLLPETKGVPIEEM----------------------
GTR5_RAT        FIQVGLGPYS---------FIIFAIICLLTTIYIFMVPETKGRTFVEI----------------------
S22AF_MOUSE     ----------------------------------------------------------------------
S22A6_PONAB     LVSMTAELYPSMP------LFIYGAVPVAASAVTVLLPETLGQPLPD-----------------------
KGTP_SHIFL      ----------------------------------------------------------------------
KGTP_ECOLI      ----------------------------------------------------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
IOLT_BACSU      LLAAIG---------LSTTFFIFVGLGICSLFVKRFLPETKGLSLEQL----------------------
S226A_XENLA     LVIYGGAP------------------IISGLCV-FFLPETVNKPLPDTIEEV------------------
INT2_ARATH      -LSLTEAIGTSWTFLIFGVISVIAL-----LFVMVCVPETKGMPMEEI----------------------
INT4_ARATH      LTHALGSSGT---------FLLFAGFSTIGLFFIWLVPETKGLQFEEV----------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL18_ARATH     LLE-----------WTQGTFYVFAVGGLALLFIWLLVPETKGLSLEEIQASLIREPD-------------
ANTR6_ARATH     ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------------------------------------------------------
SHIA_ECOLI      ----------------------------------------------------------------------
PLST4_ARATH     VVT---------KFGISSVYLGFAVCVLAVLYIAGNVVETKGRSLEEI----------------------
GUDP_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
YN41_SCHPO      IVGGFLTKSYLGWRWTEYILSIILIYLFCEETYLKTITENKVQEYREITG--------------------
S22A1_HUMAN     ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
STP2_ARATH      ----------------------------------------------------------------------
S22A1_RAT       LM----------EVWQALPLILFGVXXXXXXXXXXXXPETKGVALPETIEE-------------------
GTR8_HUMAN      LMEVLRPYGAF---WLASAFCIFSV-----LFTLFCVPETKGKTLEQI----------------------
YXAM_BACSU      I---------SAAFGLSAMFVVVAVFLLIPIILYTIVPKIK-----------------------------
PHDK_NOCSK      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QQVKGGEETPETVSPDMQPNEKHTTIx
PHO84_YEAST     ---------------------------
PHT17_ORYSJ     ---------------------------
PHT13_ARATH     ---------------------------
PHT17_ARATH     ---------------------------
PHT15_ORYSJ     VPDSGQSE-------------------
PHT12_ORYSJ     ---------------------------
PHT11_ORYSJ     ---------------------------
PHT11_ARATH     ---------------------------
PHT12_ARATH     ---------------------------
PHT18_ORYSJ     ---------------------------
PHT16_ARATH     ---------------------------
PHT14_ORYSJ     ---------------------------
PHT14_ORYSI     ---------------------------
PHT13_ORYSJ     ---------------------------
PT112_ORYSJ     ---------------------------
PHT15_ARATH     RKV------------------------
PHT14_ARATH     ---------------------------
PHT19_ARATH     ---------------------------
YHD1_SCHPO      ---------------------------
PT111_ORYSJ     ---------------------------
YBN1_SCHPO      ---------------------------
PHT16_ORYSJ     ---------------------------
PT113_ORYSJ     ---------------------------
PHT18_ARATH     ---------------------------
YAEC_SCHPO      ---------------------------
YCX2_SCHPO      ---------------------------
PT110_ORYSJ     ---------------------------
PHT19_ORYSJ     ---------------------------
YAAU_ECOLI      ---------------------------
GIT1_YEAST      ---------------------------
YHM9_SCHPO      ---------------------------
GALP_ECOLI      ---------------------------
GALP_ECOL6      ---------------------------
ITR2_SCHPO      ---------------------------
SVOPL_MOUSE     ---------------------------
ARAE_BACSU      ---------------------------
SVOPL_HUMAN     ---------------------------
YYAJ_BACSU      ---------------------------
PROP_ECOLI      ---------------------------
PROP_ECO57      ---------------------------
YWTG_BACSU      ---------------------------
EDL14_ARATH     ---------------------------
SV2B_HUMAN      ---------------------------
YOU1_CAEEL      ---------------------------
PLT5_ARATH      KSKPKGNPEKTVPNPEVE---------
HXT2_YEAST      ---------------------------
HGT1_KLULA      NKL-GLLGNPQHLE-DVHSNEK-----
SVOP_PONAB      ---------------------------
SVOP_HUMAN      ---------------------------
HXT16_YEAST     ---------------------------
ARAE_KLEOX      ---------------------------
HXT15_YEAST     ---------------------------
GHT3_SCHPO      ---------------------------
HXT13_YEAST     ---------------------------
GHT6_SCHPO      EDIKQSDSEKE----------------
HXT17_YEAST     ---------------------------
CSBC_BACSU      ---------------------------
YCEI_BACSU      ---------------------------
ITR1_YEAST      ---------------------------
ERDL7_ARATH     ---------------------------
PLT6_ARATH      ---------------------------
HXT9_YEAST      ---------------------------
ITR2_YEAST      QVAEG----------------------
HXT1_YEAST      ---------------------------
QUTD_EMENI      QLIRELRENEEAFRADMGASGK-----
HXT11_YEAST     ---------------------------
GAL2_YEAST      ---------------------------
EDL15_ARATH     ---------------------------
PROP_SALTY      ---------------------------
XYLL3_ARATH     ---------------------------
S22A6_RAT       ---------------------------
S22A6_MOUSE     ---------------------------
S22AD_MOUSE     ---------------------------
HXT10_YEAST     ---------------------------
ORCT_DROME      ---------------------------
PCAK_ACIAD      ---------------------------
PLST1_ARATH     ---------------------------
MUCK_ACIAD      ---------------------------
SVOP_RAT        ---------------------------
GLCP_SYNY3      ---------------------------
GHT4_SCHPO      ---------------------------
GHT2_SCHPO      ---------------------------
EDL16_ARATH     ---------------------------
ARAE_ECOLI      ---------------------------
ARAE_ECO57      ---------------------------
EDL10_ARATH     ---------------------------
SVOP_BOVIN      ---------------------------
SV2C_HUMAN      ---------------------------
STP4_ARATH      ---------------------------
QAY_NEUCR       ---------------------------
HEX6_RICCO      ---------------------------
ERDL8_ARATH     ---------------------------
S22A6_RABIT     ---------------------------
GTR3_CANFA      QDANRAEKGPIVEMNSMQPVKETATV-
YDJE_ECOLI      ---------------------------
HXT3_YEAST      ---------------------------
EDL11_ARATH     ---------------------------
S22A7_RAT       ---------------------------
S22A1_RABIT     ---------------------------
STP7_ARATH      ---------------------------
GTR2_MOUSE      ---------------------------
SV2C_RAT        ---------------------------
S22A6_HUMAN     KQTRQQQEHQKYMVP------------
INT3_ARATH      ---------------------------
YNCC_BACSU      ---------------------------
XYLE_ECOLI      ---------------------------
XYLE_ECO57      ---------------------------
SV2C_MOUSE      ---------------------------
NANT_YERPY      ---------------------------
NANT_YERPE      ---------------------------
NANT_YERPA      ---------------------------
YKT8_SCHPO      ---------------------------
STP3_ARATH      ---------------------------
XYLT_LACBR      ---------------------------
QAY_NEUTR       ---------------------------
GTR2_RAT        ---------------------------
YIR0_YEAST      ---------------------------
STP13_ARATH     ---------------------------
QAY_NEUAF       ---------------------------
NANT_YERPS      ---------------------------
NANT_YERPP      ---------------------------
NANT_YERPG      ---------------------------
NANT_YERPB      ---------------------------
NANT_YERP3      ---------------------------
BENK_ACIAD      ---------------------------
SVOP_MOUSE      ---------------------------
S22A6_PIG       ---------------------------
ERDL5_ARATH     ---------------------------
S22A7_MOUSE     ---------------------------
INT1_ARATH      ---------------------------
HXT5_YEAST      ---------------------------
HUP3_CHLKE      ---------------------------
S22AD_HUMAN     ---------------------------
S22A6_BOVIN     ---------------------------
GHT7_SCHPO      ---------------------------
YFIG_BACSU      ---------------------------
STP1_ARATH      ---------------------------
STP11_ARATH     ---------------------------
PLST3_ARATH     ---------------------------
S22A6_MACFA     ---------------------------
S22A4_PAPAN     KKTRDSMETEE----------------
S22A2_HUMAN     ---------------------------
GHT5_SCHPO      EEVR-----------------------
OCTL_DROME      ---------------------------
S22A1_BOVIN     ---------------------------
GHT1_SCHPO      ---------------------------
S22A1_MOUSE     ---------------------------
MHPT_ECOLI      ---------------------------
GUDP_ECOLI      ---------------------------
GUDP_PSEPU      ---------------------------
STP9_ARATH      ---------------------------
S22A5_HUMAN     ---------------------------
GTR2_BOVIN      ---------------------------
EMRB_ECOLI      ---------------------------
EMRB_ECO57      ---------------------------
STA_RICCO       ---------------------------
GHT8_SCHPO      QEV------------------------
SV2A_PONAB      ---------------------------
S22AF_HUMAN     ---------------------------
S22A2_RABIT     ---------------------------
PROP_STAAW      ---------------------------
PROP_STAAS      ---------------------------
PROP_STAAR      ---------------------------
PROP_STAAN      ---------------------------
PROP_STAAM      ---------------------------
PROP_STAAC      ---------------------------
PROP_STAA1      ---------------------------
AQR1_YEAST      ---------------------------
XYLL1_ARATH     ---------------------------
SV2A_MACFA      ---------------------------
SV2A_HUMAN      ---------------------------
STP10_ARATH     ---------------------------
GTR5_RAT        ---------------------------
S22AF_MOUSE     ---------------------------
S22A6_PONAB     ---------------------------
KGTP_SHIFL      ---------------------------
KGTP_ECOLI      ---------------------------
SV2A_RAT        ---------------------------
SV2A_MOUSE      ---------------------------
IOLT_BACSU      ---------------------------
S226A_XENLA     ---------------------------
INT2_ARATH      ---------------------------
INT4_ARATH      ---------------------------
HSRA_ECOLI      ---------------------------
EDL18_ARATH     ---------------------------
ANTR6_ARATH     ---------------------------
SV2A_BOVIN      ---------------------------
SHIA_ECOLI      ---------------------------
PLST4_ARATH     ---------------------------
GUDP_BACSU      ---------------------------
YDFJ_ECOLI      ---------------------------
NANT2_ECOL6     ---------------------------
YN41_SCHPO      ---------------------------
S22A1_HUMAN     ---------------------------
S17A5_SHEEP     ---------------------------
PROP_STAEQ      ---------------------------
STP2_ARATH      ---------------------------
S22A1_RAT       ---------------------------
GTR8_HUMAN      ---------------------------
YXAM_BACSU      ---------------------------
PHDK_NOCSK      ---------------------------