[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00337

[Show Plain Result]


## Summary of Sequence Search
    1::462
   17::388     6e-92  56%  403 aa  PANK_SCHPO RecName: Full=Pantothenate kinase;       
   16::354     6e-83  56%  367 aa  PANK_YEAST RecName: Full=Pantothenate kinase;       
   37::391     2e-74  51%  870 aa  PANK2_ARATH RecName: Full=Pantothenate kinase 2;       
   18::372     9e-69  53%  773 aa  PANK4_HUMAN RecName: Full=Pantothenate kinase 4;       
   18::372     1e-68  53%  773 aa  PANK4_MACFA RecName: Full=Pantothenate kinase 4;       
   18::372     4e-68  52%  773 aa  PANK4_PONAB RecName: Full=Pantothenate kinase 4;       
   18::386     1e-67  51%  773 aa  PANK4_RAT RecName: Full=Pantothenate kinase 4;       
   18::386     2e-67  51%  820 aa  PANK4_MOUSE RecName: Full=Pantothenate kinase 4;       
    6::337     4e-67  49%  383 aa  PANK1_ARATH RecName: Full=Pantothenate kinase 1;       
   80::364     4e-40  41%  370 aa  PANK3_BOVIN RecName: Full=Pantothenate kinase 3;       
  241::590     5e-40  42%  598 aa  PANK1_HUMAN RecName: Full=Pantothenate kinase 1;       
   80::364     7e-40  41%  370 aa  PANK3_HUMAN RecName: Full=Pantothenate kinase 3;       
   80::364     9e-40  41%  370 aa  PANK3_MOUSE RecName: Full=Pantothenate kinase 3;       
  191::540     9e-40  43%  548 aa  PANK1_MOUSE RecName: Full=Pantothenate kinase 1;       
  216::565     3e-37  41%  570 aa  PANK2_HUMAN RecName: Full=Pantothenate kinase 2, mitochondrial;    
    3::269     1e-15  33%  276 aa  COAW_BACCZ RecName: Full=Type II pantothenate kinase;       
    3::269     1e-14  33%  276 aa  COAW_BACC0 RecName: Full=Type II pantothenate kinase;       
    3::269     2e-14  32%  276 aa  COAW_BACHK RecName: Full=Type II pantothenate kinase;       
    3::269     6e-14  32%  276 aa  COAW_BACC1 RecName: Full=Type II pantothenate kinase;       
    3::269     1e-11  31%  276 aa  COAW_BACAN RecName: Full=Type II pantothenate kinase;       
    5::269     4e-10  31%  273 aa  COAW_BACCR RecName: Full=Type II pantothenate kinase;       
    5::269     4e-10  31%  273 aa  COAW_BACC4 RecName: Full=Type II pantothenate kinase;       
    5::269     7e-10  31%  273 aa  COAW_BACC2 RecName: Full=Type II pantothenate kinase;       
    1::260     4e-06  31%  262 aa  COAW_OCEIH RecName: Full=Type II pantothenate kinase;       
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxVQRLEEAISHPGSVKINVKGAFIVDEQPTEQSRVVFDCRDGI
PANK_SCHPO      ----------------------------ISNVERQLSQPPSVWLNLTGARIIENEGQ------FD-----
PANK_YEAST      ----------------------------------------------------------------------
PANK2_ARATH     ----------------------------------------------------------------------
PANK4_HUMAN     ----------------------------------------------------------------------
PANK4_MACFA     ----------------------------------------------------------------------
PANK4_PONAB     ----------------------------------------------------------------------
PANK4_RAT       ----------------------------------------------------------------------
PANK4_MOUSE     ----------------------------------------------------------------------
PANK1_ARATH     ----------------------------------------------------------------------
PANK3_BOVIN     ----------------------------------------------------------------------
PANK1_HUMAN     ----------------------------------------------------------------------
PANK3_HUMAN     ----------------------------------------------------------------------
PANK3_MOUSE     ----------------------------------------------------------------------
PANK1_MOUSE     ----------------------------------------------------------------------
PANK2_HUMAN     ----------------------------------------------------------------------
COAW_BACCZ      ----------------------------------------------------------------------
COAW_BACC0      ----------------------------------------------------------------------
COAW_BACHK      ----------------------------------------------------------------------
COAW_BACC1      ----------------------------------------------------------------------
COAW_BACAN      ----------------------------------------------------------------------
COAW_BACCR      ----------------------------------------------------------------------
COAW_BACC4      ----------------------------------------------------------------------
COAW_BACC2      ----------------------------------------------------------------------
COAW_OCEIH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HYEHKDIRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
PANK_SCHPO      ----KDIALPNNKSHVTHIAVDIGGSLAKVMYYVCEXAENYTGGRLSFMIFETAKIEDCIQFMANLIDNH
PANK_YEAST      -------------DNTFNLAIDIGGTLAKVVF------SPIHSNRLMFYTIETEKIDKFMELLHSIIKEH
PANK2_ARATH     ------ILLPNQSDDISHLALDIGGSLIKLLYFSRHEDYSNDGGRLHFVKFETHKINECLDFIHS-KQLH
PANK4_HUMAN     ----KSITLPRNLENAKRFAIDIGGSLTKLAYYSTKVRSFDHSGRLHFIKFENTYIEACLDFIKDLVNTE
PANK4_MACFA     ----KSITLPRNLENAKRFAIDIGGSLTKLAYYSTKVRSFDHSGRLHFVKFENTYIEACLDFIKDLVNTE
PANK4_PONAB     ----KSITLPRNLENAKRFAIDIGGSLTKLAYYSTKVRSFDHSGRLHFIKFENTYIEACLDFIKDLVNTE
PANK4_RAT       ----KSITLPRNLENAKRFAIDIGGSLTKLAYYSTHPGKDAEQARLHFIKFENTYMEACLDFIRDLVNTE
PANK4_MOUSE     ----KSITLPRNLENAKRFAIDIGGSLTKLAYYSTVQHKVAKTARLHFIKFENTYMEACLDFIRDLVNTE
PANK1_ARATH     ---------------ISHLALDIGGTLIKLVYFSANNGCSVVKGRLCFAKFETRKIDDCLEFIRFNILHH
PANK3_BOVIN     -------------------------------------------GNLHFIRFPTQDLPTFIQMGRD--KNF
PANK1_HUMAN     --------------------MDIGGTLVKLVYFEPKLTSNTAYGKTGIVHLELKNLTMCLHFIRFIQMGS
PANK3_HUMAN     -------------------------------------------GNLHFIRFPTQDLPTFIQMGRD-----
PANK3_MOUSE     -------------------------------------------GNLHFIRFPTQDLPTFIQMGRD--KNF
PANK1_MOUSE     --------------------MDIGGTLVKLVYFEPKTSNTAYGGNLHFIRFPTCAMHLFIQMGSE--KNF
PANK2_HUMAN     --------------------LDIGGTLVKLVYFEPKLTSNVAYGSTGIRDVHLELKDLTLDMPAFIQMGR
COAW_BACCZ      ----------------STIGIDAGGTLTKIAYLNEKK-------KLTFEKFYSNEQDKIIDWLK--KQTS
COAW_BACC0      ----------------STIGIDAGGTLTKIAYLNEKK-------KLTFEKFYSNEQDKIIDWLK--KQTS
COAW_BACHK      ----------------STIGIDAGGTLTKIAYLNEKK-------KLTFEKFYSNEQDKIIDWLKKQISIK
COAW_BACC1      ----------------STIGIDAGGTLTKIAYLNEKM-------QLAFEKFYSNEQNKIIDWLKQ-----
COAW_BACAN      ----------------STIGIDAGGTLTKIAYLNKKM-------QLAFEKVYSNEQNKIIDWLK------
COAW_BACCR      ------------------IGIDAGGTLTKIAYFNKKK-------LLTFEKFYSHEQHKIIDWIK------
COAW_BACC4      ------------------IGIDAGGTLTKIAYFNKKK-------LLTFEKFYSHEQHKIIDWIK------
COAW_BACC2      ------------------IGIDAGGTLTKIAYFNEKR-------LLTFEKFYSHEQHKIIDWIK------
COAW_OCEIH      ---------------MKRIGIDAGGSLVKVAY--------EEHGKMHLKTYSSHKMEEVIQWLKTLS---


                         +         .         .         .         .         *         .:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
PANK_SCHPO      VK--NCNKKKITLIATGGGAYKFYDRMSKQLDIKVIREDEMECLIMGLNYFVSCIPREVFVLDDTCELTF
PANK_YEAST      ---NNGCYRMTHIIATGGGAFKFYDLLYENFPQGISRFEEMEGLIHGLDFFIHEIPDEVFTYNDQDGERI
PANK2_ARATH     RRSSKTLPGTGVIKVTGGGAFKFADLFKERLGVSIEKEDEMHCLVSGANFLLKAIRHEAFTHME-GEKEF
PANK4_HUMAN     TKV---------IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF
PANK4_MACFA     TKV---------IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF
PANK4_PONAB     TKV---------IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQKDSDPEF
PANK4_RAT       TKV---------IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFMYQKDSDPEF
PANK4_MOUSE     TKV---------IQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFMYQKDSDPEF
PANK1_ARATH     QQPNGEGHDKLYVKATGGGAFKFADLFKEKLGILFDKEDEMCSLVGGVNFLLKTVPREAFTYLDGQKKFV
PANK3_BOVIN     STLH------TVLCATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNECYYFANASEPER
PANK1_HUMAN     EKNFSSLHTTLC--ATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNECYYFENPTNPEL
PANK3_HUMAN     -KNFSTLQTVLC--ATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNECYYFANASEPER
PANK3_MOUSE     STLQ------TVLSATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNECYYFANASEPER
PANK1_MOUSE     SSLHTT----LC--ATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNECYYFENPTNPEL
PANK2_HUMAN     DKNFSSLHTVFC--ATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGI-LYIDSVGSQCYYFENPADSEK
COAW_BACCZ      IK-------QICI--TGGKAKQLQQLLSDSY--KIVELNEFEATLVGVRYILKE----------------
COAW_BACC0      IK-------QICI--TGGKAKQLQQLLSDSY--KIVELNEFEATLVGVRYILKE----------------
COAW_BACHK      Q---------ICI--TGGKAKQLQQLLSDSY--KIVELNEFEATLVGVRYILKE----------------
COAW_BACC1      ----NTGKKQICI--TGGKAKQLQQLLSNSY--KIVELNEFEATLIGVRYILKE----------------
COAW_BACAN      ---NQTGIKQICI--TGGKAKQLQQLLSASY--KIVELNEFEATLVGVRYILKK----------------
COAW_BACCR      ---NNNGIKQICIT---GGKSKLLQQLLTG-SYKIIELSEFEATLAGVQFILKEEQHTINNF--------
COAW_BACC4      ---NNNGIKQICIT---GGKSKLLQQLLTG-SYKIIELSEFEATLAGVQFILKEEQHTINNF--------
COAW_BACC2      ---NNNGIKQICIT---GGKSKLLQQLLTG-SYKIIELNEFEATLAGVQYILKEEKHAIRNF--------
COAW_OCEIH      ---------PYASFHITGGRSR-------ELNLEGYR--------------VYTIPEFKAIMEGTSYLLH


                         .         .         .         +         .         .         .:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXXXXXXMSLLTGARTFDEMLAMAELGDNSG
PANK_SCHPO      QNHLNCYYPHMLVNIGSGVSILKVTGPSQFERIXXXXXXXXXXXXXXXXXXPANSFDEMLELSKGGDNTS
PANK_YEAST      IPTSSGIYPYLLVNIGSGVSILKVTEPNNFSRVXXXXXXXXXXXXXXXXXXXAQTYDQMLDWAQEGDNSS
PANK2_ARATH     VQIDPDLYPYLLVNVGSGVSIIKVDGEGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQKGDNSA
PANK4_HUMAN     RTNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVXXXXXXXXXXXXXXALLTKTKKFDELLHLASRGQHSN
PANK4_MACFA     RTNHPHIFPYLLVNIGSGVSIVKVETEDRFEWVXXXXXXXXXXXXXXALLTKTKKFDELLHLASRGQHSN
PANK4_PONAB     RTNHPHIFPYLLVNIGSGVSIVKVETGDRFEWVXXXXXXXXXXXXXXALLTKTKKFDELLHLASRGQHSN
PANK4_RAT       RTNHPNIFPYLLVNIGSGVSIVKVETEDRFEWXXXXXXXXXTFWGLGALLTKTKKFDELLQLASRGRHAN
PANK4_MOUSE     RTNHPNIFPYLLVNIGSGVSIVKVETEDRFEWXXXXXXXXXTFWGLGALLTKTKKFDELLQLASRGRHAN
PANK1_ARATH     EIDHNDLYPYLLVNIGSGVSMIKVDGDGKYERIXXXXXXXXXXXXXXXXXXXXXXFDELLELSHHGNNRV
PANK3_BOVIN     CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
PANK1_HUMAN     CQKKPNPYPMLLVNMGSGVSILAVYSKDNYKRVXXXXXXXXXXXXXXXXXXXXXXXXXALEMAAKGDSTN
PANK3_HUMAN     CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
PANK3_MOUSE     CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
PANK1_MOUSE     CQKKPNPYPMLLVNMGSGVSILAVYSKDNYKRVXXXXXXXXXXXXXXXXXXXXXXXXXALDMAAKGDSTN
PANK2_HUMAN     CQKLPNPYPLLLVNIGSGVSILAVYSKDNYKRVXXXXXXXXXXXXXXXXXXXXXXXEEALEMASRGDSTK
COAW_BACCZ      --EKYDINNFVLTNIGTGTSIHYIYNDR-YIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKG
COAW_BACC0      --EKYDINNFVLTNIGTGTSIHYIYNDR-YIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKD
COAW_BACHK      --EKYDINNFVLTNIGTGTSIHYIYNDR-YIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKD
COAW_BACC1      --EKYDINNFILTNIGTGTSIHYVYNDQ-YIRAXXXXXXXXXIMGLSKLLTNLEHFEDVIPLTKVGSRKE
COAW_BACAN      --EKYDINNFVLTNIGTGTSIHYIYNDQ-YIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKE
COAW_BACCR      ----------ILTNIGTGTSIHYVYN-EQYIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKE
COAW_BACC4      ----------ILTNIGTGTSIHYVYN-EQYIRAXXXXXXXXXIMGLSKLLTNIDHFEDIIPLTKVGSRKE
COAW_BACC2      ----------ILTNIGTGTSIHYVYN-EQYIRAXXXXXXXXXIMGLSKLLTNIDHFEDVIPLTKVGSRKE
COAW_OCEIH      QERKLPKSDYLLVNIGTGTSIFYNE-----NRIAXXXXXXXXXXXXXXXXXKESSYTQLIQMAKQGDRTK


                         .         *         .         .         .         .         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGXXXXXXXXXXXXRDVSQFRREDISRSL
PANK_SCHPO      VDMLVGDIYGKDYERFGLKSTTIASSFGKVFRERKPLE---------------------EFAPQDISRSL
PANK_YEAST      VDMLVGDIYGTDYNKIGLKSSAIASSFGKVFQNRMTSNKSLENNENKLYSSHESIENGQMFKNPDICKSL
PANK2_ARATH     IDMLVGDIYGMDYSKIGLSASTIASSFGKAISENK---------------------ELDDYRPEDISLSL
PANK4_HUMAN     VDMLVRDVYGGAHQTLGLSGNLIASSFGKSATADQ------------------------EFSKEDMAKSL
PANK4_MACFA     VDMLVRDVYGGAHQTLGLSGNLIASSFGKSATADQ------------------------EFSKEDMAKSL
PANK4_PONAB     VDTLVRDVYGGAHQTLGLSGNLIASSFGKSATADQ------------------------EFSKEDMAKSL
PANK4_RAT       VDMLVQDIYGGAHQTLGLSGNLIASSFGKSATADR------------------------EFSKEDMAKSL
PANK4_MOUSE     VDMLVQDIYGGAHQTLGLSGNLIASSFGKSATADR------------------------EFSKEDMAKSL
PANK1_ARATH     IDMLVGDIYGTDYSKIGLSSTAIASSFGKAIS---------------------DGKELEDYQPEDVARSL
PANK3_BOVIN     ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
PANK1_HUMAN     VDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEK--------------------RD--SISKEDLARAT
PANK3_HUMAN     ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
PANK3_MOUSE     ADRLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRETVS----------------------KEDLARAT
PANK1_MOUSE     VDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRESIS----------------------KEDLARAT
PANK2_HUMAN     VDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVS----------------------KEDLARAT
COAW_BACCZ      LDITVGDIYGGILSPI--DNSLTASNFGKAATIE------------------------SNYNNSDILATV
COAW_BACC0      LDITVGDIYGGILSPI--DNSLTASNFGKAATIE------------------------SNYNNSDILATV
COAW_BACHK      LDITVGDIYGGILSPI--DNSLTASNFGKAATIE------------------------SNYNNSDILATV
COAW_BACC1      LDITVGDIYGGILSPI--DNSLTASNFGKAATIE------------------------SNYNSSDILATV
COAW_BACAN      LDITVGDIYGGILSPI--DNSLTASNFGKAAITD------------------------SNYNSSDILATI
COAW_BACCR      LDITVGDIYGGILSPI--DNNLTASNFGKAAITE------------------------SNNSSSDILATV
COAW_BACC4      LDITVGDIYGGILSPI--DNNLTASNFGKAAITE------------------------SNNSSSDILATV
COAW_BACC2      LDITVGDIYGGILSPI--DNNLTASNFGKAAITE------------------------SNNSSSDILATV
COAW_OCEIH      SDLMVRDIYKDSTSPI--DETLTAANFGKV------------------------GLDPSN-SKEDQMAAL


                         .         .         .         .         *         .         .:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
PANK_SCHPO      LLAISNNIGQIAYLHAQKHNVQNIYFGGSFIRNHVQTMHTLTYAIQYWSNHTMNAYFLRHEGYLGVFGAF
PANK_YEAST      LFAISNNIGQIAYLQAKINNIQNIYFGGSYTRGHLTTMNTLSYAINFWSQGSKQAFFLKHEGYLGAMGAF
PANK2_ARATH     LRMISYNIGQISYLNAXXXXXXXXXXXXXXXXXHAYTMDTISFAVHFWSKGEMQAMFLRHEGFLGALGAF
PANK4_HUMAN     LHMISNDIGQLACLHARLHSLDRVYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF
PANK4_MACFA     LHMISNDIGQLACLHARLHSLDRVYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF
PANK4_PONAB     LHMISNDIGQLACLHARPHSLDRVYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF
PANK4_RAT       LHMISNDIGQLACLYAKLHGLDRVYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF
PANK4_MOUSE     LHMISNDIGQLACLYAKLHGLDRVYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF
PANK1_ARATH     LRMISNNIGQIAYLNAXXXXXXXXXXXXXXXXXXEYTMDTISVAVHFWSRGEAKAMFLRHEGFLGALGAF
PANK3_BOVIN     LVTITNNIGSIARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
PANK1_HUMAN     LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGAL
PANK3_HUMAN     LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
PANK3_MOUSE     LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
PANK1_MOUSE     LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGAL
PANK2_HUMAN     LITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAVGAL
COAW_BACCZ      QGLVGEVVTALSLQFAETKNIDHIIYIGSTLCNNIHLQNIISSYTKYQN---KTPIFLRDGGNSGAIGAL
COAW_BACC0      QGLVGEVVTALSLQFAETKNIGHIIYIGSTLCNNIHLQNIISSYTKYQN---KTPIFLRDGGNSGAIGAL
COAW_BACHK      QGLVGEVVTALSLQFAETKNIDHIIYIGSTLCNNIHLQNIISSYTKYQN---KTPIFLRDGGNSGAIGAL
COAW_BACC1      QGLVGEVVTALSLQFAETKNIDHIIYIGSTLCNNIHLQNIISSYTKYQN---KIPIFLQDGGNSGAIGAL
COAW_BACAN      QGLVGEVVTALSLQFAETKNIDHIIYIGSTLCNNIHLQNIISSYTKYQN---KTPIFLRDGGNSGAIGAL
COAW_BACCR      QGLVGEVVTALSLQFAETKNIEHIIYIGSTLCNNVQLQHIISSYTEYQN---KTPIFLQDGGNSGAIGAL
COAW_BACC4      QGLVGEVVTALSLQFAETKNIEHIIYIGSTLCNNVQLQHIISSYTEYQN---KTPIFLQDGGNSGAIGAL
COAW_BACC2      QGLVGEVVTALSLQFAETKNIEHIIYIGSTLCNNVQLQHIISSYTEYQN---KTPIFLQDGGNSGAIGAL
COAW_OCEIH      IQLIGETILLISHGAAQSVKTSQIVFIGGTLTNNQPLQRVF---LHFQEQMNYTATFLNNGGHAGAIGAM


                         .         .         +         .         .         .         .:490
query           LKRQPQDWGRRRSIENTAATxxxxxxxxxxxxxxxxxxxxxx
PANK_SCHPO      MK----------------------------------------
PANK_YEAST      L-----------------------------------------
PANK2_ARATH     M-----------------------------------------
PANK4_HUMAN     LKGAEQD-----------------------------------
PANK4_MACFA     LKGAEQD-----------------------------------
PANK4_PONAB     LKGAEQD-----------------------------------
PANK4_RAT       LKGAEQDWG-----ENYAAS----------------------
PANK4_MOUSE     LKGAEQDWG-----ENYAAS----------------------
PANK1_ARATH     TSYNDQ------------------------------------
PANK3_BOVIN     L-----------------------------------------
PANK1_HUMAN     LE----------------------------------------
PANK3_HUMAN     L-----------------------------------------
PANK3_MOUSE     L-----------------------------------------
PANK1_MOUSE     LE----------------------------------------
PANK2_HUMAN     LE----------------------------------------
COAW_BACCZ      L-----------------------------------------
COAW_BACC0      L-----------------------------------------
COAW_BACHK      L-----------------------------------------
COAW_BACC1      L-----------------------------------------
COAW_BACAN      L-----------------------------------------
COAW_BACCR      L-----------------------------------------
COAW_BACC4      L-----------------------------------------
COAW_BACC2      L-----------------------------------------
COAW_OCEIH      L-----------------------------------------