[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00341

[Show Plain Result]


## Summary of Sequence Search
    1::460
   38::319     1e-29  31%  324 aa  GPI2_SCHPO RecName: Full=Phosphatidylinositol
   63::115     3e-28  46%  345 aa  PIGC_DICDI RecName: Full=Putative phosphatidylinositol
   13::287     5e-26  35%  297 aa  PIGC_HUMAN RecName: Full=Phosphatidylinositol
   13::287     2e-24  30%  297 aa  PIGC_RAT RecName: Full=Phosphatidylinositol
   13::287     9e-24  29%  297 aa  PIGC_MOUSE RecName: Full=Phosphatidylinositol
   13::287     2e-22  29%  297 aa  PIGC_BOVIN RecName: Full=Phosphatidylinositol
    6::22      1e-06  34%  280 aa  GPI2_YEAST RecName: Full=Phosphatidylinositol
    1::460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GPI2_SCHPO      ----------------------------------------------------------------------
PIGC_DICDI      ----------------------------------------------------------------------
PIGC_HUMAN      ----------------------------------------------------------------------
PIGC_RAT        ----------------------------------------------------------------------
PIGC_MOUSE      ----------------------------------------------------------------------
PIGC_BOVIN      ----------------------------------------------------------------------
GPI2_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQWKKLLWVKQSYP
GPI2_SCHPO      ----------------------------------------------------------WKKVLWRKQDYP
PIGC_DICDI      ---------------------------------------------------------KWKKNLYEKQPYS
PIGC_HUMAN      ---------------------------------------------------------KWQKVLYERQPFP
PIGC_RAT        ---------------------------------------------------------KWQKVLYERQPFP
PIGC_MOUSE      ---------------------------------------------------------KWQKVLYERQPFP
PIGC_BOVIN      ---------------------------------------------------------RWQKVLYERQPFP
GPI2_YEAST      ----------------------------------------------------------WKRLLWLKQEYP


                         +         .         .         .         .         *         .:210
query           DNYTDTETFLDHLQRNPRLRPYDFWPLVADFTVIVQHSSVGGQLGDPMYDIXXXXXXXXXXXXXXXIRAI
GPI2_SCHPO      DNFID-ESFLNGLQRNVNIQVTDFWSLVADSLPVSQHLXXXXXXXXXXXXXYRNQLSCALVGFVSNVSAV
PIGC_DICDI      DNYTD-ETFLIGLVQNANFIKYDFWTVVLDFTVSQQITSV------------------------------
PIGC_HUMAN      DNYVDRR-FLEELRKNIHARKYQYWAVVFESSVIQQLCSV-------------------------CVFVV
PIGC_RAT        DNYVD-QRFLEELRKNIYARKYQYWAVVFESSVVIQ------QLCSVCVFVVIWWYMDEGLLAPQWL---
PIGC_MOUSE      DNYVD-QRFLEELRKNIYARKYQYWAVVFESSVVIQ------QLCSVCVFVVIWWYMDEGLLAPQWL---
PIGC_BOVIN      DNYVDRR-FLEELRKNIYARKYQYWAVVFESSVVIQ------QLCSVCVFVVIWWYMDEGLLAPQWL---
GPI2_YEAST      DNYTD-----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAWYGSAIQQTTAQAPALCPVPQETTDKKSLRTWAWAISRFIQYRSLPRRQTKSALLIFCALQGLSPIXX
GPI2_SCHPO      AAFI----------------------------LWDFVLRKPCNNRTFPNYMVKSCILIVLTLAGLSPILM
PIGC_DICDI      -------------------------------------------------------ILLFGTVYGLSPVLR
PIGC_HUMAN      IWWYGTGLASSLIGYVLFDLIDGGEGRKKSGQT-RWA-------------DLKSALVFITFTYGFSPVLK
PIGC_RAT        ---FGTGLASSLVGYVLFDLIDGGDGRKKSGRT-RWA-------------DLKSTLVFITFTYGFSPVLK
PIGC_MOUSE      ---FGTGLASSLVGYVLFDLIDGGDGRKKSGRT-RWA-------------DLKSTLVFITFTYGFSPVLK
PIGC_BOVIN      ---FGTGLASSLIGYVLFDFIDGGEGRKKSGRT-RWA-------------DLKSALVFITFTYGFSPVLK
GPI2_YEAST      ----------------------------------------------------KSSLIITFAMLTLSPVLK


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDSIWAMSCWLMIINVFFFDYGSGTKENQNLSXXXXXXXXXXKFPASLSTNAALMASTVLASR
GPI2_SCHPO      SLTKSTSPDSVWAIAVWLFLANVFFHEYTTET------------IRPHVRXXXXXXXXXXXXXXXXXXXX
PIGC_DICDI      TLTNSFSDDTIWALTFILLLAHLFFHDYGYTNNESQ-------------KFSAPVSLNAAIFASVLLGSR
PIGC_HUMAN      TLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAI----------------VSSTLSLNMAIFASVCLASR
PIGC_RAT        TLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAI----------------VSSTLSLNMAIFASVCLASR
PIGC_MOUSE      TLTESVSTDTIYAMAVFMLLGHLIFFDYGANAAI----------------VSSTLSLNMAIFASVCLASR
PIGC_BOVIN      TLTESVSTDTIYAMAVFMLLGHLIFFDYGANAAI----------------VSSTLSLNMAIFASVCLASR
GPI2_YEAST      SLSKTTASDSIWTLSFWLTLWYIFVI---SSTKSKDK--------------PSNLSTNIXXXXXXXXXXX


                         .         .         .         .         *         .         .:420
query           LKSTTHVFSLTLFSIEVFGLFPVFRRHLRAISWRGHVLLTVSLVIAAGAAVGVTLKGGYKGMILGILIGA
GPI2_SCHPO      XEKSINVFFFILFAVHWFALFPIFRKYIHVFSFYADMLMTLVLIISAYIALNAV------ASXXXXXXXX
PIGC_DICDI      LPSNIHVFVLISYAIETFALFPIFRHHLKRHSMELHVGLTVILCVTCS-----XXXXXXXXXXXXIYIGI
PIGC_HUMAN      LPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVT---LLFAFSAVGGLLSISAVGAVLFALLLM
PIGC_RAT        LPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTXXXXXXXXXXXXXI--SGVGAILFALLLFS
PIGC_MOUSE      LPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTXXXXXXXXXXXXXISAVG--AILFALLLFS
PIGC_BOVIN      LPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTXXXXXXXXXXXXXI-------SAVGXXXXX
GPI2_YEAST      XXTTIDVFCFLLICIQLNIILPTY------LSVTNKVVPIISNIIVY-SFLNVAL--GWIYMLLIFFASV


                         .         .         +         .         .         .         .:490
query           PSTALAMGGCSWWLIRLQKYKNVVAGPWDQAKPILxxxxx
GPI2_SCHPO      XXXXXXXXXCPIWFIKLQRFKNEIHGPWDIALPKL-----
PIGC_DICDI      IGTITFV--CPLWLIFIQKYKNEINGPWDEASVI------
PIGC_HUMAN      SISCL----CPFYLIRLQLFKENIHGPWDEAE--------
PIGC_RAT        ISCL-----CPYYLIHLQLFKENIHGPWDEAE--------
PIGC_MOUSE      ISCL-----CPYYLIHLQLFKENIHGPWDEAE--------
PIGC_BOVIN      XXXXXXXXXXPFYLIRLQLFKENIHGPWDEAE--------
GPI2_YEAST      FYITVLPKWFIYWKINYHKRDNDLLSTWDARTPIL-----