[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00357

[Show Plain Result]


## Summary of Sequence Search
    1::755
   33::206     4e-23  29%  581 aa  YHMA_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   36::574     3e-22  27%  586 aa  HOL1_YEAST RecName: Full=Protein HOL1;
   82::282     9e-21  30%  541 aa  YN22_SCHPO RecName: Full=Uncharacterized transporter C530.02;
   86::531     1e-19  30%  539 aa  YHA8_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   91::288     1e-19  29%  547 aa  YCT4_SCHPO RecName: Full=Uncharacterized transporter C794.04c;
   97::630     5e-19  22%  689 aa  YBP3_YEAST RecName: Full=Uncharacterized transporter YBR043C;
   99::471     1e-18  26%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
  169::575     2e-17  25%  622 aa  TPO3_YEAST RecName: Full=Polyamine transporter 3;
  101::298     4e-17  24%  564 aa  BMRP_CANAL RecName: Full=Benomyl/methotrexate resistance protein;
  140::566     6e-17  25%  614 aa  TPO2_YEAST RecName: Full=Polyamine transporter 2;
   35::479     8e-17  27%  491 aa  YJA1_SCHPO RecName: Full=Uncharacterized transporter C1529.01;
   85::269     2e-16  28%  659 aa  TPO4_YEAST RecName: Full=Polyamine transporter 4;
   32::223     4e-16  28%  485 aa  YI45_SCHPO RecName: Full=Uncharacterized transporter C1348.05;
   93::490     4e-16  28%  548 aa  FLR1_YEAST RecName: Full=Fluconazole resistance protein 1;
   32::223     6e-16  28%  485 aa  YLZ2_SCHPO RecName: Full=Uncharacterized transporter
   85::286     5e-15  23%  552 aa  CYHR_CANMA RecName: Full=Cycloheximide resistance protein;
  130::319     7e-15  23%  580 aa  YN41_SCHPO RecName: Full=Uncharacterized transporter C36.01c;
   29::220     1e-14  26%  495 aa  YKN1_SCHPO RecName: Full=Uncharacterized transporter B1A11.01;
   30::481     1e-14  25%  498 aa  YHS6_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   58::529     1e-14  26%  531 aa  MFS1_SCHPO RecName: Full=Transporter mfs1;
   66::250     3e-14  26%  516 aa  YN2F_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   79::248     4e-14  25%  563 aa  YIM0_YEAST RecName: Full=Uncharacterized transporter YIL120W;
  127::316     3e-13  21%  577 aa  YN42_SCHPO RecName: Full=Uncharacterized transporter C36.02c;
   89::530     9e-13  24%  538 aa  YN43_SCHPO RecName: Full=Uncharacterized transporter C36.03c;
   58::529     2e-12  27%  531 aa  CAF5_SCHPO RecName: Full=Caffeine resistance protein 5;
  100::252     3e-12  27%  514 aa  YHK8_YEAST RecName: Full=Uncharacterized transporter YHR048W;
  108::507     3e-12  23%  526 aa  BSU1_SCHPO RecName: Full=Vitamin B6 transporter bsu1;AltName:
   71::240     6e-12  24%  542 aa  YIM1_YEAST RecName: Full=Uncharacterized transporter YIL121W;
  126::567     1e-11  25%  576 aa  YQO5_SCHPO RecName: Full=Uncharacterized transporter C569.05c;
   72::241     1e-11  25%  525 aa  YQEH_SCHPO RecName: Full=Uncharacterized transporter C576.17c;
  137::521     1e-11  25%  572 aa  YB30_YEAST RecName: Full=Uncharacterized transporter YBR180W;
   60::192     2e-10  26%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
   31::184     2e-10  24%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
   80::265     2e-10  21%  537 aa  YCUD_SCHPO RecName: Full=Uncharacterized transporter C965.13;
   11::187     4e-10  20%  398 aa  BCR_HAEIN RecName: Full=Bicyclomycin resistance protein homolog;
   91::540     5e-10  24%  546 aa  YAO5_SCHPO RecName: Full=Uncharacterized transporter C11D3.05;
   77::187     7e-10  31%  471 aa  LMRB_LISMO RecName: Full=Lincomycin resistance protein lmrB;
   77::187     7e-10  31%  471 aa  LMRB_LISIN RecName: Full=Lincomycin resistance protein lmrB;
   29::191     9e-10  22%  410 aa  MDTM_ECOLI RecName: Full=Multidrug resistance protein mdtM;
   87::228     2e-09  32%  487 aa  S22FL_XENLA RecName: Full=Solute carrier family 22 member 15-like;
  131::327     2e-09  25%  567 aa  OCTL_DROME RecName: Full=Organic cation transporter-like protein;
   29::181     2e-09  24%  391 aa  MDTL_ECOL6 RecName: Full=Multidrug resistance protein mdtL;
   29::181     2e-09  24%  391 aa  MDTL_ECO81 RecName: Full=Multidrug resistance protein mdtL;
   29::191     3e-09  21%  410 aa  MDTM_ECO57 RecName: Full=Multidrug resistance protein mdtM;
   29::181     3e-09  24%  391 aa  MDTL_SHIDS RecName: Full=Multidrug resistance protein mdtL;
   29::181     3e-09  24%  391 aa  MDTL_ECO5E RecName: Full=Multidrug resistance protein mdtL;
   29::181     3e-09  24%  391 aa  MDTL_ECO57 RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_SHISS RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_SHIFL RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_SHIBS RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_SHIB3 RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECOSE RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECOLI RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECOLC RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECOHS RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECODH RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECOBW RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECO8A RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECO55 RecName: Full=Multidrug resistance protein mdtL;
   29::181     8e-09  23%  391 aa  MDTL_ECO24 RecName: Full=Multidrug resistance protein mdtL;
   35::197     8e-09  21%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   35::197     8e-09  21%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   27::185     1e-08  22%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoD;
   82::249     1e-08  26%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   82::249     1e-08  25%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
   29::181     1e-08  23%  391 aa  MDTL_ESCF3 RecName: Full=Multidrug resistance protein mdtL;
   29::181     1e-08  23%  391 aa  MDTL_ECOSM RecName: Full=Multidrug resistance protein mdtL;
   29::181     1e-08  23%  391 aa  MDTL_ECOLU RecName: Full=Multidrug resistance protein mdtL;
   29::181     1e-08  23%  391 aa  MDTL_ECOL5 RecName: Full=Multidrug resistance protein mdtL;
   29::181     1e-08  23%  391 aa  MDTL_ECO27 RecName: Full=Multidrug resistance protein mdtL;
   29::181     2e-08  23%  391 aa  MDTL_ECOUT RecName: Full=Multidrug resistance protein mdtL;
   29::181     2e-08  23%  391 aa  MDTL_ECOK1 RecName: Full=Multidrug resistance protein mdtL;
   29::181     2e-08  23%  391 aa  MDTL_ECO7I RecName: Full=Multidrug resistance protein mdtL;
   29::181     2e-08  23%  391 aa  MDTL_ECO45 RecName: Full=Multidrug resistance protein mdtL;
   32::172     3e-08  24%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   66::181     3e-08  26%  391 aa  MDTL_SHIF8 RecName: Full=Multidrug resistance protein mdtL;
   19::180     4e-08  24%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
   28::193     6e-08  20%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
   87::207     8e-08  33%  487 aa  S22FL_XENTR RecName: Full=Solute carrier family 22 member 15-like;
  145::283     1e-07  24%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
   20::189     1e-07  27%  479 aa  LMRB_BACSU RecName: Full=Lincomycin resistance protein lmrB;
   45::134     1e-07  29%  531 aa  GHT2_SCHPO RecName: Full=High-affinity glucose transporter
   15::192     2e-07  23%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
  136::274     2e-07  23%  551 aa  S22A6_RAT RecName: Full=Solute carrier family 22 member 6;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALTY RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALTI RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALSV RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALPK RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALPC RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALPB RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALPA RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALNS RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALHS RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALG2 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALEP RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALDC RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALCH RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_SALAR RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  21%  496 aa  NANT_ESCF3 RecName: Full=Putative sialic acid transporter;AltName:
   51::203     2e-07  20%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
   14::190     2e-07  25%  496 aa  NANT_ENTS8 RecName: Full=Putative sialic acid transporter;AltName:
   32::194     2e-07  20%  413 aa  MDTM_SALTY RecName: Full=Multidrug resistance protein mdtM;
   32::194     2e-07  20%  413 aa  MDTM_SALTI RecName: Full=Multidrug resistance protein mdtM;
   41::151     2e-07  26%  557 aa  GHT1_SCHPO RecName: Full=High-affinity glucose transporter
   44::185     3e-07  19%  538 aa  TCMA_STRGA RecName: Full=Tetracenomycin C resistance and export
   51::203     3e-07  20%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   51::203     3e-07  20%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
   29::176     3e-07  22%  395 aa  MDTL_SALPC RecName: Full=Multidrug resistance protein mdtL;
   29::176     3e-07  22%  395 aa  MDTL_SALEP RecName: Full=Multidrug resistance protein mdtL;
   29::176     3e-07  22%  395 aa  MDTL_SALDC RecName: Full=Multidrug resistance protein mdtL;
   29::176     3e-07  22%  395 aa  MDTL_SALCH RecName: Full=Multidrug resistance protein mdtL;
   25::185     3e-07  20%  404 aa  BCRH_RICBR RecName: Full=Uncharacterized transporter RBE_0856;
   25::215     4e-07  26%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
   14::190     4e-07  21%  496 aa  NANT_SHIFL RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_SHIF8 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_SHIB3 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOSM RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOSE RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOLI RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOLC RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOL5 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOHS RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECODH RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECOBW RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO8A RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO7I RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO5E RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO57 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO55 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO45 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO27 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT_ECO24 RecName: Full=Putative sialic acid transporter;AltName:
   14::190     4e-07  21%  496 aa  NANT1_ECOL6 RecName: Full=Putative sialic acid transporter
   29::176     4e-07  21%  395 aa  MDTL_SALTY RecName: Full=Multidrug resistance protein mdtL;
   29::176     4e-07  21%  395 aa  MDTL_SALPB RecName: Full=Multidrug resistance protein mdtL;
   29::176     4e-07  21%  395 aa  MDTL_SALNS RecName: Full=Multidrug resistance protein mdtL;
   29::176     4e-07  21%  395 aa  MDTL_SALHS RecName: Full=Multidrug resistance protein mdtL;
   29::176     4e-07  21%  395 aa  MDTL_SALA4 RecName: Full=Multidrug resistance protein mdtL;
   80::188     4e-07  21%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
   32::184     5e-07  22%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
    4::186     5e-07  25%  470 aa  MDTD_SALPB RecName: Full=Putative multidrug resistance protein
    4::186     5e-07  25%  470 aa  MDTD_SALHS RecName: Full=Putative multidrug resistance protein
    9::106     5e-07  25%  518 aa  GHT7_SCHPO RecName: Full=Probable high-affinity hexose transporter
   28::201     7e-07  23%  410 aa  Y588_BUCAI RecName: Full=Uncharacterized transporter BU588;
   14::190     7e-07  21%  496 aa  NANT_CITK8 RecName: Full=Putative sialic acid transporter;AltName:
   20::195     7e-07  25%  410 aa  MDFA_ECOLI RecName: Full=Multidrug translocase mdfA;AltName:
   20::195     7e-07  25%  410 aa  MDFA_ECOL6 RecName: Full=Multidrug translocase mdfA;AltName:
   20::195     7e-07  25%  410 aa  MDFA_ECO57 RecName: Full=Multidrug translocase mdfA;AltName:
   48::181     9e-07  23%  543 aa  SGE1_YEAST RecName: Full=Protein SGE1;AltName: Full=Crystal violet
    4::186     9e-07  25%  470 aa  MDTD_SALSV RecName: Full=Putative multidrug resistance protein
   46::185     9e-07  22%  407 aa  BCRH_RICPR RecName: Full=Uncharacterized transporter RP603;
    9::164     1e-06  22%  457 aa  YWTG_BACSU RecName: Full=Putative metabolite transport protein
   12::183     1e-06  20%  511 aa  YUBD_BACSU RecName: Full=Uncharacterized MFS-type transporter yubD;
  131::267     1e-06  29%  548 aa  ORCT_DROME RecName: Full=Organic cation transporter protein;
   14::190     2e-06  22%  496 aa  NANT_SALA4 RecName: Full=Putative sialic acid transporter;AltName:
   52::205     2e-06  20%  475 aa  MMR_STRCO RecName: Full=Methylenomycin A resistance
   29::176     2e-06  20%  395 aa  MDTL_SALSV RecName: Full=Multidrug resistance protein mdtL;
    4::186     2e-06  25%  470 aa  MDTD_SALTY RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALPK RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALPA RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALNS RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALEP RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALDC RecName: Full=Putative multidrug resistance protein
    4::186     2e-06  25%  470 aa  MDTD_SALA4 RecName: Full=Putative multidrug resistance protein
   29::176     2e-06  20%  395 aa  MDTL_SALTI RecName: Full=Multidrug resistance protein mdtL;
   29::176     2e-06  20%  395 aa  MDTL_SALPK RecName: Full=Multidrug resistance protein mdtL;
   29::176     2e-06  20%  395 aa  MDTL_SALPA RecName: Full=Multidrug resistance protein mdtL;
   38::189     3e-06  21%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   70::186     3e-06  28%  457 aa  XYLT_LACBR RecName: Full=D-xylose-proton symporter;AltName:
  136::274     3e-06  24%  551 aa  S22A6_RABIT RecName: Full=Solute carrier family 22 member
   46::185     3e-06  21%  409 aa  BCRH_RICTY RecName: Full=Uncharacterized transporter RT0591;
   36::178     5e-06  21%  403 aa  YVMA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvmA;
  130::268     5e-06  22%  545 aa  S22A6_MOUSE RecName: Full=Solute carrier family 22 member
   34::198     5e-06  23%  508 aa  PLT3_ARATH RecName: Full=Probable polyol transporter 3;
    3::138     5e-06  27%  547 aa  GHT8_SCHPO RecName: Full=Probable high-affinity hexose transporter
   74::231     6e-06  22%  484 aa  YT13_CAEEL RecName: Full=Putative transporter B0252.3;
  142::273     8e-06  25%  552 aa  S226B_XENLA RecName: Full=Solute carrier family 22 member
   29::181     8e-06  18%  395 aa  MDTL_SALAR RecName: Full=Multidrug resistance protein mdtL;
    3::138     8e-06  26%  546 aa  GHT5_SCHPO RecName: Full=High-affinity glucose transporter
   25::165     8e-06  23%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
  132::538     1e-05  23%  586 aa  TPO1_YEAST RecName: Full=Polyamine transporter 1;
    6::186     1e-05  24%  470 aa  MDTD_SALTI RecName: Full=Putative multidrug resistance protein
   27::184     1e-05  20%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
   14::185     1e-05  20%  444 aa  YVKA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvkA;
    6::214     1e-05  23%  417 aa  YNFM_ECOLI RecName: Full=Inner membrane transport protein ynfM;
    3::182     1e-05  24%  389 aa  YDHP_ECOLI RecName: Full=Inner membrane transport protein ydhP;
    3::182     1e-05  24%  389 aa  YDHP_ECO57 RecName: Full=Inner membrane transport protein ydhP;
   76::189     1e-05  22%  454 aa  YAJR_ECOLI RecName: Full=Inner membrane transport protein yajR;
   47::185     1e-05  20%  405 aa  BCRH_RICFE RecName: Full=Uncharacterized transporter RF_0358;
   72::183     2e-05  21%  541 aa  YUSP_BACSU RecName: Full=Uncharacterized MFS-type transporter yusP;
   78::225     2e-05  23%  494 aa  SVOPL_MOUSE RecName: Full=Putative transporter SVOPL;AltName:
    7::185     2e-05  20%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
   84::214     2e-05  18%  413 aa  Y567_BUCAP RecName: Full=Uncharacterized transporter BUsg_567;
   86::158     3e-05  27%  503 aa  XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1;
   78::225     3e-05  24%  492 aa  SVOPL_HUMAN RecName: Full=Putative transporter SVOPL;AltName:
   41::202     3e-05  26%  557 aa  GHT4_SCHPO RecName: Full=High-affinity hexose transporter ght4;    
   45::182     4e-05  26%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
    4::186     4e-05  23%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
    4::186     4e-05  23%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   15::165     4e-05  19%  396 aa  BCR_ECOLI RecName: Full=Bicyclomycin resistance protein;AltName:
   42::178     4e-05  20%  472 aa  ARAE_ECOLI RecName: Full=Arabinose-proton symporter;AltName:
   42::178     4e-05  20%  472 aa  ARAE_ECO57 RecName: Full=Arabinose-proton symporter;AltName:
   29::194     5e-05  21%  493 aa  PLT6_ARATH RecName: Full=Probable polyol transporter 6;
   19::177     5e-05  25%  466 aa  MMR_BACSU RecName: Full=Methylenomycin A resistance
   29::181     5e-05  18%  396 aa  MDTL_VIBPA RecName: Full=Multidrug resistance protein mdtL;
   41::202     5e-05  29%  555 aa  GHT3_SCHPO RecName: Full=High-affinity gluconate transporter
  142::280     7e-05  31%  563 aa  S22A1_BOVIN RecName: Full=Solute carrier family 22 member
   26::181     7e-05  21%  478 aa  MOT2_HUMAN RecName: Full=Monocarboxylate transporter 2;       
   75::230     7e-05  24%  609 aa  ITR2_YEAST RecName: Full=Myo-inositol transporter 2;
   42::178     7e-05  20%  472 aa  ARAE_KLEOX RecName: Full=Arabinose-proton symporter;AltName:
   51::203     9e-05  22%  502 aa  NANT2_ECOL6 RecName: Full=Putative sialic acid transporter
   25::186     9e-05  18%  734 aa  MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1;AltName:
  134::285     1e-04  27%  554 aa  S22A1_HUMAN RecName: Full=Solute carrier family 22 member
    5::154     1e-04  25%  539 aa  PLT5_ARATH RecName: Full=Polyol transporter 5;AltName:
    7::185     1e-04  23%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
   47::184     1e-04  21%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   47::184     1e-04  21%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
  151::286     1e-04  28%  553 aa  S22A2_MOUSE RecName: Full=Solute carrier family 22 member
  148::286     1e-04  30%  556 aa  S22A1_RAT RecName: Full=Solute carrier family 22 member 1;AltName:
    8::186     1e-04  18%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
    8::186     1e-04  18%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
    4::186     2e-04  22%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
   68::188     2e-04  20%  547 aa  GTR1_LEIDO RecName: Full=Membrane transporter D1;
   79::193     2e-04  25%  430 aa  DGOT_ECOLI RecName: Full=D-galactonate transporter;
   79::193     2e-04  25%  430 aa  DGOT_ECOL6 RecName: Full=D-galactonate transporter;
   42::227     3e-04  28%  513 aa  STP7_ARATH RecName: Full=Sugar transport protein 7;AltName:
    4::186     3e-04  22%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
  102::223     3e-04  27%  555 aa  YD387_YEAST RecName: Full=Probable metabolite transport protein
   83::261     3e-04  22%  548 aa  SVOP_XENLA RecName: Full=Synaptic vesicle 2-related protein;       
  108::227     3e-04  27%  514 aa  STP11_ARATH RecName: Full=Sugar transport protein 11;AltName:
  153::287     3e-04  24%  566 aa  S22AG_XENLA RecName: Full=Solute carrier family 22 member
  147::285     3e-04  28%  554 aa  S22A1_RABIT RecName: Full=Solute carrier family 22 member
   74::187     3e-04  21%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
    4::186     3e-04  22%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
    2::184     4e-04  23%  402 aa  YDGK_BACSU RecName: Full=Uncharacterized MFS-type transporter ydgK;
  151::281     4e-04  23%  548 aa  S22A7_PONAB RecName: Full=Solute carrier family 22 member
   56::210     6e-04  22%  582 aa  VBA5_YEAST RecName: Full=Vacuolar basic amino acid transporter 5;
  114::261     6e-04  23%  548 aa  SVOP_PONAB RecName: Full=Synaptic vesicle 2-related protein;       
  114::261     6e-04  23%  548 aa  SVOP_HUMAN RecName: Full=Synaptic vesicle 2-related protein;       
  114::261     6e-04  23%  548 aa  SVOP_BOVIN RecName: Full=Synaptic vesicle 2-related protein;       
  151::281     6e-04  23%  548 aa  S22A7_HUMAN RecName: Full=Solute carrier family 22 member
    5::182     6e-04  21%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
    4::176     6e-04  25%  471 aa  MDTD_CITK8 RecName: Full=Putative multidrug resistance protein
  306::451     7e-04  26%  482 aa  YFIG_BACSU RecName: Full=Putative metabolite transport protein
   30::105     7e-04  20%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
  160::294     7e-04  21%  577 aa  S22AG_HUMAN RecName: Full=Solute carrier family 22 member
  111::243     7e-04  24%  606 aa  ENB1_YEAST RecName: Full=Siderophore iron transporter ENB1;AltName:
   58::193     7e-04  21%  419 aa  CMLA_PSEAE RecName: Full=Chloramphenicol resistance protein;
   32::179     0.001  19%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
   32::179     0.001  19%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
   32::179     0.001  19%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
   32::179     0.001  19%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
  114::201     0.001  32%  531 aa  S22AF_XENLA RecName: Full=Solute carrier family 22 member 15;
  158::286     0.001  27%  555 aa  S22A2_RAT RecName: Full=Solute carrier family 22 member 2;AltName:
  157::285     0.001  26%  554 aa  S22A2_PIG RecName: Full=Solute carrier family 22 member 2;AltName:
  158::286     0.001  26%  555 aa  S22A2_HUMAN RecName: Full=Solute carrier family 22 member
   29::185     0.001  25%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
    1::755

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHMA_SCHPO      ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      ----------------------------------------------------------------------
FLR1_YEAST      ----------------------------------------------------------------------
YLZ2_SCHPO      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      ----------------------------------------------------------------------
YHS6_SCHPO      ----------------------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
CAF5_SCHPO      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      ----------------------------------------------------------------------
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQKRTPDGKIV
YHMA_SCHPO      -----------------------------------------------------------------DGDIV
HOL1_YEAST      -------------------------------------------------------------KKTSSG-VV
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      ------------------------------------------------------------------GENE
YJA1_SCHPO      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      ----------------------------------------------------------------------
FLR1_YEAST      ----------------------------------------------------------------------
YLZ2_SCHPO      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      ----------------------------------------------------------------------
YHS6_SCHPO      ----------------------------------------------------------------PDSDFL
MFS1_SCHPO      -----------------------------------------------------------------EGLII
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
CAF5_SCHPO      -----------------------------------------------------------------EGHII
YHK8_YEAST      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      ----------------------------------------------------------------------
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ---------------------------------------------------------------TVDGAPA
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      -----------------------------------------------------------QDEDEDDGRIV
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ---------------------------------------------------------------TPENRTA
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDPQPEESLNDPLNWPQWRRDLALLSLGFYCMIGGGMTPILAAAFNDVSEEYNVSFQKVALTTGLYMLGL
YHMA_SCHPO      LQPQPSDDPNDPLNWNKFRKNWHLVLICLVSLVTGAIANDAGSAQDQMNAELGISYDAMDNAAGVLFICV
HOL1_YEAST      LIPQPSYSPNDPLNWSSWRKLAHFGLMAFITAFTAATSNDAGAAQDSLNEIYGISYDSMNTGAGVLFLGI
YN22_SCHPO      ------DSIDDPLNWPMWKKWIVVVQISLIAFVVTFGSSVYSSGIGNVSMDFGVSISVSSLGSCVFLVGF
YHA8_SCHPO      --------LNDPENPHNWSRITIVNSLLVVCSAFG--SSVIAGDLEDVSRDLKVGPEVANLSCSLMVVGF
YCT4_SCHPO      ------ESGKDPLNWPMWKKIYTLLVASFIAIVITANSSIFSDGGGIAAQQYHVGATVGDLCSATFLLGF
YBP3_YEAST      ----------DARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLSL
AQR1_YEAST      ----------------KWGMVAILTMCGFWSSLG---SPIYYPALRQLEKQFXXXXXXXXXXXXXYLLFQ
TPO3_YEAST      ----------NPHNWPAWIRYTVLLSILVICVAYG--SACISGGLGTVEKKYHVGMEAAILSVSLMVIGF
BMRP_CANAL      -DDDPE----NPQNWPTLQKAFFIFQISFLTTSVYMGSAVYTPGIEELMHDFGIGRVVATLPLTLFVIGY
TPO2_YEAST      LDPEIEGDPENPHNWPSWVRYTVLLSILVICVAYG--SACISGGLGTVEKKYHVGMEAAILSCSLMVIGF
YJA1_SCHPO      ----------NPKNWIYARKWTQLILVSAFALLGPMASSMVAPCLDQIADRFHINSTEKALILSIYLLVF
TPO4_YEAST      -------------NWSSLKKWYTTMTSAFLCLVVTMGSSLYVSSVPELVERYHVS-QTLALA-GLTFYLL
YI45_SCHPO      ----------NPKTWPKVRNVIVISSMTFLNQYGDS---VFAPSISNIAEQFHASRTLVTLGATLYTLGI
FLR1_YEAST      ----------NPQNWPLLKKSLVVFQIMLLTCVTYMGSSIYTPGQEYIQEEFHVGHVVATLNLSLYVLGY
YLZ2_SCHPO      ----------NPKTWPKVRNVIVISSMTFLNQYGDS---VFAPSISNIAEQFHASRTLVTLGATLYTLGI
CYHR_CANMA      -DDDPE----NPYNWPFAWKAIAAMQIGFLTVSVYMASAIYTPGVEEIMNQFNINSTLATLPLTMFVIGY
YN41_SCHPO      ------------LNWTFWRKMKTTSIYAYASLTIAWGSSVLSPASATLAKKYHIGMTTSLLNVSLFMLGY
YKN1_SCHPO      ----------DPLTWPXXXXXXXXXXXSFMTMLCMYGSSVFMPSIPELCEKFGEPETLVVLGATLYVIGV
YHS6_SCHPO      VTFNGEDDPEKPLNWPV---SIKLLNTALY-----GLTTF-AAQFNSTTNAYPIGHEVAVLPTCLYILGI
MFS1_SCHPO      VTWDGEDDPENPKNWPLWAKLVVTFDVCFLTFAVYMGSAIFTPGIQEIRETMHVGTVPVILGLTLFVEGY
YN2F_SCHPO      ------------VNWPLAKKLRNVAVMGSACLCAGFGSSIFSGAVPEVMVKFHVCRTVALLGISLYVLGF
YIM0_YEAST      ---------------------------GFFSTVAGSIYPVLTI----IERKFNITEELANVTIVVYFIFQ
YN42_SCHPO      ------------VNWPFKRKLKTTCILAYVALCXXXXXXXXXXPAEAITTVFHISLTVSLLTMTVFLLGY
YN43_SCHPO      ------------VNWPTHVKILHVALLAFTTLTASWGSSVFSAAATIFAAKYHIGLTVALLGMSLYVCGF
CAF5_SCHPO      VRWDDANDPENPLNWPLWAKLVVTFDICFLTFAVYVGSAIFTPGISEMQETMHXXXXXXXXXXXXXXXXY
YHK8_YEAST      -----------------------------------------------IIEHFHISHEVSTLGITLYVFGL
BSU1_SCHPO      -----------------------------------------------VMAQFNVSAQVATLCLSMNILGS
YIM1_YEAST      ---------------------------GFFSTIAGAIYPVLSV----IERKFDIDEELXXXXXXXXXXFQ
YQO5_SCHPO      ------------VNWP-FRKKLKITCVYSYVALCSTFSSVFSVPAEAITTIFHISLTVSLLTMTVFLCGY
YQEH_SCHPO      -----------PQNWGWWKKAYIVLSLQMYVF----WTPNFYPGVQDVMELWHLSSQVSLLGQSMFVLGV
YB30_YEAST      -----------------------------------------------LQREYDVSATTINATVSVFMAVF
YEBQ_ECOLI      -----------------------------------------------------------------YQIAI
BMR3_BACSU      ---------------------------------------IVATAMGNIVADLG-SFDKFAWVTASYMVAV
YCUD_SCHPO      -----------PHKWPLWKKLFVATVYTFLEVYVIWSSTACINFFDIYQTNWHCSIQVSYLVQSLFIVGN
BCR_HAEIN       -----------------------ILTLGILSMLPPFGVDMYLPSFLEIAKDLDVSPEQVQHTLTSFAYGM
YAO5_SCHPO      ----PDDPLN-PRNWSHSYKWWXXXXXXXXXXXXXFASSVYSSGIIDIASELHSSIPVSTLGSCTFLVGF
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      -------------------------------------TDLIQPGIINVVRDFNADVSLAPAAVSLYLAGG
S22FL_XENLA     ---------------------------------------------------------KVNLASSLFFAGL
OCTL_DROME      -----------------------------------------------------------ATSDSLFMLGV
MDTL_ECOL6      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO81      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTM_ECO57      -------------------------------------TDLIQPGIINVVRDFNADVSLAPAAVSLYLAGG
MDTL_SHIDS      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO5E      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO57      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_SHISS      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_SHIFL      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_SHIBS      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_SHIB3      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOSE      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOLI      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOLC      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOHS      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECODH      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOBW      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO8A      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO55      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO24      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
GALP_ECOLI      ---------------------------------------VIAGALPFIADEFQITSHTQEWVVSSMMFGA
GALP_ECOL6      ---------------------------------------VIAGALPFIADEFQITSHTQEWVVSSMMFGA
YWOD_BACSU      ---------------------------------------MISLALHSIQHEFHLSFTTVSWLISSFYLAS
YI32_SCHPO      ---------------------LVLPSNRLYIVIPGLMLSIFLAALDQXXXXXXXXXXXXNLDGGSSYSWI
YAN6_SCHPO      ---------------------LVLPSNRMYIVIPGLMLSIFLSALDQXXXXXXXXXXXXNLDGGSSYSWI
MDTL_ESCF3      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOSM      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOLU      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOL5      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO27      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOUT      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECOK1      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO7I      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
MDTL_ECO45      -----------------------------------------------IAADLNASEAQLHIAFSVYXXXX
YHCA_BACSU      ---------------------------------------LLNVAMPHLMTEFGVSATTIQWLTTGYMLVN
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ---------------PIGRRQRIIVLMVFLIMVADGMDITLASLFPPVIRDWGVPVSAVTLVVSLGVVAM
MUCK_ACIAD      --------------------------------VDGADLMLLSYSLNSIKAEFNLSTVEAGMLGSFTLAGM
S22FL_XENTR     ---------------------------------------------------------KVNLASSLFFAGL
YMPB_CAEEL      -------------------------------------------------------FQEFGLT--IFTIGA
LMRB_BACSU      ---------------------ISLLLAGF---IGMFSETALNIALTDLMKELNITAATVQWLTTGYLLVL
GHT2_SCHPO      -----------------------------------------ADRYDPITDQYSLSSARQGLLTGMVNVGS
YFIU_BACSU      ---------------------ISLFTIGFMAALDNG---IISAALTTINESFSVSPSWGSWGITLYTLGL
S22A6_RAT       ------------------------------------------------------------LAQSLYMVGV
NANT_YERPS      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_YERPP      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_YERPG      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_YERPB      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_YERP3      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_SALTY      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALTI      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALSV      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALPK      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALPC      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALPB      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALPA      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALNS      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALHS      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALG2      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALEP      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALDC      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALCH      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_SALAR      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
NANT_ESCF3      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_YERPY      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_ENTS8      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEIQDEFGLTTIQAASLISAAFISR
MDTM_SALTY      -------------------------------------TDLIQPGIINVVRDFNADVSLAPASVSLYLAGG
MDTM_SALTI      -------------------------------------TDLIQPGIINVVRDFNADVSLAPASVSLYLAGG
GHT1_SCHPO      -----------------------------------------ADRYNPVTDTYSYSSARQGLITGMVNVGS
TCMA_STRGA      ---------------------------------------IVAIANPAIQQDLHASLADVQWITNGYLLAL
NANT_YERPE      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
NANT_YERPA      ---------------------------------------LITLVLTDIKQEFGLTLIQATSLISAAFISR
MDTL_SALPC      -----------------------------------------------IAVDLNASESQLHIAFSVYLAGM
MDTL_SALEP      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALDC      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALCH      -----------------------------------------------IAVDLNASESQLHIAFSVYLAGM
BCRH_RICBR      ---------------------------------------IYTSGLPSITEYFNTDGSTTQITSSLYYLGF
PCAK_ACIAD      --------INDPLSRYQWLIAIVCFLIVFVDGIDTAAMGFIAPA---LAQDWGVDRSQLGPVMSAALGGM
NANT_SHIFL      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_SHIF8      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_SHIB3      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOSM      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOSE      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOLI      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOLC      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOL5      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOHS      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECODH      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECOBW      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO8A      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO7I      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO5E      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO57      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO55      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO45      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO27      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT_ECO24      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
NANT1_ECOL6     ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
MDTL_SALTY      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALPB      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALNS      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALHS      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALA4      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ---------------------------------------LLITALPHIMRDFNVDANQAQWLTTSFMLTN
MDTD_SALPB      --------LPDNTRWQLW-----IVALGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALHS      --------LPDNTRWQLW-----IVALGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
GHT7_SCHPO      -----------------------------------------ADRYNQITNSYSYSSSRQGLITGMVNVGS
Y588_BUCAI      ---------------------LALFSGGFYCV--QSILPMFSKQFYLTPAESSLALSAATITMSLGMLFT
NANT_CITK8      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQGEFGLTTVQAASLISAAFISR
MDFA_ECOLI      ---------------------LCLVLYEFSTYIGNDM---IQPGMLAVVEQYQAGIDWVPTSMTAYLAGG
MDFA_ECOL6      ---------------------LCLVLYEFSTYIGNDM---IQPGMLAVVEQYQAGIDWVPTSMTAYLAGG
MDFA_ECO57      ---------------------LCLVLYEFSTYIGNDM---IQPGMLAVVEQYQAGIDWVPTSMTAYLAGG
SGE1_YEAST      ------------------------------------------------------------LVTG-YALSN
MDTD_SALSV      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
BCRH_RICPR      ------------------------------------------------------------MTSTLYFLGF
YWTG_BACSU      --------------------------LYFFGALGGALTGVISGAILFMKKELGLNAFTEGLVVSSLLVGA
YUBD_BACSU      ---------------------LAVLAVGPGLMSNTALSSVQGLVQKTVGTSVFTSVNPILIGNMAFALLV
ORCT_DROME      -----------------------------------------------------------ATSDSLFMLGV
NANT_SALA4      ------------LNRAQWRAFSAAW-LGY--LLDGFDFVLIALVLTEVQSEFGLTTVQAASLISAAFISR
MMR_STRCO       -----------------------------------------------IQESLDTTLTQLTWIVDGYVLTF
MDTL_SALSV      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTD_SALTY      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALPK      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALPA      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALNS      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALEP      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALDC      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTD_SALA4      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
MDTL_SALTI      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALPK      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
MDTL_SALPA      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
YYBF_BACSU      ----------------------------------------------EFTREFHVTPTAASLSLSVTTMLL
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ------------------------------------------------------------LGQSLYMAGV
BCRH_RICTY      ------------------------------------------------------------ITSTLYFLGF
YVMA_BACSU      -----------------------------------------------IKESFHVSTAMVNLSVSVFMIVT
S22A6_MOUSE     ------------------------------------------------------------LAQSLFMVGV
PLT3_ARATH      -------------------------------IIFGYDTGVMSGAQIFIRDDLKINDTQIEVLAGILNLCA
GHT8_SCHPO      -------------------KTLTIVMLVFVSMAGGGITNMFADRYNPVTDTYSYSSARQGLITGMVNVGS
YT13_CAEEL      ------------------------------------------SSFIGVADEFDLTGDASWLTTTFYMVGN
S226B_XENLA     ----------------------------------------------------------------IYMAGV
MDTL_SALAR      -----------------------------------------------IAADLNASEAQLHIAFSVYLAGM
GHT5_SCHPO      -------------------KNLTIVMLVFVSMAGGGITNMFADRYNPVTDSYSYSSARQGLITGMVNVGS
CSBC_BACSU      -------------------------------------TGVISGALLFINNDIPLTTLTEGLVVSMLLLGA
TPO1_YEAST      ---------NDPLNWPMXXXXXXXXXXXXDSIAIAMCSSIFASAVPQICEIYHVIEVVAILGITLFVLGF
MDTD_SALTI      ----------DNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAKSLGESPLHMHMVVVSYVLTV
BAIG_EUBSP      ----------------------------------GGFTAVLGPAF---VADQGIDYNNTTWIXXXXXXXX
YVKA_BACSU      -------------------------------LLGAILVPIIAVALSSISHTYNESIASITWVVTVYLIVM
YNFM_ECOLI      SDTD-KQSISQPNQFPQFMRTLALFSAGLYCV-----QPILPV----LSQEFGLTPANSSISLSISTAML
YDHP_ECOLI      ------------INYPLLALAIGAFGIGTTEFSPMGLLPVIARGVD-------VSIPAAGMLISAYAVGV
YDHP_ECO57      ------------INYPLLALAIGAFGIGTTEFSPMGLLPVIARGVD-------VSIPAAGMLISAYAVGV
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      -------------------------------------------------------------TSTLYFLGF
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     --------------------------------------------------EWQLENWQVAFVTTMVFFGY
MDTD_PECCP      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSMAASLNESPLHMHSVIVSYVLTV
Y567_BUCAP      ---------------------------------------------------------------------M
XYLL1_ARATH     ---------------------------------------------------YDLSSVDVGIITSGSLYGA
SVOPL_HUMAN     --------------------------------------------------EWQLENWQVALVTTMVFFGY
GHT4_SCHPO      -----------------------------------------ADRYNPITNSYSYSAWRQALLTGTVNAGC
Y466_BUCAI      ----------------------------------------------------------IGLSMGIY----
MDTD_ECOL6      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO81      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
BCR_ECOLI       --------------------------LGLLAMLMPLSIDMYLPALPVISAQFGVPAGSTQMTLSTYILGF
ARAE_ECOLI      ---------------------------------------VIAGALPFITDHFVLTSRLQEWVVSSMMLGA
ARAE_ECO57      ---------------------------------------VIAGALPFITDHFVLTSRLQEWVVSSMMLGA
PLT6_ARATH      -------------------------------IIFGYDTGVMSGAMVFIEEDLKTNDVQIEVLTGILNLCA
MMR_BACSU       ---------------------LIVLALGF--LMATLDVTVVNVAMADMKNTLSMSLSGVTWVVDGYILTF
MDTL_VIBPA      -----------------------------------------------IASDLNASESQLHIAFSVYLAGM
GHT3_SCHPO      -----------------------------------------ADRYNPISNSYSYSAWRQALLTGTINAGC
S22A1_BOVIN     ---------------------------------------------------------KVDLFQSCVNLGF
MOT2_HUMAN      ----------------------AFISIGFSYAFPKAVTVF----FKEIQQIFHTTYSEIAWISSIMLAVM
ITR2_YEAST      IKPVNDEDDTSVIITFNQSISPFIITLTFVASISGFMTGYISSALISINRDLDLTYGEKELITAATSLGA
ARAE_KLEOX      ---------------------------------------VIAGALPFITDHFVLSSRLQEWVVSSMMLGA
NANT2_ECOL6     ---------------------------------------LISLVLTEVQHEFGLTTIEAASLISAAFISR
MSSP1_ARATH     ----------------------------------------IAGAMVYINKDLNLPTSVQGLVVAMSLIGA
S22A1_HUMAN     ----------------------------------------IVTEFNLVADSWKLDLFQSCLNAGFFFGSL
PLT5_ARATH      PSPPPVKHVPESVAKPPKRNNYA-----FACAILASMTSILSGAMIYIKRDLKINDLQIGILAGSLNIYS
MDTD_ERWCT      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSMAASLNESPLHMHSVIVSYVLTV
EMRB_ECOLI      -----------------------------------------------------------SLSQGTWVISF
EMRB_ECO57      -----------------------------------------------------------SLSQGTWVISF
S22A2_MOUSE     ------------------------------------------------------------LFQSLVNVGF
S22A1_RAT       ---------------------------------------------------------KVDLFQSCVNLGF
MDTD_YERPY      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPS      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPP      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPN      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPG      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPE      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPB      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERPA      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_YERP3      ------------VRWQLW-----IVAFGFFMQTLD--TTIVNTALPSIAASLGENPLRMQSVIVSYVLTV
MDTD_ESCF3      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ---------------------------GYDIGISGGVTSMLEEFFHTVYEKKKQAHESAAFTSSLYLAGL
MDTD_SHISS      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_SHIFL      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_SHIF8      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTAIPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_SHIBS      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_SHIB3      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOUT      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOSM      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOSE      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOLI      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOLC      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOK1      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOHS      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECODH      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOBW      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO8A      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO7I      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO5E      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO57      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO55      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO45      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO27      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECO24      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------QWK--LSMLT-GLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGM
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------IFMLGV
S22A1_RABIT     ---------------------------------------------------------KVDLFQSCVNLGF
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      --------LPDNTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
MDTD_ECOL5      --------LPDSTRWRLW-----IVAFGFFMQSLD--TTIVNTALPSMAQSLGESPLHMHMVIVSYVLTV
YDGK_BACSU      ------------LHNPTGKERLALFLLGMLAILGPLNIDMYLPSFPEIAKDXXXXXXXXXXXXXXCLVGL
S22A7_PONAB     -----------------------------------------------------------------FFAGV
VBA5_YEAST      ---------------------------------------IVGTIIDVVAEQFGNYSKTGWLVTG-YSLPN
SVOP_PONAB      --------------------------------------------------EWRLPSWQVALLTSVVFVGM
SVOP_HUMAN      --------------------------------------------------EWRLPSWQVALLTSVVFVGM
SVOP_BOVIN      --------------------------------------------------EWRLPSWQVALLTSVVFVGM
S22A7_HUMAN     -----------------------------------------------------------------FFAGV
MDTD_YERE8      ------------------RAQLWIVAFGFFMQIVNTALPSMAASLG----ENPLRMQSVIVS---YVLTV
MDTD_CITK8      --------LPDSTRWQLW-----IVAFGFFMQSLD--TTIVNTALPSMALSLGESPLHMHMVVVSYVLTV
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      -------------------------------------------------DQFHVSTDLSGWMVSAYALGY
S22AG_HUMAN     ----------------------------------------------------------------LFMFGV
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      -----------------------------------------------------------------YLVMI
TCR_STRPN       ---------------------------------------VLNVSLPDIANDFNKPPASTNWVNTAFMLTF
TCR_BACSU       ---------------------------------------VLNVSLPDIANDFNKPPASTNWVNTAFMLTF
TCR_BACST       ---------------------------------------VLNVSLPDIANDFNKPPASTNWVNTAFMLTF
TCR_BACCE       ---------------------------------------VLNVSLPDIANDFNKPPASTNWVNTAFMLTF
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       -------------------------------------------------------------------VGF
S22A2_PIG       -------------------------------------------------------------------VGF
S22A2_HUMAN     -------------------------------------------------------------------VGF
EXUT_BACSU      ----------------------------------------IAAPF--IQDDLTLSATQMGLIFSSFSIGY


                         .         .         .         +         .         .         .:280
query           GIGSVVMSPTAILFGKRPVYIAGATMFIISAVWCALSPTYVSLVIARIFQGIAVSPVECLPSATIAEIFF
YHMA_SCHPO      GYFTYLAMPATFLYGRRCVYLVCLLFGMLGSMWFALVKTTSNSIGNQAFIGISEACAEALTQFSVSEVFF
HOL1_YEAST      GWSTLFLAPFANLYGRKITYIVCTTXXXXXXXXXXXXKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFF
YN22_SCHPO      GFGSLPFAPLSGIYGRFVVYFCTLLMFTLFQIGGGCAQNIWTLVILRFFQGFFGSTPLSNCGGTLSDLFT
YHA8_SCHPO      GIGPLVISPLSEMIGRRIVYLVTLMIYIVLQIPCALAPNIACLLIVRFFCGCFGCTPLTLAGGVISDVWE
YCT4_SCHPO      AAGSVLFAPLSEVYGRLPLYSVTLVIFVVFQIGGGCSKNIWSLVIFRFFHGFFGCTPMSACGGTISDLFN
YBP3_YEAST      GVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINSFIALRMLCXXXXXXXXXXXXXXXXDLYI
AQR1_YEAST      GISPTVSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTL
TPO3_YEAST      SLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGSLLACRFLCGVWSSSGLCLVGGSIADMFP
BMRP_CANAL      GVGPLVFSPMSAIFGRTSIYIITLFLFVILQIPTALVNNIAGLCILRFLGGFFASPCLATGGASVADVVK
TPO2_YEAST      SLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFP
YJA1_SCHPO      AISPMISAPLSEVFGRRMLLQVGNVIFIVFNMACGLARTKAQMYIFRFLAGFGSATPMGLGSGTISDLFT
TPO4_YEAST      GLSTVIGAPLSEVFGRKPVYLFSLPVSMLFTMGVGLSNGHMRIILPRFLSGVFASPALSVGSGTILDIFD
YI45_SCHPO      LFGNLIFAPLSEQFGRRPIYLIGYSVFALLQIPIALSVNLAMXXXXXXXXXXXXXXXXXXXXXXXADLFE
FLR1_YEAST      GLGPIIFSPLSARYGRLNLYMVTLFFFMIFQVGCATVHNIGGLIVMRFISGILCSPSLATGGGTVADIIS
YLZ2_SCHPO      LFGNLIFAPLSEQFGRRPIYLIGYSVFALLQIPIALSVNLAMXXXXXXXXXXXXXXXXXXXXXXXADLFE
CYHR_CANMA      GIGPLFWSPLSSRIGRXXXXXXXXXXXXXXXXXXALSNHIAGLSVLRVIAGFFAAPALSTGGASYGDFIA
YN41_SCHPO      CLGPICWAPMSEITGKTPLYI-GLFLFSVFQIAVATAQDIQTIMICRFFGGYGACVPLCVVAAAFADMYP
YKN1_SCHPO      MLGPLIFSPLSELYGRRPLNIFGYTLFALMQIPTALSVNLAMXXXXXXXXXXXXXXXXXXXXXXLSDMFS
YHS6_SCHPO      AFGPMIFAPFSEVNGRKIGVLVPFFLSILFTIGTASSDSVAAIMCTRFFAGLFAGAPVVSSGGVMADLWC
MFS1_SCHPO      AVGPLIFSPLSEVIGRQKIYVLSLIVFICLQIPTALGSSLGVLLPMRFLAGVFGSPALSTGGASLADIWQ
YN2F_SCHPO      ASGPVVWAPMCELFGRRRPMIIAVFIFCIFHIAVATAKDIQTVMICRFFCGFFGSSPITTVAGSFSDMFS
YIM0_YEAST      GVAPSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVTT
YN42_SCHPO      CSGPIIWAPLSELSGRKPPILIGMLGFGIFNISVAVGKDIQTIMMCRFFAGFFASAPLTVVAAALADMYS
YN43_SCHPO      ASGPILWAPISELVGRKIPLIVGMFMFSIFSIAVAVAKDVQTVMICRFFSGFCASSPLSVVAAAFADMFD
CAF5_SCHPO      AIGPLILSPLSEIVGRQKIYVLSLLVFVCLQIPTALGSSLGVLLPMRFLAGFFGSPALATGGATLADIWQ
YHK8_YEAST      GIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSKTITGVMXXXXXXXXXXXXXXXXXXXXIADIFD
BSU1_SCHPO      GLGPMFLGPLSDIGGRKPVYFCSIFVYTVFNISCALPRNIVQMIISHFIIGVAGSTALTNVAGGIPDLFP
YIM1_YEAST      GLAPTFMGGFADSLGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDVTT
YQO5_SCHPO      IAGPIVWAPLSELSGRKLPLLIGMFGFGIFNISVAVAKDIQTIMMCRFFSGFFASAPLTVVAAAFADMYS
YQEH_SCHPO      ALGPLFLGPLSDLLGRKLVYIGSLIIYVCFCISCALARNYAQLVISMLIMGVVGSTALGNVAGAVADVLG
YB30_YEAST      SVGPLFWGALADFGGRKFLYMVSLSLMLIVNILLAAVPVNIALFVLRIFQAFASSSVISLGAGTVTDVVP
YEBQ_ECOLI      VISLLSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAALMSVNTALIRLIYP
BMR3_BACSU      MAGMPIYGKLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGALLPIAFTIIFDLFP
YCUD_SCHPO      AFGPMLLGPMSDIFGRKWVYVGSLILYIIFQIPQALAYNLPMMAINSAIAGAFGSSALANVASSMCDIFT
BCR_HAEIN       AFGQLFWGPFGDSFGRKPIILLGVIVGALTALVLTEINSVGNFTALRFVQGFFGAAPVVLSGALLRDLFS
YAO5_SCHPO      GVGSLPFAPLSDIYGRFIIYFVTLLIFTIFQVGGGCAHNVWTLAIVRFFQGVFGSTPLANAGGTISDLFT
LMRB_LISMO      -------------FTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFP
LMRB_LISIN      -------------FTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFP
MDTM_ECOLI      MALQWLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFG
S22FL_XENLA     LIGNVFFGPLSDKLGRRPVYLSGLFFDIIFGYFTALAPSYEVFAVSRFFVGVM--------NGGMALVSF
OCTL_DROME      LLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVG
MDTL_ECOL6      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO81      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTM_ECO57      MALQWLLGPLSDRIGRKPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFG
MDTL_SHIDS      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO5E      XXXXXXXXKVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO57      XXXXXXXXKVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_SHISS      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_SHIFL      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_SHIBS      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_SHIB3      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOSE      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOLI      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOLC      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOHS      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECODH      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOBW      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO8A      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO55      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO24      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
GALP_ECOLI      AVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAP
GALP_ECOL6      AVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAP
YWOD_BACSU      AVAQPVTGKLGDLIGRKRLFLFGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAI--YPSGVGLIRNH
YI32_SCHPO      GTAYSLAETSILPFGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGIMSLVTIVIADITP
YAN6_SCHPO      GTAYTLAQTSILPFGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGITSLVTIVIADITP
MDTL_ESCF3      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOSM      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOLU      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOL5      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO27      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOUT      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECOK1      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO7I      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
MDTL_ECO45      XXXXXXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLD
YHCA_BACSU      GVLIPLSAFLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFP
MDTL_SHIF8      --------------GRKPVAIPGSALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLD
PHDK_NOCSK      AIGALVSGPVADRWGRKGVTVVGFVLFCLATAGLGLTGDIHSFAALRIISCFGLGAVMPVALTIVADWMP
MUCK_ACIAD      AIGGIFGGWACDRFGRVRIVVISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTLMAEYVP
S22FL_XENTR     LIGNILFGPLSDKLGRRPVYLSGLFFDITFGYCTALAPSYEVFAVSRFFVGIM--------NGGMALVSF
YMPB_CAEEL      VIAVPFMSMLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLS
LMRB_BACSU      GILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIXXXXXXXXXXXXXRIVQALGTGLLLPLMFNTILVIFP
GHT2_SCHPO      LFGCIISSPIADRFGKRLSIIGFCAVYIIGIVQVTAVPSWVQIMVAKIWTGIGIGALSVL----------
YFIU_BACSU      SVSVPIVGKLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATLP
S22A6_RAT       LLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMP
NANT_YERPS      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_YERPP      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_YERPG      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_YERPB      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_YERP3      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_SALTY      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALTI      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALSV      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALPK      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALPC      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALPB      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALPA      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALNS      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALHS      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALG2      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALEP      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALDC      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALCH      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SALAR      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ESCF3      WFGGLMLGAMGDRYGRRLAMVTSIVLFSVGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_YERPY      WFGGLVLGAMGDRYGRKLAMIISIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_ENTS8      WFGGLMLGAMGDRYGRRLAMISSIVLFSVGTLACGLAPGYTTLFIARLVIGIGMAGEYGASATYVIESWP
MDTM_SALTY      MALQWLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFG
MDTM_SALTI      MALQWLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFG
GHT1_SCHPO      FFGCLISSPTTDRIGKRNSIIGFCVIYLIGVIQVTAVPSWVQIMVAKIWTGLGIGALSVLAPGYQSEVAP
TCMA_STRGA      AVSLITAGKLGDRFGHRQTFLVGVAGFAVTSAAIGLSGSVAAIVVFRVLQGLFGALMQPSALGLLRVTFP
NANT_YERPE      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
NANT_YERPA      WFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWP
MDTL_SALPC      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLD
MDTL_SALEP      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLD
MDTL_SALDC      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLD
MDTL_SALCH      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLD
BCRH_RICBR      ALGILTLGRLSDIYGRRPVVLFGLCIYAXXXXXXXFAPNIETLMLARFVQAFGVSVGSVIGQAMARDSYQ
PCAK_ACIAD      IIGALVSGPTADRFGRKIVLSMSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGLG--AAMPNATFSEYCP
NANT_SHIFL      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SHIF8      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_SHIB3      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOSM      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOSE      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOLI      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOLC      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOL5      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOHS      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECODH      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECOBW      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO8A      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO7I      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO5E      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO57      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO55      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO45      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO27      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT_ECO24      WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
NANT1_ECOL6     WFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWP
MDTL_SALTY      ATAMLFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALPB      ATAMLFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALNS      ATAMLFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALHS      ATAMLFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALA4      ATAMLFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
EMRB_HAEIN      -------------FGEVRLFLVSTFLFVVSSWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNYP
YCNB_BACSU      GILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMMPLMQTVFLTIFP
MDTD_SALPB      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALHS      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
GHT7_SCHPO      FFGCLLSSPVADKIGKRLSIIVWTTVYLIGIIQVTTVPSWVQILVAKIWTGLSIGALSVITPGYQSEV--
Y588_BUCAI      G-------PLSDIIGRKSIMSTSLFIAAMLTMICSMMTSWISIVLLRALTGLALSGVVAVAMTYISEEIH
NANT_CITK8      WFGGLMLGAMGDRYGRRLAMVTSIILFSMGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
MDFA_ECOLI      MFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFE
MDFA_ECOL6      MFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFE
MDFA_ECO57      MFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFE
SGE1_YEAST      AVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVR
MDTD_SALSV      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
BCRH_RICPR      AVGILSLGRLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQ
YWTG_BACSU      ILGSGAAGKLTDRFGRKKAIMAAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLYLSELAP
YUBD_BACSU      PAGPLLRKK----FGARPVYLASLPVFILGSLLIACSGDIALMAAGRFLQGAATGXXXXXXXXXXXXSFP
ORCT_DROME      LLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEM--
NANT_SALA4      WFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWP
MMR_STRCO       ASLLMLAGGLANRIGAKTVYLWGMGVFFLASLACALAPTAETLIAARLVQGAGAAXXXXXXXXXXXXXXE
MDTL_SALSV      ATAMLFAGKIADQSGRKPVAIVGALVFMTASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTD_SALTY      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALPK      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALPA      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALNS      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALEP      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALDC      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTD_SALA4      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
MDTL_SALTI      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALPK      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
MDTL_SALPA      ATAMLFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLD
YYBF_BACSU      AVSMLVFGSLSEVWGRKP--IMGISM-LAASVLCAFSPSFHTLLVLRTIQGVALAGLPSIAMAYLGEEIE
XYLT_LACBR      -------------FGRRKLLLLSAIIFFVGALGSAFSPEFWTLIISRIILGMAVGAASALIPTYLAELAP
S22A6_RABIT     LIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMP
BCRH_RICTY      AVGILSLGRLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQ
YVMA_BACSU      AIMQIILGAIIDFKGARIVLITGILATAAASIGCAVTTDFTLFLIFRMIQXXXXXXXXXXXXTTIGQLFT
S22A6_MOUSE     LLGAMMFGYLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMP
PLT3_ARATH      LVGSLTAGKTSDVIGRRYTIALSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGFALMIAPVYSAEISS
GHT8_SCHPO      MTGCILSSPLMDRIGKRVSIMFWTIVYLIGIILQVTAPSWVQIMVAKIWTGLAIGALSVLAPGFQSEV--
YT13_CAEEL      MIGGMFIPPLADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTP
S226B_XENLA     LVGSILFGGLSDKFGRRPLNIWSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIP
MDTL_SALAR      ATAMLFAGKIADRSGRKPVAIVGAIVFMMASLLCSQATEGSLFLSGRFLQGVGAGSCYVVAFAILRDTLD
GHT5_SCHPO      FFGCFLSSPLMDRIGKRTSIMFWTIVYLIGIILQVTAPSWVQIMVAKIWTGLSIGALSVLAPGFQSEV--
CSBC_BACSU      IFGSALSGTCSDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAP
TPO1_YEAST      AASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
MDTD_SALTI      AVMLPASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVP
BAIG_EUBSP      XXXXPILGKLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAAISPIVMAYIVTEYP
YVKA_BACSU      AVTQPIAGKLGDMYGNKTMYLWGVGLFLIAXXXXXXXXXXXXXIVFRALQAVGGALLTPNSIAIIRHVVS
YNFM_ECOLI      AIGLLFTGPLSDAIGRKPVMVTALLLASICTLLSTMMTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIH
YDHP_ECOLI      MVGAPLMTXXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVP
YDHP_ECO57      MVGAPLMTXXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVP
YAJR_ECOLI      --------------GRKPLIVGGLAVFAAGSVIAALSDSIWGIILGRALQGSGA--IAAAVMALLSDLTR
BCRH_RICFE      ALGILTLGRLSDIYGRRPIALLGLFIYVXXXXXXXFAVNIEMLMIARFVQAFGVSVGSVIGQAMARDSYQ
YUSP_BACSU      ----------ADLLGRRIVYVSGLIIFMAASALCGMANNMTELXXXXXXXXXXXXXXXXXXXXXXXDLFT
SVOPL_MOUSE     MVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSG---HAQGLIIKTEF
MDTD_PECCP      AVMLPASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLNELLASRVIQGIGGAMMVPVGRLTVMKIVP
Y567_BUCAP      SIGTLFIGPLSDRIGRKSIMSSSLLIAAVLTIICSISNNWTVIVFLRALTGLALSGVVAVAMTYIVEEVH
XYLL1_ARATH     LIGSIVAFSVADIIGRRKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGI----------------
SVOPL_HUMAN     MVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHS---QGLIIKTEF
GHT4_SCHPO      LFGAMLSSPFTEAIGKKYSIAFFSGCYIIGQILLVTAPSWVQIMVGKLFTGLTIGALSVLSPGYQSEVAP
Y466_BUCAI      GISQVIFQPFGILFNRKKIILLGLFMFFIGNIISASIHSIWGLIIGRFFQGSGAISGVCM--AFLSDLIR
MDTD_ECOL6      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO81      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
BCR_ECOLI       ALGQLIYGPMADSFGRKPXXXXXXXXXXXXXXXXXXXNTIDQLIVMRFFHGLXXXXXSVVINALMRDIYP
ARAE_ECOLI      AIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMAS
ARAE_ECO57      AIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMAS
PLT6_ARATH      LVGSLLAGRTSDIIGRRYTIVLASILFMLGSILMGWGPNYPVLLSGRCTAGLGVGFALMVAPVYSAEIAT
MMR_BACSU       XXXXXXXXXXXDRFGSKTIYILGLAVFVMASCLCAASINGQMLIAGRLIQGIGXXXXXXXXXXXXXXXYL
MDTL_VIBPA      ATTMLFAGKIADSVGRKPIAVVGAMIFVLASFLGGMAEQPNTFLIARFCQGIGAGSCYVVAFAILRDTLD
GHT3_SCHPO      LFGAMLSSPFTERIGKKGVYII-AELLLVTAV-----PSWIQVLVGKILAGVGIGALSVLSPGYQSEVAP
S22A1_BOVIN     FLGSLGVGYIADRFGRKVXXXXXXXXXXSLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEVAI
MOT2_HUMAN      YAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFTGLGLA-FNLQPALTIIGKYF
ITR2_YEAST      LITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEI--
ARAE_KLEOX      AIGALFNGWLSFRLGRKYSLMVGAVLFVAGSVGSAFATSVEMLLVARIVLGVAVGIASYTAPLYLSEMAS
NANT2_ECOL6     WFGGLAIGALSDKMGRRMAMVLSIVLFSLGTLACGLAPGYAVMFIARIVIGLGMAGEYGSSVTYVIESWP
MSSP1_ARATH     TVITTCSGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISETAE
S22A1_HUMAN     GVGYF-----ADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGTEFVGSGSRRTVAI
PLT5_ARATH      LIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMIAPVYTAEV--
MDTD_ERWCT      AVMLPASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLDELLISRVIQGIGGAMMVPVGRLTVMKIVP
EMRB_ECOLI      GVANAISIPLTGWLAKRKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYP
EMRB_ECO57      GVANAISIPLTGWLAKRKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYP
S22A2_MOUSE     FIGAVGIGYLADRFGRKFCLLVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVG
S22A1_RAT       FLGSLVVGYIADRFGRKLCXXXXXXXXXXXXXXXAVAPDYTSMLLFRLLQGM-VSKGSWVSGYTLITEFI
MDTD_YERPY      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPS      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGDAMMVPVGRLTVMKIVP
MDTD_YERPP      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPN      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPG      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPE      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPB      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERPA      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_YERP3      AVMLPASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVP
MDTD_ESCF3      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSATLNELLLARALQGVGGAMMVPVGRLTVMKIVP
GTR1_LEIDO      -------------FGRRPCIAVADALFVIGSVLMGAAPNVEVVLVSRVIVGLAIGISSATIPVYLAEVTS
DGOT_ECOLI      --------------GSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFP
DGOT_ECOL6      --------------GSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFP
STP7_ARATH      -VSTLVASPITRNYGRRASIVCGGISFLIGSGLNAGAVNLAMLLAGRIMLGVGIGPLEVAPTHLRGGLNM
MDTD_SHISS      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_SHIFL      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_SHIF8      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_SHIBS      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_SHIB3      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOUT      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOSM      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOSE      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOLI      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOLC      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOK1      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOHS      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECODH      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOBW      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO8A      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO7I      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO5E      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO57      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO55      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO45      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO27      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECO24      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
YD387_YEAST     --------PLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGSAQCVP-LFLSEISP
SVOP_XENLA      MASSSLWGNVSDQYGRRTGLKISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVP--QSVTLAEFLP
STP11_ARATH     ------------LFGRKVSMVIGSLAFLSGALLNGLAINLEMLIIGRLFLGVGVGPLEMAPAKIRGALNI
S22AG_XENLA     LIGAVIFGDIADRVGRRPIIWITSTGQFLFGIAVAFTFDYYSFVIVRFLLAMVSSGXXXXXXXXLTEYVG
S22A1_RABIT     FLGSLGVGYIADRFGRKLCLLLTTLINAVSGVLTAVAPDYTSMLLFRLLQGLVSKGTEFVGSGYRRTVAI
MDTD_SERP5      --------------GVQRVFFSAIVLFTLGSILCARSETLNELIASRVVQGIGGAMMVPVGRLTVMKIVP
MDTD_ECOLU      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
MDTD_ECOL5      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVP
YDGK_BACSU      TIGQLIVGPVSDAQGRRKPXXXXXXXXXXXXXXXXXXPNITTLVAARFLQGFTASAGLVLSRAIVRDVFT
S22A7_PONAB     LVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLD
VBA5_YEAST      AILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVG
SVOP_PONAB      MSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVEFLPMKARAKCIL
SVOP_HUMAN      MSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVEFLPMKARAKCIL
SVOP_BOVIN      MSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVEFLPMKARAKCIL
S22A7_HUMAN     LVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLD
MDTD_YERE8      AVMLPASGWLADRVGVKWVFFSAIILFTLGSLLCAQAETLNELISSRVIQGIGGAMMVPVGRLTVMKIVP
MDTD_CITK8      AVMLPASGWLADKVGVRNIFFTAIVLFTLGSLFCAWSSTLNELVLARVLQGVGGAMMVPVGRLTVMKIVP
YFIG_BACSU      -IANGVISVIAVIFGRRPMLIIGTALLLIGILSIVLEGTYVVLSLTILFLAFQQTAISTVTWLMLSEIFP
YCEJ_BACSU      ALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAA---------------
S22AG_HUMAN     LLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIG
ENB1_YEAST      -VASVVAVPYARIFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG
CMLA_PSEAE      GAGQLLFGPLSDXXXXXXXXXXXXXAYVVASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYA
TCR_STRPN       SIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIARFIQGAGAAAFPALVMVVVARYIP
TCR_BACSU       SIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIARFIQGAGAAAFPALVMVVVARYIP
TCR_BACST       SIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIARFIQGAGAAAFPALVMVVVARYIP
TCR_BACCE       SIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIARFIQGAGAAAFPALVMVVVARYIP
S22AF_XENLA     -IGVICFGQLSDRFGRKPVYVTGLALEVTFAVMNALTPIFSMFLITRFLVGVMVLLNECIGSSYWAIAGS
S22A2_RAT       FIGAMMIGYLADRFGRKFCLLVTILINAISGALMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVG
S22A2_PIG       FIGSVGIGYIADRFGRKLCLLLTILINAVSGVLMAISPTYTWMLVFRLIQGLVSKAGWMIGYILITEFVG
S22A2_HUMAN     FIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFV-
EXUT_BACSU      AIFNFLGGVASDRYG------AKLTLFVAMVVWSALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFP


                         .         *         .         .         .         .         +:350
query           LHERAYRVGIYTXXXXXXKNLIPLVSAAITEGLGWRWIFWVVAITIAFGLVLVFFFVPETFWDXXXXXXX
YHMA_SCHPO      EHERGIKIGIYILSTSVGTYLGPLAAGYI-----------------------------------------
HOL1_YEAST      QHQLGSVLTVYIMCTSIGTFLGPLIAGYISAFTNFRWVGWVAVIISGGLLITIIFGCEETYFD-------
YN22_SCHPO      PIQRTYVLGFCTXXXXXXXXXXXXXDFICQSYLGWCWVFWINMIMGAVVIVIIFFFMPETHGD-------
YHA8_SCHPO      TRERGLAIAFFAAGPYAGPTLGPLVGGWIGVGTGFRWIFWVNMIYM-FVMYLTLLPVPETY---------
YCT4_SCHPO      PIQRTGALLVFCAAAFVGPLVGPVMGGYITESLGWRWDFWINMIWAGLTWVIVCFTMPET----------
YBP3_YEAST      SEDRGKNXXXXXXXXXXXXXXXXIFGSLLVNRWPWRSTQWFMVILSGCNVILLTVLLPETLRKQDSKGAI
AQR1_YEAST      KHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET----------
TPO3_YEAST      SETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAIPETY---------
BMRP_CANAL      FWNLPVGLAAWSLGAVCGPSFGPFFGSILTVKASWRWTFWFMCIISGFSFVMLCFTLPETF---------
TPO2_YEAST      SETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAIPETY---------
YJA1_SCHPO      PDERGKAVAVMSLAPLLGPTIGPVVSGFIAEYTTYKWIFWSTTIFSGFIFALSLPLLAETY---------
TPO4_YEAST      VDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWIQ--LIAGGLILPFILMPET----------
YI45_SCHPO      KKDRGYMVIYFTVLXXXXXXXXXXXXXXXXXXXXWQWEFWILLILSGFNLFWAFLLLKETY---------
FLR1_YEAST      PEMVPLVLGMWSXXXXXXXXXXXXXXXXMVDAKNWRFIFWLLMWLSAATFILLAFFFPET----------
YLZ2_SCHPO      KKDRGYMVIYFTVLXXXXXXXXXXXXXXXXXXXXWQWEFWILLILSGFNLFWAFLLLKETY---------
CYHR_CANMA      MHYYSIALGVWSIFAVAGPSIGPLIGAAVIDADGWRWSFWFMAILSGVCFIVLSFSLPETY---------
YN41_SCHPO      NRYRGTAITIFAAVIFVGPLVAPIVGGFLTKSLGWRWTEYITSFMGFLSIILIYLFCEETY---------
YKN1_SCHPO      KRDRGKYIGIYLGICLXXXXXXXXXXXXXXXXXXWRWEFWILLMLSGVSLLAGVVFLKETY---------
YHS6_SCHPO      PAQRGTALIFYAFFVVSGADFGPIISSLVTEDTAWRWPLWTIVIIECFILTLDVFLIKETF---------
MFS1_SCHPO      PWLYPYFMCFWSXXXXXXXXXXXXXXXXMVVAKSWRWQFWLLMMISALVLVIITFFMPET----------
YN2F_SCHPO      ARTRGLVIAVYSAIIFNGPLMSPIVGGFIGKSLGWRWTSYITAIMTAFTSMIIF----------------
YIM0_YEAST      KVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLLMPET----------
YN42_SCHPO      NKYRGTAITLFSAMVFDGPLVSPIVGGFLTKSLGWRWTEYITSFMGFFALIIVYLFCDETY---------
YN43_SCHPO      NKTRGPAVCIFACITFAGPLIGPIAGGFLAKSLGWRWTEYITSF-MGFFSTLCLLFMKECY---------
CAF5_SCHPO      PWLLPYFMCFWXXXXXXXXXXXXXXXXXXXXXESWRWQFWLLMMISGFALIVIFFFMPET----------
YHK8_YEAST      KDQIGIPMAIYTTSAFLGPSLGPIIGGALYH-QSYKWTFITLLITSGCCLVMIIFTIPETY---------
BSU1_SCHPO      EDTAGVPMSLFVWACAGGAIGAPMATGVINAKYGWRWLYYINIIVGGFFLI-VILIIPET----------
YIM1_YEAST      RAERGGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILPET----------
YQO5_SCHPO      NKHRGTAITIFAALVFDGPLVSPIIGGFLTKSLGWRWTEYITSFMGFFALVIVYLFCDETY---------
YQEH_SCHPO      DEDSNWGMYMFIFMCSVASVGSPMTGVAENPKLTWRWLYW------------------------------
YB30_YEAST      PKHRGKAIAYFMMGPNMGPIIAPIVAGLILKGNYWRWLFGFTSIMTGIALILVTALLPET----------
YEBQ_ECOLI      QRFLGRGMGINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLGIIALLLAMRFLP------------
BMR3_BACSU      PEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSISWHWVFY---INVPIGALSLFFII-------------
YCUD_SCHPO      PETVGFGISLFVWGANAGASIGSPIGEALYD--HWRWFYWMNMIVGGF-FVILCVLCPET----------
BCR_HAEIN       KDQLSKVMSTITLVFMLAPLVAPIIGGYIVKFFHWHAIFYVISLVGXXXXXXVFFIIPET----------
YAO5_SCHPO      PVQRTYVLPGFCTFPYLXXXXXXXXXDFITQSLEWRWTFWINMXXXXXXXXXXXXXXPETHED-------
LMRB_LISMO      EHKRGSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWILIIALLFGM--------------------
LMRB_LISIN      EHKRGSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWILIIALLFGM--------------------
MDTM_ECOLI      QTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFISFVGLLLAMPET----------
S22FL_XENLA     VLTQEYVGKSYWALTGSLTNLIFAVGIAFYALLGWRTLAFVANSPGIFFLLLSFVLPESPRW--------
OCTL_DROME      PDKRLY-AGIFVMMFFSVGFMLTAVFAYFVH--DWRWL--QIALTLP-GLIFMFY-----YW--------
MDTL_ECOL6      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKET----------
MDTL_ECO81      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKET----------
MDTM_ECO57      QTKGIKLMAIITSIVLIAPIIGPLSGAALMHFVHWKVLFAIIAVMGFISFVGLLLAMPET----------
MDTL_SHIDS      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKET----------
MDTL_ECO5E      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKET----------
MDTL_ECO57      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKET----------
MDTL_SHISS      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_SHIFL      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_SHIBS      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_SHIB3      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECOSE      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECOLI      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECOLC      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECOHS      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECODH      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECOBW      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECO8A      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKET----------
MDTL_ECO55      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
MDTL_ECO24      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKET----------
GALP_ECOLI      EKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPRW--------
GALP_ECOL6      EKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPRW--------
YWOD_BACSU      IHERASALAVLSIFASAMTALGPTAGGFLIVWGGWPAIFIVNLPFIILSFLLGLYMFPK-----------
YI32_SCHPO      LQTRPYYTGCMGVTWGVASVMGPLIGGAISQNTTWRWIFFI-----------------------------
YAN6_SCHPO      LQTRPYYTGCMGVTWGLASVMGPLIGGAISQKASWRWIFFI-----------------------------
MDTL_ESCF3      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMATMGIAVLMLSLFILKET----------
MDTL_ECOSM      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKET----------
MDTL_ECOLU      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKET----------
MDTL_ECOL5      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKET----------
MDTL_ECO27      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKET----------
MDTL_ECOUT      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKET----------
MDTL_ECOK1      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKET----------
MDTL_ECO7I      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAILMLSLFILKET----------
MDTL_ECO45      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKET----------
YHCA_BACSU      PESRGKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFY------------------------------
MDTL_SHIF8      DRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKET----------
PHDK_NOCSK      KARRAQMVSIAFAGVGVGSIIGAYLAAAVIPTLGWQ----------------------------------
MUCK_ACIAD      TKYRTTVLGTLQAGWTVGYIVATLLAGWLIPDHGWRVLFYVAIIPVLMA-VLMHFFVPE-----------
S22FL_XENTR     VLTQEYVGKSYWALTGSLTNLIFAVGIAFYALLGWRTLAFV-----------------------------
YMPB_CAEEL      EKARAWITVVYNVAWSLGMVWTLLVTLMTDD---WRWRYFIVSLPGVYGFAL-WYFLPES----------
LMRB_BACSU      PHKRGAAMGTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWILVLALVFGI--------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      KEKQGKALGLLGAMNGMAAVLGPNIGSFLLDWTGWHWLF---LINLPIAVLLVVFFIAET----------
S22A6_RAT       IHTRAYVGTLIGYVYSLGQFLLAGIAYAVPH---WRHLQLVVSVPFFIAFIYSWFFIESARW--------
NANT_YERPS      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_YERPP      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_YERPG      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_YERPB      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_YERP3      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_SALTY      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALTI      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALSV      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALPK      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALPC      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALPB      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALPA      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALNS      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALHS      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALG2      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALEP      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALDC      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALCH      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SALAR      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ESCF3      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPLWGWRALFFIGILPIIFALWL------------------
NANT_YERPY      KNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWL------------------
NANT_ENTS8      KALRNKASGFLIXXXXXXXXXXXXXYSLVVPVWGWRALFFIGILPIVFALWL------------------
MDTM_SALTY      QTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMXXXXXXXXXXXMPET----------
MDTM_SALTI      QTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMXXXXXXXXXXXMPET----------
GHT1_SCHPO      PHIRGTIVVTY-----------------------------------------------------------
TCMA_STRGA      PGKLNMAIGIWSGVVGASTAAGPIIGGLLVQHVGWEAVFFI-----------------------------
NANT_YERPE      KNMRNKASGFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYIGLLPIIFALWL------------------
NANT_YERPA      KNMRNKASGFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYIGLLPIIFALWL------------------
MDTL_SALPC      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALEP      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALDC      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALCH      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
BCRH_RICBR      GSELSYVYASLSPWLLFIPXXXXXXXXXXXXXXXWHYTFVFFSLTGTVLLTLYCKILPET----------
PCAK_ACIAD      ARIRSLLVTCMFCGYNLGMAIGGFISSWLIPAFGWHSLFLLGGWAPLILMLLVIFFLPESY---------
NANT_SHIFL      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SHIF8      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_SHIB3      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOSM      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOSE      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOLI      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOLC      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOL5      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOHS      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECODH      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECOBW      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO8A      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO7I      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO5E      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO57      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO55      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO45      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO27      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT_ECO24      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
NANT1_ECOL6     KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
MDTL_SALTY      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALPB      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALNS      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALHS      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTL_SALA4      EHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
EMRB_HAEIN      PEKRGMALAFWSMTIVVAPIFGPILGGWISDNIHWGWIFF-INVPIGLSVVLI-----------------
YCNB_BACSU      IEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVIDLIL------------------
MDTD_SALPB      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALHS      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      PNSLSFCMGLYISGNTIGGFLGRLLSSILAEKFSWSISLMVIGLFSFISSCFFLYFLP------------
NANT_CITK8      KHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWL------------------
MDFA_ECOLI      EAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET----------
MDFA_ECOL6      EAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET----------
MDFA_ECO57      EAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET----------
SGE1_YEAST      ENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILAF---------------
MDTD_SALSV      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAIATFMLMP------------
BCRH_RICPR      GAELSYVYAILSPWLLFIPALGSYIGGYIIEYLSWHYVFIFFSLAGTILLALYYQILPET----------
YWTG_BACSU      KHKRGALSSLNQLMITVGILLSYIVNYIFADAEAWRWM--------------------------------
YUBD_BACSU      IERRNYALLVLIGGFYGSVIIGTILGTIATSCGHWRWLFFIFGTLSLIGVAVSYFFL-------------
ORCT_DROME      -------VGSYRLFAGVAMQMFFSVGFMLTAGFAWRWL--QIAITLPGLLFLCYYWIPES----------
NANT_SALA4      KHLRNKASGFLISGFXXXXXXXXXXXXXXXXXWGWRALFFIGILPIIFALWL------------------
MMR_STRCO       KRQRTRMLGLWSAIVATSSGLGPTVGGLMVSAFGWESIFLLNLPIGAIGMAMTYRYIAAT----------
MDTL_SALSV      EHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMAMGIIVGLLSLF----------------
MDTD_SALTY      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALPK      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALPA      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALNS      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALEP      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALDC      RTQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTD_SALA4      RAQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
MDTL_SALTI      EHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSMGIMVGLLSLF----------------
MDTL_SALPK      EHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSMGIIVGLLSLF----------------
MDTL_SALPA      EHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSMGIIVGLLSLF----------------
YYBF_BACSU      PGSLGSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMAMGTIGVISLIASVIFFINLP------------
XYLT_LACBR      SDKRGTVSSLFQLMVMTGILLAYITNYSFSGYTGWRWMLGFAAIPAAL-LFLGGLILPES----------
S22A6_RABIT     IHTRAYVGTLAGYVYSTGQFLLAGVAYAVPH---WRYLQLLVSVPFFAFFVYSWFFIESARW--------
BCRH_RICTY      GAELSYVYAILSPWLLFIPSLGSYIGGYIIEYSSWHYVFVFFSLIGTILLALYYKILPET----------
YVMA_BACSU      GNERGSAMGTYQMLLSVAPAIAPVLXXXXXXXXXXXXXXWILA---AISIVLL-----------------
S22A6_MOUSE     IHTRAYVGTLIGYVYSLGQFLLAGIAYAVPH---WRHLQLAVSVPFFVAFIYSWFFIESARW--------
PLT3_ARATH      ASHRGFLTSL-PELCISLGILLGYVSGKLTLKLGWRLMLGIAALILAFGI--------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      LRLRFFTSVYFGVMWVVGACFLGLLAYILPD---WRYLMFCISVPNIFVALLIYMTVPES----------
S226B_XENLA     TGNRAF-TSTATGYCYTMGQLVLVGLAFIIR--DWQWLQLAASIPFFF-YFLYSWWIPES----------
MDTL_SALAR      ERRRAKVLSLLNGITCIVPVLAPVLGHLIMLRFPWQSLFYTMSAMGIIVCLLSLFILRET----------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      TKIRGTLGTMNNLMIVTGILLAYIVNYLFTPFEAWRWM--------------------------------
TPO1_YEAST      TNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAVFVAIVLFFEET----------
MDTD_SALTI      RAQYMAAMTFVAXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMP------------
BAIG_EUBSP      QEETGKAFGLYMLISSGAVVVGPTCGGLIMNAAGWRVMMWVVALCVVVFLICTF----------------
YVKA_BACSU      EKRLPKVXXXXXXXXXXXXXXXPFIGSILIDSFSWHSIFWVNIPFLAIALFTALTMFPQ-----------
YNFM_ECOLI      PSFVAFSMGLYISGNSIGGMSGRLISGVFTDFFNWRIALAAIGCFALASALMFWKILPES----------
YDHP_ECOLI      KHKQASAVA--TMFMGLTLANIGGVPAALGETIGWRMSFLATAGLGVISMVSLFFSLPK-----------
YDHP_ECO57      KHKQASAVA--TMFMGLTLANIGGVPAALGETIGWRMSFLATAGLGVISMVSLFFSLPK-----------
YAJR_ECOLI      EQNRTKAMAFIGVSFGITFAIAMVLGPIITHKLGLHALFWMIAILATTGIALTIWVVPNS----------
BCRH_RICFE      GSELSYVYASLSPWLLFIPXXXXXXXXXXXXXXXWHYVFVFFSLTGTILLALYYKVLPET----------
YUSP_BACSU      GKQRAKFQGVFGAIYGLASVIGPQIGGWIVDSLNWKWVFY---INLPVGIIAVIF---------------
SVOPL_MOUSE     LKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIP-GIILIMAFKFIPES----------
MDTD_PECCP      RDQYMAAMTFVTLPGQIGPLMGPALGGFLVEYASWHWIFLINLPVGIIGALATWFLMP------------
Y567_BUCAP      PNSVSFCMGLYISGNTIGGCSGRILSSILAEYFSWHIAFIVIGFFSLMSSCLFLYFLPSS----------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     LKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIP-GIILIVAFKFIPES----------
GHT4_SCHPO      PQIRGAVVSTY----QLFQTCGTLIAACINMGASWRTSF---GINILWGIFLMVLFLPES----------
Y466_BUCAI      EENRVKSIAAIGVSFAISFLIAVVSGPIIVHYFGFFSIFWISAFLSIVCMIIVCFFVP------------
MDTD_ECOL6      REQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAITTLMLMP------------
MDTD_ECO81      REQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAIATLMLMP------------
BCR_ECOLI       KEEFSRMMSFVMLVTTIAPLMAPIVGGWVLVWLSWHY---------------------------------
ARAE_ECOLI      ENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWR----------------------------------
ARAE_ECO57      ENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWR----------------------------------
PLT6_ARATH      ASHRGLLASLPHLCISIGILLGYIVNSKLPMHIGWRLMLGIAAVVLAFGIL-------------------
MMR_BACSU       ERARARMFGLWXXXXXXXXXXGPFIGGVLVQLAGWQSIFLI-----------------------------
MDTL_VIBPA      DERRAKVLSMLNGITCIIPVIAPVIGHLIMLKFPWPSLFTTMAGMGILVSVLAIFVLKES----------
GHT3_SCHPO      PQIRGAVVATYQIFSTG----AALVAACINMGASWRTSF---GINMLWGILLMVLFLPES----------
S22A1_BOVIN     LYQMAFTVGLV------------LLSGLAYILPHWRWLQLAVSLPI-FLLLFRFWFVPES----------
MOT2_HUMAN      YRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLIL----------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ENVRGKMISMYQLMVTLGIVMAFLSDTAFSYSGNWR----------------------------------
NANT2_ECOL6     VHLRNKXXXXXXXXXXXXXXXXXQVYSIVVPLWGWRSLFFVGMLPILFAFYL------------------
MSSP1_ARATH     IRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTVFYLPES----------
S22A1_HUMAN     MYQMAFTVG-----------LVALTGLAYALP-HWRWLQLAVSLP-TFLFLLYYWCVPES----------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      RDQYMAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINLPVGIIGALATWFLMP------------
EMRB_ECOLI      PAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFIVPIGVAVVLM-------------------
EMRB_ECO57      PAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFIVPIGVAVVLM-------------------
S22A2_MOUSE     LGYRR-TVGIYQIAFTVGLLILAGVAYALP---NWRWLQFAVTLP-NFCFLLYFWCIPES----------
S22A1_RAT       LYQMAFTVGLVG---------LAGVAYAIPD---WRWLQLAVSLP-TFLFLLYYWFVPES----------
MDTD_YERPY      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPS      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPP      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPN      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPG      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPE      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPB      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERPA      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_YERP3      REQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMP------------
MDTD_ESCF3      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
GTR1_LEIDO      PKHRGATIVLLTGGQFVAAGFTAIMVVFTSKNIGWRVAIGIGALPAVVQAFCLLFFLPES----------
DGOT_ECOLI      EHERASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGIGIIWSLIWFKVYQP------------
DGOT_ECOL6      EHERASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGIGIIWSLIWFKVYQP------------
STP7_ARATH      MFQLATTIGIFT------ANMVNYGTQQL-KPWGWRLSLGLAAFP-ALLMTLGGYFLPET----------
MDTD_SHISS      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_SHIFL      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_SHIF8      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_SHIBS      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_SHIB3      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECOUT      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECOSM      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECOSE      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECOLI      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECOLC      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECOK1      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECOHS      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECODH      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECOBW      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMP------------
MDTD_ECO8A      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO7I      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO5E      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO57      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO55      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO45      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO27      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECO24      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
YD387_YEAST     SRIRGFMLTL-NIIAITGGQLVSYVIASLMKEISWRYLFALSAIP-AILFLSILDFIPES----------
SVOP_XENLA      MKSRAKCILLIEIFWALGTVFEVLLAIFVMPTLGWRWLLILSALPLMLFAILC-FWLPES----------
STP11_ARATH     GFQLAITIGILA------ANIVNYVTPKLQNGIGWRLSLGLAGVP-AVMMLVGCFFLPDT----------
S22AG_XENLA     IKARTWASMHVHAFFAVGVMIVSLVGFLVRT---W-WIYQIILSLTTLPFVLCCWMLPETFW--------
S22A1_RABIT     LYQVAFSVGLVA---------LSGVAYAIP---NWRWLQLTVSLP-TFLCLFYYWCVPES----------
MDTD_SERP5      REQYMAAMTFVTLPGQIGPLMGPALGGFLVQYASWHWIFLIIPVGIA-GAIATLLLMP------------
MDTD_ECOLU      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
MDTD_ECOL5      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMP------------
YDGK_BACSU      GRELSKFFSLLMVITAVAPMVAPMTGGAILPFATWHTIFHVLMI-IGFLLVLL-----------------
S22A7_PONAB     VEHRTVAGVLSSTFWTGGMMLLALVGYLIRD---WRWLLLAVTLPCAPG-ILSLWWVPES----------
VBA5_YEAST      ERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTWRWCFY-INLPIG-GLAIIMFLL-------------
SVOP_PONAB      LIEVFWAIGTVFEV---------VLAVFVMPSLGWRWLLILSAVPLLLFAVLC-FWLPES----------
SVOP_HUMAN      LIEVFWAIGTVFEV---------VLAVFVMPSLGWRWLLILSAVPLLLFAVLC-FWLPES----------
SVOP_BOVIN      LIEVFWAIGTVFEV---------VLAVFVMPSLGWRWLLILSAVPLLLFAVLC-FWLPES----------
S22A7_HUMAN     VEHRTVAGVLSSTFWTGGVMLLALVGYLIRD---WRWLLLAVTLPCAPG-ILSLWWVPES----------
MDTD_YERE8      REQYMSAMAFVTLPGQIGPLVGPALGGFLVEYASWHWIFLINLPVGVVGALATLWLMP------------
MDTD_CITK8      REQYMAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIF---LINIPVGIV-------------------
YFIG_BACSU      MHVRGLGMGISTFCLWTANFLIGFTFPILLNHIGMSATFFIFVAMNILAILFVKKYVPET----------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     MKSRTW-ASVHLHSFFAVGTLLVALTGYLVR--TW-WLYQMILSTVTVPFILCCWVLPETFW--------
ENB1_YEAST      LRDRTFAMNIFLIPVIINTNIVSSVAGNVAP-YKWRWGYGIFCIIVPISLILVLPYV-------------
CMLA_PSEAE      GREESNVIGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMIAASAAAWRFWPET----------
TCR_STRPN       KENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITI------------------------
TCR_BACSU       KENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITI------------------------
TCR_BACST       KENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITI------------------------
TCR_BACCE       KENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIPMITI------------------------
S22AF_XENLA     LGSMCFAVGI------------------------------------------------------------
S22A2_RAT       LGYRR-MVGIYQIAFTVGLLILAGVAYVIP---NWRWLQFAVTLP-NFCFLLYFWCIPES----------
S22A2_PIG       LSYRR-TVGIFYQVAFTFXXXXXXXXXXXXP--HWRWLQFTVTLP-NFCFLFYYWCVPES----------
S22A2_HUMAN     --GRRYRRTVGIFYQXXXXXXXXXXXXXXXXXPHWRWLQFTVALP-NFFFLLYYWCIPES----------
EXUT_BACSU      PTQRASVIGVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWFKFVKE-----------


                         .         .         .         .         *         .         .:420
query           XXXXXXXSVSDIVAHSFRGRSPEPVTPTEIRQKARDASTQKKQKDLRVDFADDVKSDMRRSGEHPRDSDN
YHMA_SCHPO      ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      AQILAERRIQ--VDNNERGEIQEDYQRGEIENQVATLSTEKHNGEVRDQDSLDLESHSSPNTYDGRAGET
AQR1_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      ----------------------------------------------------------------------
FLR1_YEAST      ----------------------------------------------------------------------
YLZ2_SCHPO      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      ----------------------------------------------------------------------
YHS6_SCHPO      ----------------------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
CAF5_SCHPO      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      ----------------------------------------------------------------------
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      -----------IIPESARW------LLLKGRKDCAIANMQKAARFNKVEISDEALSELLDEGENSEEKAK
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QVLDEKHVEGEPAGDTVAEGYFSVPPASALTPPSTEEDSTTRKDVLDLESARSQPVSRDISVDASADPLH
YHMA_SCHPO      ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      Q-LQRIYTE---ASRSLYEYQLDDSGIDATTAQVTRIRST------DPKLARS---IRENSLRKLQTNLE
AQR1_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      ----------------------------------------------------------------------
FLR1_YEAST      ----------------------------------------------------------------------
YLZ2_SCHPO      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      ----------------------------------------------------------------------
YHS6_SCHPO      ----------------------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
CAF5_SCHPO      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      ----------------------------------------------------------------------
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      QKLEDQELDEGP----------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ASLQQIYTSNLRSKPPVSFSQSLKPWNGRIARDNWFRVMTRPFILFAYPAVLWSSMVYALSVGWLIVLSE
YHMA_SCHPO      --------------------------------------------IFLFPAVLYSGLQWGAQDAWLSFYLT
HOL1_YEAST      ----------------------------------YFKYLKINLRMFLFPPVWLSGMFWGIQDVFLTFYLT
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      EQVKKVLSSNGGEIAPKQVSAVRKVW------DTFFVYFIKPLHFLEYPPVALAITFSAISFSTVYFVNM
AQR1_YEAST      --------------------ETLDPTIPKLDLSSAGKILVLPIILSLFP----SGLLFAM---WTLMLSS
TPO3_YEAST      -----------------------------LLRPLYFSVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGE
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      -----------------------------LLRPLYFAVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGE
YJA1_SCHPO      --------------------------------------LMRPIMLFTQPIVILCSTYMAIQYGILYLVLT
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      --------------------------------------------------------------GMINLVLI
FLR1_YEAST      ------------------------------ARTFLINTLYRPLMIIKEPAILAFDLYIAVAYGCFYLFFE
YLZ2_SCHPO      --------------------------------------------------------------GMINLVLI
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      -------------------------------------------LLCTQPIMILISLIVGTVYGILYLLFT
YHS6_SCHPO      --------------------------------------LVRPFAMLATPIVFFIAMFASYVYGILYLVLT
MFS1_SCHPO      ---------NYKTEAEIASSQLSK---GQFAK----QILVRPIILCVSEPIVLSLTIYGLVYSILYLWFE
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      ------------------------------------RYLAVPFVLFCEPIVFLLTLYMSFVYGILYLLLE
CAF5_SCHPO      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
BSU1_SCHPO      -----------------------------------FRMMTEPIIL---SMGLYNFYAYGISYFFLT----
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      -------------------------------------------LLFTEPIVLYSSFVYAI----LYLLLE
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------WKMIKCPPIIITSVSTALLFSSYYAFSVTFSYYL--
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      -------------------------------------------LLCTEPIIMALGLYNGFAYGLIFLYLD
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      ----------------------------------------------------------------------
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ------------------------------------KTVTRPIILFVEPLLLFVTIYNSFVYGILYLLLE
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           AVAEIYRNKESYNFSALATGLVYISPFVGGILGTVVAGKVSDIIVRWMARRNGGIYEPEFRLVMSAPIAI
YHMA_SCHPO      TEEEDWM-EAPYNYGDNAVAIMNVPCIIGATIGCIYGGYFGDYFTLWAAKRNNGIKEAESRLWLMILPCI
HOL1_YEAST      TQESAYY-EPPWNYSDFGVAIMNVPTLXXXXXXXXXXXXXSDYFVLWMARHNRGILEAEFRLYFSIATAI
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ------------------TGLMFI-PILVGVVGALSTTPFLE--KQYMAKANNGKSVPEWRLVGMCIASP
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      TVEYKY-SRPPYNFKPLYIGLLYIPNSVTYFFASIYGGRWVDMLLK-RYKEKYGILAPEARISWNVVTSV
AQR1_YEAST      ISSGL--SVAPYNYHLVIIGVCYLPGGIGGLMGSFFTGRIIDMYFKRKIKKNGLIPQDKVRLVCLLPQNF
TPO3_YEAST      L----------YGYKDNLVGLMFIPIVIGALWALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAP
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      L----------YGYKDNLVGLMFIPIVIGALWALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAP
YJA1_SCHPO      TYPTLWT--EEYHERPSIAGLNYIASGIGLIFGSQASGIFIDKTFRYLKRRNNGKMAPEFRVPVILLGTF
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      AFSEVW--KSSYDFSPGISGLMYISITLGLFSAVFIAMPINQKFYSYLVKRNGGEGEPEFRLPMGFIGIT
FLR1_YEAST      AFPIVFVG--IYHFSLVEVGLAYMGFCVGCVLAYGLFGILNMRII--VPRFRNGTFTPEAFLIVAMCVCW
YLZ2_SCHPO      AFSEVW--KSSYDFSPGISGLMYISITLGLFSAVFIAMPINQKFYSYLVKRNGGEGEPEFRLPMGFIGIT
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      AFAEVWISQ--YHFTSGLSGLTYISLSIGQVFAVFVLLPLNQKYWLSAVQKNNGVPEPEFRLPMAFLGCF
YHS6_SCHPO      TIPYTFGMTKNWQ------GTISTLPMIAMFTGVVIGGSFN---IMWNQRANGGKPLPEQRLPLMMAVGW
MFS1_SCHPO      AFPILFTTV--YHFTTIENGLVYMGILVGSVLTVAFYFIYLRKVMIPKFVENKGKFPAEEILXXXXXXXX
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      AYPIIFAEKRHFSLGVDAL------PYXXXXXXXXXXXXXXXYFQGYYNRKNGGKPVPEARLPPMMIGSV
CAF5_SCHPO      -----------YHFTIIENGLVYLGILVGALITLVFLYKV--MIPAFMA--SGGDFAPEGVLVISFPATF
YHK8_YEAST      -VAFPYVFKKLYNFGPMEIACSYIGIMVGMILSAPTC-LLFQKTFEWRVKRNNGVKTPEMRFEPLFYGAF
BSU1_SCHPO      AIWPVFY--DTYKMSEMGASCTYLSGFVASTL-LFLYQPIQDWIFRRDKAKNNGVARPEARFTSALFITL
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      AYPIIFSEKRHFSMGVAEL------PYIGLLVGVFIGSAINISFEPWYYRRCGGKPDPEARLPPMMIGCF
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      --------EHDYRFTMLEIGAAYVCPGVAMLLGSQSGGHLSDYLSRWIKSHPKKKFPAEFRXXXXXXXXX
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      GLFPVF--VDNYKMGYMGANLTYLN-FLVGVTIVVMLQPIQNWLYRWDKRRHGGVARPEARFLISLLTVW
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      -----------YGFNKGEQGL----SFIGVGVGIVCAGLCTPFIY-WVNKKRNGVICPEDRLYPLFIGCF
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      AYPLVF--VEGYGFTENGE-----LPYIALIIGMMVCAAFNDYLKRCRAK---GKLVPEARLYAMVIAGT
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           CTAMGLMGFGWSAQEKEKWIVPTVFFGILSFGCTLGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGFV
YHMA_SCHPO      INPIGLFMFGIGTARHWHWGPTYVGLGFIGFGWGCAGDISMAYLMDAYPGMVLEAMVGVSVINNTF-GYV
HOL1_YEAST      IGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCSGDIAMAYLMDCYPDMVLEGMVCTAIINNTI-SCI
YN22_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      FIPTGLLIFAWTSFPRLIWIGPAFSGAPFGYGMVLFYFSANNYLIDVYQNYCASALAAKTMVRSA-GGAA
YCT4_SCHPO      ----------------------------------------------------------------------
YBP3_YEAST      ISPIALLIFGWCLDKKCHWVTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQIL----
AQR1_YEAST      LAVVAYLLFGWSID--KGWRIESIL--ITSFVCS------------------------------------
TPO3_YEAST      FAAIALWILGATAYKHIIWVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSA-GGAA
BMRP_CANAL      ----------------------------------------------------------------------
TPO2_YEAST      FAAIALWILGATAYKHIIWVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSA-GGAA
YJA1_SCHPO      FFPAGLFIYGWTAQYHTHWIGPDIGAAMFNIGLMLGWRGIQTYLIDSFMIYAASSTAVACCVRSIA-AFA
TPO4_YEAST      ----------------------------------------------------------------------
YI45_SCHPO      LFEIGILLFGWTARYKIFWFVPTIGSAIMGGGYIMTSNPLNMYVVDSYGIYXXXXXXGVKIFQ-LLFGAI
FLR1_YEAST      CLPLSLFLFGWTA--RVHWILPVVFFVLAVFNIFQATFAYLATCYPKYSVFAGNGFCRASFA--------
YLZ2_SCHPO      LFEIGILLFGWTARYKIFWFVPTIGSAIMGGGYIMTSNPLNMYVVDSYGIYXXXXXXGVKIFQ-LLLGAI
CYHR_CANMA      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
YKN1_SCHPO      AIMTGMFIFGWTVQYKVFWFVPLIGTTLVGAGFVMTFNPMNMFIVDNYGRYXXXXXXXXXXPRNIF-GAC
YHS6_SCHPO      LMPAGIFVFAWTNSPNIHWIAPFIGISMMGAGFFVIFQGCLNYLVDTFTKFAASAIAANTFTRSIFAGFS
MFS1_SCHPO      XXXXXLFWFGWTGRESVHWIVPIVGTLFYASGSFLLFQSMFQYLAAAYPKYAGNALFRSSMAA------A
YN2F_SCHPO      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
YN43_SCHPO      LFPAGIFWLAWSGYYTHHWIVPTLSGLLTGCGILTIFMQSLIYLIDAY-LFRAASVIAANTIMRSLVAAG
CAF5_SCHPO      FIPICLFWFGWSGRESVHWIVPIVSTLFYASGAFLMFQSMFQYLAASYPKYVASVFAGNDLFRSAM-AAS
YHK8_YEAST      LTPVGLFIFAFTCYKHVHWIAPIIGSAIFGSGVYFVFTGVFAYTVDAYRRYAASGMACNTFVRCIMAG-V
BSU1_SCHPO      LFPAGMFLFAFTCHPPFPWMSPIVGNSMVTVANGHNWMCILNYLTDSYPLLSGSAVAAFTL-PSFIGATV
YIM1_YEAST      ----------------------------------------------------------------------
YQO5_SCHPO      MFPAGIFWLSWSGYYSYHWIVPTLSGLATGCGILLIFLQCLNYLIDAYLFRAASAVAANTIMRSAM-AAG
YQEH_SCHPO      ----------------------------------------------------------------------
YB30_YEAST      XXXXXXXXXXWAIXXXXXXXXXXXXSALTAFGMTWCSNTSMTYLTELFPKRAAGTVAVSSFFRNV-----
YEBQ_ECOLI      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YCUD_SCHPO      FFPAGLFWFAFTSDGRISWVSPLIAGGVLGVGDPQLWLAMINYITDSYPSVAGSAIAAFTLPSFAIAAVL
BCR_HAEIN       ----------------------------------------------------------------------
YAO5_SCHPO      LLPISMFWFAWTCYPHHHWIVPIIASAFFGFSLLIVFFVSYNYIIDSYQHMAPSALAAATLVRYSASGGI
LMRB_LISMO      ----------------------------------------------------------------------
LMRB_LISIN      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
GHT1_SCHPO      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      VFPIGILWFCWTGYYPHKWMVPTVGGAFIGFGLMGIFLPCLNYIIESYXXXXXXXXXXNTFMRSAF-GAC
MDTD_SALTI      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
MOT2_HUMAN      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
GTR1_LEIDO      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
STP11_ARATH     ----------------------------------------------------------------------
S22AG_XENLA     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
S22AG_HUMAN     ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           FSLFFVDWLHSDGAKTVFVALGGIHLACMLFSIPMYIYGKRARMWTVRKRLMEKF
YHMA_SCHPO      FTFACQSWIDSLGTERTYISIGVLCFIFIATSFPMILCGKRLRKWTVRNRLDEK-
HOL1_YEAST      FTFTCSDWLAASGTENTYIALAVINFGITAFALPMYYYGKRIRLWTKR-------
YN22_SCHPO      -------------------------------------------------------
YHA8_SCHPO      FPLFIDYMMDGMTRQWAFFLLGMVAVAAIPIPFTFYLFGDKIR------------
YCT4_SCHPO      -------------------------------------------------------
YBP3_YEAST      -------------------------------------------------------
AQR1_YEAST      -------------------------------------------------------
TPO3_YEAST      FPLFTIQMYH---------------------------------------------
BMRP_CANAL      -------------------------------------------------------
TPO2_YEAST      FPLFTIQMYH---------------------------------------------
YJA1_SCHPO      FPLFGQDMYDTLGSLLAFIVLGSSIITCSL----LWFGGKRLR------------
TPO4_YEAST      -------------------------------------------------------
YI45_SCHPO      FPLFAESLFRRLNYGWGCTLLAFILLACGCSLPILFKYGKQIR------------
FLR1_YEAST      -------------------------------------------------------
YLZ2_SCHPO      FPLFAESLFRRLNYGWGCTLLAFILLACGCSLPILFKYGKQIR------------
CYHR_CANMA      -------------------------------------------------------
YN41_SCHPO      -------------------------------------------------------
YKN1_SCHPO      FPLF---------AEKLFERLGAFLLVAINFSIALYMFGKTIR------------
YHS6_SCHPO      EIMFKKLGVHWGGSLVGFIALGMIPIPFIFY------------------------
MFS1_SCHPO      SPLYARAMFNNTGPSYAPVGWGSTILSCIMIPIPFLIY-----KWGLKLRSRSKY
YN2F_SCHPO      -------------------------------------------------------
YIM0_YEAST      -------------------------------------------------------
YN42_SCHPO      -------------------------------------------------------
YN43_SCHPO      FPLFAVQMFHNMGIGWAGSLLGFIATALIPIPTLFFIFGKRIRL-----------
CAF5_SCHPO      FPLFARAMFNNTGPSYAPVAWGSTILACLMIPIPFVLH-----KWGLKLRSRSKY
YHK8_YEAST      FPLFGLQMYKSMGVNWAGFLLAMVTVAMIPVPFLFTKYGARLR------------
BSU1_SCHPO      FAHVSQIMFNNMSVKWAVATMAFISISIPFIIYTFYFFGQRIR------------
YIM1_YEAST      -------------------------------------------------------
YQO5_SCHPO      FPLFAVQMFHNMGVGWAGSLLGFIAVALIPMPFAFFFFGRKIR------------
YQEH_SCHPO      -------------------------------------------------------
YB30_YEAST      -------------------------------------------------------
YEBQ_ECOLI      -------------------------------------------------------
BMR3_BACSU      -------------------------------------------------------
YCUD_SCHPO      VHLGIIMF---DNMTTTWATLAFISLSLVATIYVIYFFGKHSRLAVTQQALQE--
BCR_HAEIN       -------------------------------------------------------
YAO5_SCHPO      SMVARPMYLNL-GDHWATSVLGFISVAMVPIPFIFYRFGKSIRAWS---------
LMRB_LISMO      -------------------------------------------------------
LMRB_LISIN      -------------------------------------------------------
MDTM_ECOLI      -------------------------------------------------------
S22FL_XENLA     -------------------------------------------------------
OCTL_DROME      -------------------------------------------------------
MDTL_ECOL6      -------------------------------------------------------
MDTL_ECO81      -------------------------------------------------------
MDTM_ECO57      -------------------------------------------------------
MDTL_SHIDS      -------------------------------------------------------
MDTL_ECO5E      -------------------------------------------------------
MDTL_ECO57      -------------------------------------------------------
MDTL_SHISS      -------------------------------------------------------
MDTL_SHIFL      -------------------------------------------------------
MDTL_SHIBS      -------------------------------------------------------
MDTL_SHIB3      -------------------------------------------------------
MDTL_ECOSE      -------------------------------------------------------
MDTL_ECOLI      -------------------------------------------------------
MDTL_ECOLC      -------------------------------------------------------
MDTL_ECOHS      -------------------------------------------------------
MDTL_ECODH      -------------------------------------------------------
MDTL_ECOBW      -------------------------------------------------------
MDTL_ECO8A      -------------------------------------------------------
MDTL_ECO55      -------------------------------------------------------
MDTL_ECO24      -------------------------------------------------------
GALP_ECOLI      -------------------------------------------------------
GALP_ECOL6      -------------------------------------------------------
YWOD_BACSU      -------------------------------------------------------
YI32_SCHPO      -------------------------------------------------------
YAN6_SCHPO      -------------------------------------------------------
MDTL_ESCF3      -------------------------------------------------------
MDTL_ECOSM      -------------------------------------------------------
MDTL_ECOLU      -------------------------------------------------------
MDTL_ECOL5      -------------------------------------------------------
MDTL_ECO27      -------------------------------------------------------
MDTL_ECOUT      -------------------------------------------------------
MDTL_ECOK1      -------------------------------------------------------
MDTL_ECO7I      -------------------------------------------------------
MDTL_ECO45      -------------------------------------------------------
YHCA_BACSU      -------------------------------------------------------
MDTL_SHIF8      -------------------------------------------------------
PHDK_NOCSK      -------------------------------------------------------
MUCK_ACIAD      -------------------------------------------------------
S22FL_XENTR     -------------------------------------------------------
YMPB_CAEEL      -------------------------------------------------------
LMRB_BACSU      -------------------------------------------------------
GHT2_SCHPO      -------------------------------------------------------
YFIU_BACSU      -------------------------------------------------------
S22A6_RAT       -------------------------------------------------------
NANT_YERPS      -------------------------------------------------------
NANT_YERPP      -------------------------------------------------------
NANT_YERPG      -------------------------------------------------------
NANT_YERPB      -------------------------------------------------------
NANT_YERP3      -------------------------------------------------------
NANT_SALTY      -------------------------------------------------------
NANT_SALTI      -------------------------------------------------------
NANT_SALSV      -------------------------------------------------------
NANT_SALPK      -------------------------------------------------------
NANT_SALPC      -------------------------------------------------------
NANT_SALPB      -------------------------------------------------------
NANT_SALPA      -------------------------------------------------------
NANT_SALNS      -------------------------------------------------------
NANT_SALHS      -------------------------------------------------------
NANT_SALG2      -------------------------------------------------------
NANT_SALEP      -------------------------------------------------------
NANT_SALDC      -------------------------------------------------------
NANT_SALCH      -------------------------------------------------------
NANT_SALAR      -------------------------------------------------------
NANT_ESCF3      -------------------------------------------------------
NANT_YERPY      -------------------------------------------------------
NANT_ENTS8      -------------------------------------------------------
MDTM_SALTY      -------------------------------------------------------
MDTM_SALTI      -------------------------------------------------------
GHT1_SCHPO      -------------------------------------------------------
TCMA_STRGA      -------------------------------------------------------
NANT_YERPE      -------------------------------------------------------
NANT_YERPA      -------------------------------------------------------
MDTL_SALPC      -------------------------------------------------------
MDTL_SALEP      -------------------------------------------------------
MDTL_SALDC      -------------------------------------------------------
MDTL_SALCH      -------------------------------------------------------
BCRH_RICBR      -------------------------------------------------------
PCAK_ACIAD      -------------------------------------------------------
NANT_SHIFL      -------------------------------------------------------
NANT_SHIF8      -------------------------------------------------------
NANT_SHIB3      -------------------------------------------------------
NANT_ECOSM      -------------------------------------------------------
NANT_ECOSE      -------------------------------------------------------
NANT_ECOLI      -------------------------------------------------------
NANT_ECOLC      -------------------------------------------------------
NANT_ECOL5      -------------------------------------------------------
NANT_ECOHS      -------------------------------------------------------
NANT_ECODH      -------------------------------------------------------
NANT_ECOBW      -------------------------------------------------------
NANT_ECO8A      -------------------------------------------------------
NANT_ECO7I      -------------------------------------------------------
NANT_ECO5E      -------------------------------------------------------
NANT_ECO57      -------------------------------------------------------
NANT_ECO55      -------------------------------------------------------
NANT_ECO45      -------------------------------------------------------
NANT_ECO27      -------------------------------------------------------
NANT_ECO24      -------------------------------------------------------
NANT1_ECOL6     -------------------------------------------------------
MDTL_SALTY      -------------------------------------------------------
MDTL_SALPB      -------------------------------------------------------
MDTL_SALNS      -------------------------------------------------------
MDTL_SALHS      -------------------------------------------------------
MDTL_SALA4      -------------------------------------------------------
EMRB_HAEIN      -------------------------------------------------------
YCNB_BACSU      -------------------------------------------------------
MDTD_SALPB      -------------------------------------------------------
MDTD_SALHS      -------------------------------------------------------
GHT7_SCHPO      -------------------------------------------------------
Y588_BUCAI      -------------------------------------------------------
NANT_CITK8      -------------------------------------------------------
MDFA_ECOLI      -------------------------------------------------------
MDFA_ECOL6      -------------------------------------------------------
MDFA_ECO57      -------------------------------------------------------
SGE1_YEAST      -------------------------------------------------------
MDTD_SALSV      -------------------------------------------------------
BCRH_RICPR      -------------------------------------------------------
YWTG_BACSU      -------------------------------------------------------
YUBD_BACSU      -------------------------------------------------------
ORCT_DROME      -------------------------------------------------------
NANT_SALA4      -------------------------------------------------------
MMR_STRCO       -------------------------------------------------------
MDTL_SALSV      -------------------------------------------------------
MDTD_SALTY      -------------------------------------------------------
MDTD_SALPK      -------------------------------------------------------
MDTD_SALPA      -------------------------------------------------------
MDTD_SALNS      -------------------------------------------------------
MDTD_SALEP      -------------------------------------------------------
MDTD_SALDC      -------------------------------------------------------
MDTD_SALA4      -------------------------------------------------------
MDTL_SALTI      -------------------------------------------------------
MDTL_SALPK      -------------------------------------------------------
MDTL_SALPA      -------------------------------------------------------
YYBF_BACSU      -------------------------------------------------------
XYLT_LACBR      -------------------------------------------------------
S22A6_RABIT     -------------------------------------------------------
BCRH_RICTY      -------------------------------------------------------
YVMA_BACSU      -------------------------------------------------------
S22A6_MOUSE     -------------------------------------------------------
PLT3_ARATH      -------------------------------------------------------
GHT8_SCHPO      -------------------------------------------------------
YT13_CAEEL      -------------------------------------------------------
S226B_XENLA     -------------------------------------------------------
MDTL_SALAR      -------------------------------------------------------
GHT5_SCHPO      -------------------------------------------------------
CSBC_BACSU      -------------------------------------------------------
TPO1_YEAST      FPLF---------------------------------------------------
MDTD_SALTI      -------------------------------------------------------
BAIG_EUBSP      -------------------------------------------------------
YVKA_BACSU      -------------------------------------------------------
YNFM_ECOLI      -------------------------------------------------------
YDHP_ECOLI      -------------------------------------------------------
YDHP_ECO57      -------------------------------------------------------
YAJR_ECOLI      -------------------------------------------------------
BCRH_RICFE      -------------------------------------------------------
YUSP_BACSU      -------------------------------------------------------
SVOPL_MOUSE     -------------------------------------------------------
MDTD_PECCP      -------------------------------------------------------
Y567_BUCAP      -------------------------------------------------------
XYLL1_ARATH     -------------------------------------------------------
SVOPL_HUMAN     -------------------------------------------------------
GHT4_SCHPO      -------------------------------------------------------
Y466_BUCAI      -------------------------------------------------------
MDTD_ECOL6      -------------------------------------------------------
MDTD_ECO81      -------------------------------------------------------
BCR_ECOLI       -------------------------------------------------------
ARAE_ECOLI      -------------------------------------------------------
ARAE_ECO57      -------------------------------------------------------
PLT6_ARATH      -------------------------------------------------------
MMR_BACSU       -------------------------------------------------------
MDTL_VIBPA      -------------------------------------------------------
GHT3_SCHPO      -------------------------------------------------------
S22A1_BOVIN     -------------------------------------------------------
MOT2_HUMAN      -------------------------------------------------------
ITR2_YEAST      -------------------------------------------------------
ARAE_KLEOX      -------------------------------------------------------
NANT2_ECOL6     -------------------------------------------------------
MSSP1_ARATH     -------------------------------------------------------
S22A1_HUMAN     -------------------------------------------------------
PLT5_ARATH      -------------------------------------------------------
MDTD_ERWCT      -------------------------------------------------------
EMRB_ECOLI      -------------------------------------------------------
EMRB_ECO57      -------------------------------------------------------
S22A2_MOUSE     -------------------------------------------------------
S22A1_RAT       -------------------------------------------------------
MDTD_YERPY      -------------------------------------------------------
MDTD_YERPS      -------------------------------------------------------
MDTD_YERPP      -------------------------------------------------------
MDTD_YERPN      -------------------------------------------------------
MDTD_YERPG      -------------------------------------------------------
MDTD_YERPE      -------------------------------------------------------
MDTD_YERPB      -------------------------------------------------------
MDTD_YERPA      -------------------------------------------------------
MDTD_YERP3      -------------------------------------------------------
MDTD_ESCF3      -------------------------------------------------------
GTR1_LEIDO      -------------------------------------------------------
DGOT_ECOLI      -------------------------------------------------------
DGOT_ECOL6      -------------------------------------------------------
STP7_ARATH      -------------------------------------------------------
MDTD_SHISS      -------------------------------------------------------
MDTD_SHIFL      -------------------------------------------------------
MDTD_SHIF8      -------------------------------------------------------
MDTD_SHIBS      -------------------------------------------------------
MDTD_SHIB3      -------------------------------------------------------
MDTD_ECOUT      -------------------------------------------------------
MDTD_ECOSM      -------------------------------------------------------
MDTD_ECOSE      -------------------------------------------------------
MDTD_ECOLI      -------------------------------------------------------
MDTD_ECOLC      -------------------------------------------------------
MDTD_ECOK1      -------------------------------------------------------
MDTD_ECOHS      -------------------------------------------------------
MDTD_ECODH      -------------------------------------------------------
MDTD_ECOBW      -------------------------------------------------------
MDTD_ECO8A      -------------------------------------------------------
MDTD_ECO7I      -------------------------------------------------------
MDTD_ECO5E      -------------------------------------------------------
MDTD_ECO57      -------------------------------------------------------
MDTD_ECO55      -------------------------------------------------------
MDTD_ECO45      -------------------------------------------------------
MDTD_ECO27      -------------------------------------------------------
MDTD_ECO24      -------------------------------------------------------
YD387_YEAST     -------------------------------------------------------
SVOP_XENLA      -------------------------------------------------------
STP11_ARATH     -------------------------------------------------------
S22AG_XENLA     -------------------------------------------------------
S22A1_RABIT     -------------------------------------------------------
MDTD_SERP5      -------------------------------------------------------
MDTD_ECOLU      -------------------------------------------------------
MDTD_ECOL5      -------------------------------------------------------
YDGK_BACSU      -------------------------------------------------------
S22A7_PONAB     -------------------------------------------------------
VBA5_YEAST      -------------------------------------------------------
SVOP_PONAB      -------------------------------------------------------
SVOP_HUMAN      -------------------------------------------------------
SVOP_BOVIN      -------------------------------------------------------
S22A7_HUMAN     -------------------------------------------------------
MDTD_YERE8      -------------------------------------------------------
MDTD_CITK8      -------------------------------------------------------
YFIG_BACSU      -------------------------------------------------------
YCEJ_BACSU      -------------------------------------------------------
S22AG_HUMAN     -------------------------------------------------------
ENB1_YEAST      -------------------------------------------------------
CMLA_PSEAE      -------------------------------------------------------
TCR_STRPN       -------------------------------------------------------
TCR_BACSU       -------------------------------------------------------
TCR_BACST       -------------------------------------------------------
TCR_BACCE       -------------------------------------------------------
S22AF_XENLA     -------------------------------------------------------
S22A2_RAT       -------------------------------------------------------
S22A2_PIG       -------------------------------------------------------
S22A2_HUMAN     -------------------------------------------------------
EXUT_BACSU      -------------------------------------------------------