[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00379

[Show Plain Result]


## Summary of Sequence Search
    1::390
   25::361     4e-81  53%  361 aa  YKQ9_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   43::375     2e-72  49%  377 aa  RIM2_YEAST RecName: Full=Mitochondrial carrier protein RIM2;
    9::310     3e-51  40%  313 aa  S2536_CHICK RecName: Full=Solute carrier family 25 member 36;
    9::308     5e-51  41%  311 aa  S2536_DANRE RecName: Full=Solute carrier family 25 member 36-A;
    9::313     3e-50  41%  314 aa  S2533_DANRE RecName: Full=Solute carrier family 25 member 33;
    9::308     1e-49  40%  311 aa  S2536_HUMAN RecName: Full=Solute carrier family 25 member 36;
   14::317     5e-49  39%  320 aa  S2533_MOUSE RecName: Full=Solute carrier family 25 member 33;
    9::308     1e-48  40%  311 aa  S2536_MOUSE RecName: Full=Solute carrier family 25 member 36;
   14::315     3e-48  40%  321 aa  S2533_HUMAN RecName: Full=Solute carrier family 25 member
   14::315     3e-48  39%  321 aa  S2533_BOVIN RecName: Full=Solute carrier family 25 member 33;
   23::303     8e-26  31%  315 aa  MFTC_HUMAN RecName: Full=Mitochondrial folate
   23::303     1e-25  31%  315 aa  MFTC_MACFA RecName: Full=Mitochondrial folate
   53::359     4e-25  29%  373 aa  YIA6_YEAST RecName: Full=Uncharacterized mitochondrial carrier
   42::318     9e-25  44%  329 aa  MCFW_DICDI RecName: Full=Mitochondrial substrate carrier family
  136::419     2e-24  32%  434 aa  MCFB_DICDI RecName: Full=Mitochondrial substrate carrier family
   55::324     4e-24  35%  335 aa  YEA6_YEAST RecName: Full=Probable mitochondrial carrier YEL006W;
   23::303     7e-24  31%  316 aa  MFTC_MOUSE RecName: Full=Mitochondrial folate
   66::369     8e-23  34%  370 aa  S2541_HUMAN RecName: Full=Solute carrier family 25 member 41;
  186::467     2e-22  33%  468 aa  SCMC3_HUMAN RecName: Full=Calcium-binding mitochondrial carrier
  187::468     9e-22  31%  469 aa  SCM2A_DANRE RecName: Full=Calcium-binding mitochondrial carrier
    2::300     8e-21  29%  322 aa  SFC1_YEAST RecName: Full=Succinate/fumarate mitochondrial
  231::512     1e-20  32%  513 aa  SCMC2_XENTR RecName: Full=Calcium-binding mitochondrial carrier
  232::513     2e-20  31%  514 aa  SCMC2_XENLA RecName: Full=Calcium-binding mitochondrial carrier
    6::265     5e-20  30%  277 aa  YBC9_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  187::468     6e-20  31%  469 aa  SCMC2_HUMAN RecName: Full=Calcium-binding mitochondrial carrier
  187::468     6e-20  31%  469 aa  SCMC2_BOVIN RecName: Full=Calcium-binding mitochondrial carrier
  176::473     8e-20  28%  475 aa  SCMC1_RABIT RecName: Full=Calcium-binding mitochondrial carrier
  176::475     8e-20  27%  477 aa  SCMC1_HUMAN RecName: Full=Calcium-binding mitochondrial carrier
  187::468     8e-20  32%  469 aa  SCM2B_DANRE RecName: Full=Calcium-binding mitochondrial carrier
  176::471     1e-19  28%  475 aa  SCMC1_MOUSE RecName: Full=Calcium-binding mitochondrial carrier
  176::465     1e-19  28%  473 aa  SCM1B_XENLA RecName: Full=Calcium-binding mitochondrial carrier
    7::306     1e-19  31%  312 aa  S2541_MOUSE RecName: Full=Solute carrier family 25 member 41;
  187::468     2e-19  31%  469 aa  SCMC2_MOUSE RecName: Full=Calcium-binding mitochondrial carrier
   19::293     2e-19  31%  300 aa  MCFG_DICDI RecName: Full=Mitochondrial substrate carrier family
  185::466     2e-19  31%  467 aa  SCMC3_MOUSE RecName: Full=Calcium-binding mitochondrial carrier
  176::465     2e-19  28%  473 aa  SCMC1_XENTR RecName: Full=Calcium-binding mitochondrial carrier
  176::475     3e-19  27%  477 aa  SCMC1_BOVIN RecName: Full=Calcium-binding mitochondrial carrier
  176::465     3e-19  28%  473 aa  SCM1A_XENLA RecName: Full=Calcium-binding mitochondrial carrier
  187::468     4e-19  30%  469 aa  SCMC2_RAT RecName: Full=Calcium-binding mitochondrial carrier
  533::809     5e-19  29%  902 aa  AGC1_YEAST RecName: Full=Mitochondrial aspartate-glutamate
   14::323     7e-19  32%  335 aa  YH66_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  136::407     1e-18  34%  436 aa  BT1_MAIZE RecName: Full=Protein brittle-1,
   20::257     2e-18  33%  306 aa  MCATL_RAT RecName: Full=Mitochondrial carnitine/acylcarnitine
  218::530     2e-18  26%  532 aa  CMC3_CAEBR RecName: Full=Probable calcium-binding mitochondrial
  245::529     2e-18  27%  531 aa  CMC3_CAEEL RecName: Full=Probable calcium-binding mitochondrial
   48::321     3e-18  34%  338 aa  MFRN1_RAT RecName: Full=Mitoferrin-1;AltName: Full=Mitochondrial
   20::257     4e-18  33%  306 aa  MCATL_MOUSE RecName: Full=Mitochondrial carnitine/acylcarnitine
   16::296     6e-18  29%  306 aa  MCFM_DICDI RecName: Full=Mitochondrial substrate carrier family
  168::467     8e-18  27%  477 aa  SCMC1_DANRE RecName: Full=Calcium-binding mitochondrial carrier
   48::321     8e-18  34%  338 aa  MFRN1_MOUSE RecName: Full=Mitoferrin-1;AltName: Full=Mitochondrial
   20::260     8e-18  32%  303 aa  MCATL_HUMAN RecName: Full=Mitochondrial carnitine/acylcarnitine
   48::321     2e-17  33%  338 aa  MFRN1_HUMAN RecName: Full=Mitoferrin-1;AltName: Full=Mitochondrial
   16::293     3e-17  31%  307 aa  ODC2_YEAST RecName: Full=Mitochondrial 2-oxodicarboxylate carrier
  130::417     5e-17  30%  426 aa  YBT5_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
    9::300     5e-17  32%  311 aa  MCP62_HUMAN RecName: Full=Putative mitochondrial carrier protein
  249::526     5e-17  28%  588 aa  CMC2_CAEEL RecName: Full=Putative calcium-binding mitochondrial
   14::323     7e-17  31%  353 aa  S2540_DANRE RecName: Full=Solute carrier family 25 member 40;
   18::301     9e-17  25%  329 aa  PM34_DICDI RecName: Full=Mitochondrial substrate carrier family
   23::322     9e-17  31%  344 aa  MCFD_DICDI RecName: Full=Mitochondrial substrate carrier family
   20::260     9e-17  31%  298 aa  MCATL_BOVIN RecName: Full=Mitochondrial carnitine/acylcarnitine
    6::305     9e-17  29%  311 aa  FLX1_YEAST RecName: Full=Mitochondrial FAD carrier protein FLX1;
   12::285     1e-16  36%  285 aa  MCFS_DICDI RecName: Full=Mitochondrial substrate carrier family
    8::292     2e-16  29%  301 aa  MCAT_MOUSE RecName: Full=Mitochondrial carnitine/acylcarnitine
   21::309     7e-16  28%  318 aa  TPC_MOUSE RecName: Full=Mitochondrial thiamine pyrophosphate
   18::327     1e-15  25%  338 aa  MCFI_DICDI RecName: Full=Mitochondrial substrate carrier family
   14::323     1e-15  28%  341 aa  S2540_XENTR RecName: Full=Solute carrier family 25 member 40;
   59::279     4e-15  32%  349 aa  S2541_BOVIN RecName: Full=Solute carrier family 25 member 41;
   19::289     4e-15  29%  299 aa  ODC_HUMAN RecName: Full=Mitochondrial 2-oxodicarboxylate
   13::292     4e-15  33%  301 aa  MCFX_DICDI RecName: Full=Mitochondrial substrate carrier family
    5::294     5e-15  35%  300 aa  MCAT_ARATH RecName: Full=Mitochondrial carnitine/acylcarnitine
   25::366     6e-15  33%  371 aa  YID3_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   20::309     6e-15  33%  319 aa  TPC1_COCIM RecName: Full=Mitochondrial thiamine pyrophosphate
   63::294     6e-15  28%  341 aa  S2543_HUMAN RecName: Full=Solute carrier family 25 member 43;
  351::619     6e-15  35%  695 aa  CMC_DROME RecName: Full=Calcium-binding mitochondrial carrier
  526::805     6e-15  29%  911 aa  AGC1_ASHGO RecName: Full=Mitochondrial aspartate-glutamate
   14::323     8e-15  27%  341 aa  S2540_XENLA RecName: Full=Solute carrier family 25 member 40;
    4::322     8e-15  28%  338 aa  S2540_HUMAN RecName: Full=Solute carrier family 25 member
   11::290     1e-14  27%  294 aa  UCPB_DICDI RecName: Full=Mitochondrial substrate carrier family
   20::310     1e-14  36%  322 aa  TPC1_SCLS1 RecName: Full=Mitochondrial thiamine pyrophosphate
    3::278     1e-14  35%  298 aa  S2535_DANRE RecName: Full=Solute carrier family 25 member 35;
    3::313     1e-14  31%  320 aa  OAC1_SCHPO RecName: Full=Mitochondrial oxaloacetate transport
   57::293     1e-14  28%  341 aa  S2543_MOUSE RecName: Full=Solute carrier family 25 member 43;
    3::322     1e-14  28%  338 aa  S2540_BOVIN RecName: Full=Solute carrier family 25 member 40;
    7::309     2e-14  33%  318 aa  S2534_RAT RecName: Full=Solute carrier family 25 member 34;
    4::281     2e-14  28%  285 aa  MCFL_DICDI RecName: Full=Mitochondrial substrate carrier family
   21::304     3e-14  29%  320 aa  TPC_HUMAN RecName: Full=Mitochondrial thiamine pyrophosphate
   21::316     3e-14  38%  327 aa  TPC1_MAGGR RecName: Full=Mitochondrial thiamine pyrophosphate
   20::308     3e-14  36%  322 aa  TPC1_BOTFB RecName: Full=Mitochondrial thiamine pyrophosphate
   21::304     4e-14  29%  320 aa  TPC_PONAB RecName: Full=Mitochondrial thiamine pyrophosphate
   21::305     4e-14  27%  318 aa  TPC_BOVIN RecName: Full=Mitochondrial thiamine pyrophosphate
   12::291     4e-14  35%  307 aa  PM34_HUMAN RecName: Full=Peroxisomal membrane protein
   17::307     4e-14  30%  308 aa  MFRN_DICDI RecName: Full=Mitoferrin;AltName: Full=Mitochondrial
   29::193     4e-14  32%  301 aa  MCAT_MACFA RecName: Full=Mitochondrial carnitine/acylcarnitine
   19::289     5e-14  28%  299 aa  ODC_PONAB RecName: Full=Mitochondrial 2-oxodicarboxylate
    9::300     5e-14  29%  311 aa  MCP62_BOVIN RecName: Full=Putative mitochondrial carrier protein
    6::289     5e-14  30%  291 aa  KMCP1_RAT RecName: Full=Kidney mitochondrial carrier protein
    6::289     5e-14  30%  291 aa  KMCP1_MACFA RecName: Full=Kidney mitochondrial carrier protein
    7::309     7e-14  33%  318 aa  S2534_MOUSE RecName: Full=Solute carrier family 25 member 34;
    6::289     9e-14  29%  291 aa  KMCP1_MOUSE RecName: Full=Kidney mitochondrial carrier protein
   37::357     1e-13  30%  366 aa  S2540_DICDI RecName: Full=Mitochondrial substrate carrier family
   25::306     1e-13  28%  306 aa  S2538_SHEEP RecName: Full=Solute carrier family 25 member 38;
    4::297     1e-13  34%  304 aa  S2534_BOVIN RecName: Full=Solute carrier family 25 member 34;
  155::456     1e-13  27%  472 aa  MCFC_DICDI RecName: Full=Mitochondrial substrate carrier family
   29::196     1e-13  32%  301 aa  MCAT_RAT RecName: Full=Mitochondrial carnitine/acylcarnitine
  389::545     1e-13  37%  707 aa  CMC1_CAEEL RecName: Full=Probable calcium-binding mitochondrial
   21::304     2e-13  28%  320 aa  TPC_MACFA RecName: Full=Mitochondrial thiamine pyrophosphate
    4::324     2e-13  28%  337 aa  S2540_RAT RecName: Full=Solute carrier family 25 member 40;
   22::324     2e-13  29%  337 aa  S2540_MOUSE RecName: Full=Solute carrier family 25 member 40;
    6::289     2e-13  29%  291 aa  KMCP1_HUMAN RecName: Full=Kidney mitochondrial carrier protein
    6::295     2e-13  29%  299 aa  TXTP_YEAST RecName: Full=Tricarboxylate transport protein;AltName:
  333::606     2e-13  29%  676 aa  CMC2_MOUSE RecName: Full=Calcium-binding mitochondrial carrier
   90::378     2e-13  31%  386 aa  ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1,
  119::297     3e-13  34%  308 aa  UCP3_PIG RecName: Full=Mitochondrial uncoupling protein 3;       
   20::309     3e-13  33%  321 aa  TPC1_ASPNC RecName: Full=Mitochondrial thiamine pyrophosphate
   20::309     3e-13  29%  317 aa  TPC1_ASPFU RecName: Full=Mitochondrial thiamine pyrophosphate
   96::361     3e-13  26%  366 aa  MTM1_YEAST RecName: Full=Mitochondrial carrier protein
   29::193     3e-13  32%  301 aa  MCAT_HUMAN RecName: Full=Mitochondrial carnitine/acylcarnitine
   26::319     3e-13  27%  326 aa  YP011_YEAST RecName: Full=Uncharacterized mitochondrial carrier
   23::293     3e-13  30%  345 aa  S2543_DANRE RecName: Full=Solute carrier family 25 member 43;
   12::291     3e-13  34%  307 aa  PM34_MOUSE RecName: Full=Peroxisomal membrane protein
   12::285     3e-13  32%  298 aa  ODC_SCHPO RecName: Full=Probable mitochondrial 2-oxodicarboxylate
    8::299     3e-13  32%  312 aa  MFRN_CAEEL RecName: Full=Mitoferrin;
   80::354     3e-13  33%  376 aa  MFRN2_DANRE RecName: Full=Mitoferrin-2;AltName: Full=Mitochondrial
   91::379     3e-13  29%  387 aa  ADT1_MAIZE RecName: Full=ADP,ATP carrier protein 1,
   18::288     4e-13  28%  298 aa  ODC_MOUSE RecName: Full=Mitochondrial 2-oxodicarboxylate
   27::312     4e-13  33%  318 aa  ADT2_YEAST RecName: Full=ADP,ATP carrier protein 2;AltName:
   20::309     6e-13  28%  317 aa  TPC1_NEOFI RecName: Full=Mitochondrial thiamine pyrophosphate
   15::298     6e-13  26%  310 aa  ODC1_YEAST RecName: Full=Mitochondrial 2-oxodicarboxylate carrier
    9::295     6e-13  32%  306 aa  MCP62_MOUSE RecName: Full=Putative mitochondrial carrier protein
    6::289     6e-13  30%  291 aa  KMCP1_XENLA RecName: Full=Kidney mitochondrial carrier protein
    9::342     8e-13  32%  359 aa  S2539_HUMAN RecName: Full=Solute carrier family 25 member 39;
   86::374     8e-13  30%  382 aa  ADT_ORYSJ RecName: Full=ADP,ATP carrier protein,
   20::307     1e-12  33%  320 aa  TPC1_ASPTN RecName: Full=Mitochondrial thiamine pyrophosphate
   16::297     1e-12  28%  310 aa  TPC1_LODEL RecName: Full=Mitochondrial thiamine pyrophosphate
   20::316     1e-12  31%  328 aa  TPC1_EMENI RecName: Full=Mitochondrial thiamine pyrophosphate
    6::289     1e-12  28%  291 aa  KMCP1_XENTR RecName: Full=Kidney mitochondrial carrier protein
   25::323     1e-12  30%  331 aa  ADT1_WHEAT RecName: Full=ADP,ATP carrier protein 1,
   50::309     2e-12  31%  318 aa  S2542_RAT RecName: Full=Solute carrier family 25 member 42;
   50::309     2e-12  31%  318 aa  S2542_MOUSE RecName: Full=Solute carrier family 25 member 42;
    9::304     2e-12  30%  309 aa  MCP62_DANRE RecName: Full=Putative mitochondrial carrier protein
   15::292     2e-12  29%  306 aa  COLT_DROME RecName: Full=Congested-like trachea protein;
   56::311     3e-12  29%  327 aa  S2542_XENLA RecName: Full=Solute carrier family 25 member 42;
  130::315     3e-12  39%  331 aa  S2538_NEOFI RecName: Full=Solute carrier family 25 member 38
   12::280     3e-12  34%  308 aa  ADT_CHLRE RecName: Full=ADP,ATP carrier protein;AltName:
   20::307     4e-12  33%  318 aa  TPC1_ASPOR RecName: Full=Mitochondrial thiamine pyrophosphate
   56::311     4e-12  29%  327 aa  S2542_XENTR RecName: Full=Solute carrier family 25 member 42;
   27::324     4e-12  31%  334 aa  S2538_ASPCL RecName: Full=Solute carrier family 25 member 38
    8::287     4e-12  28%  287 aa  S238A_DANRE RecName: Full=Solute carrier family 25 member 38-A;
    8::264     5e-12  32%  269 aa  SAMC_XENTR RecName: Full=S-adenosylmethionine mitochondrial carrier
   50::309     5e-12  31%  318 aa  S2542_HUMAN RecName: Full=Solute carrier family 25 member 42;
  369::603     5e-12  28%  677 aa  CMC1_MOUSE RecName: Full=Calcium-binding mitochondrial carrier
    9::342     6e-12  30%  359 aa  S2539_BOVIN RecName: Full=Solute carrier family 25 member 39;
   18::288     6e-12  29%  298 aa  ODC_RAT RecName: Full=Mitochondrial 2-oxodicarboxylate
   14::295     6e-12  31%  305 aa  ADT_KLULA RecName: Full=ADP,ATP carrier protein;AltName:
  122::300     8e-12  34%  311 aa  UCP3_BOVIN RecName: Full=Mitochondrial uncoupling protein 3;       
    2::286     8e-12  27%  288 aa  S2545_MOUSE RecName: Full=Solute carrier family 25 member 45;
    2::288     8e-12  26%  288 aa  S2545_HUMAN RecName: Full=Solute carrier family 25 member 45;
  119::304     8e-12  39%  320 aa  S2538_ASPFU RecName: Full=Solute carrier family 25 member 38
  119::304     8e-12  39%  320 aa  S2538_ASPFC RecName: Full=Solute carrier family 25 member 38
   59::298     8e-12  31%  311 aa  MFRN_CAEBR RecName: Full=Mitoferrin;
    7::283     8e-12  27%  312 aa  DIF1_CAEEL RecName: Full=Protein dif-1;
  122::301     1e-11  33%  312 aa  UCP3_HUMAN RecName: Full=Mitochondrial uncoupling protein 3;       
   55::310     1e-11  30%  321 aa  S2542_DANRE RecName: Full=Solute carrier family 25 member 42;
   14::326     1e-11  27%  326 aa  S2538_MOUSE RecName: Full=Solute carrier family 25 member 38;
   11::295     1e-11  29%  303 aa  MCFE_DICDI RecName: Full=Mitochondrial substrate carrier family
   20::307     1e-11  29%  324 aa  TPC1_AJECN RecName: Full=Mitochondrial thiamine pyrophosphate
   10::373     1e-11  24%  423 aa  PM47A_CANBO RecName: Full=Peroxisomal membrane protein PMP47A;
   28::306     1e-11  28%  318 aa  M2OM_DICDI RecName: Full=Probable mitochondrial
   54::359     2e-11  26%  368 aa  YM39_YEAST RecName: Full=Uncharacterized mitochondrial carrier
   75::347     2e-11  31%  364 aa  MFRN2_MOUSE RecName: Full=Mitoferrin-2;AltName: Full=Mitochondrial
  102::82      2e-11  32%  288 aa  HDCPB_DANRE RecName: Full=Hepatocellular carcinoma down-regulated
  346::603     2e-11  30%  678 aa  CMC1_PONAB RecName: Full=Calcium-binding mitochondrial carrier
  346::603     2e-11  30%  678 aa  CMC1_HUMAN RecName: Full=Calcium-binding mitochondrial carrier
   25::323     2e-11  29%  331 aa  ADT2_WHEAT RecName: Full=ADP,ATP carrier protein 2,
  222::324     2e-11  36%  336 aa  TPC1_YARLI RecName: Full=Mitochondrial thiamine pyrophosphate
   19::295     2e-11  28%  300 aa  ODC_DICDI RecName: Full=Probable mitochondrial 2-oxodicarboxylate
   62::347     2e-11  31%  364 aa  MFRN2_HUMAN RecName: Full=Mitoferrin-2;AltName: Full=Mitochondrial
   49::323     2e-11  29%  327 aa  MCFA_DICDI RecName: Full=Mitochondrial substrate carrier family
  157::313     3e-11  31%  322 aa  ADT_SCHPO RecName: Full=ADP,ATP carrier protein;AltName:
   66::379     3e-11  29%  387 aa  ADT2_MAIZE RecName: Full=ADP,ATP carrier protein 2,
   33::306     4e-11  30%  321 aa  TPC1_PHANO RecName: Full=Mitochondrial thiamine pyrophosphate
   25::306     4e-11  27%  306 aa  S2538_BOVIN RecName: Full=Solute carrier family 25 member 38;
  193::172     4e-11  34%  381 aa  EAAC_ARATH RecName: Full=Probable envelope ADP,ATP carrier protein,
   21::295     5e-11  23%  302 aa  YD1K_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   41::323     5e-11  30%  325 aa  UCP5_MOUSE RecName: Full=Brain mitochondrial carrier protein 1;    
  348::605     5e-11  28%  675 aa  CMC2_HUMAN RecName: Full=Calcium-binding mitochondrial carrier
   36::309     7e-11  32%  332 aa  MFRN1_DANRE RecName: Full=Mitoferrin-1;AltName: Full=Mitochondrial
   84::373     7e-11  29%  381 aa  ADT1_ARATH RecName: Full=ADP,ATP carrier protein 1,
   14::305     9e-11  27%  314 aa  TPC1_YEAS7 RecName: Full=Mitochondrial thiamine pyrophosphate
  221::388     9e-11  39%  415 aa  TAAC_ARATH RecName: Full=Thylakoid ADP,ATP carrier protein,
    1::342     9e-11  28%  359 aa  S2539_MOUSE RecName: Full=Solute carrier family 25 member 39;
  119::331     9e-11  33%  350 aa  S2538_AJECN RecName: Full=Solute carrier family 25 member 38
   41::323     1e-10  31%  325 aa  UCP5_HUMAN RecName: Full=Brain mitochondrial carrier protein 1;    
  157::316     1e-10  32%  333 aa  S2538_CHAGB RecName: Full=Solute carrier family 25 member 38
  181::309     1e-10  29%  320 aa  ADT4_MOUSE RecName: Full=ADP/ATP translocase 4;AltName:
   10::369     2e-10  25%  419 aa  PM47B_CANBO RecName: Full=Peroxisomal membrane protein PMP47B;
    3::312     2e-10  29%  324 aa  OAC1_YEAST RecName: Full=Mitochondrial oxaloacetate transport
   90::358     2e-10  31%  386 aa  ADT1_SOLTU RecName: Full=ADP,ATP carrier protein,
   14::305     2e-10  27%  314 aa  TPC1_YEAST RecName: Full=Mitochondrial thiamine pyrophosphate
  518::581     2e-10  37%  674 aa  CMC2_MACFA RecName: Full=Calcium-binding mitochondrial carrier
   24::316     3e-10  29%  329 aa  S2538_ASPTN RecName: Full=Solute carrier family 25 member 38
   24::305     3e-10  34%  315 aa  S2538_ASPNC RecName: Full=Solute carrier family 25 member 38
   31::304     4e-10  27%  304 aa  S2538_HUMAN RecName: Full=Solute carrier family 25 member 38;
  180::305     4e-10  29%  315 aa  ADT4_MACFA RecName: Full=ADP/ATP translocase 4;AltName:
  157::301     4e-10  32%  307 aa  ADT3_YEAST RecName: Full=ADP,ATP carrier protein 3;AltName:
  180::305     5e-10  29%  315 aa  ADT4_HUMAN RecName: Full=ADP/ATP translocase 4;AltName:
   12::288     5e-10  29%  298 aa  ADT3_HUMAN RecName: Full=ADP/ATP translocase 3;AltName:
  109::299     6e-10  29%  310 aa  UCP2_CYPCA RecName: Full=Mitochondrial uncoupling protein 2;       
    3::291     6e-10  31%  300 aa  S2535_MOUSE RecName: Full=Solute carrier family 25 member 35;
   12::288     6e-10  25%  298 aa  ADT1_RAT RecName: Full=ADP/ATP translocase 1;AltName: Full=Adenine
   12::288     6e-10  25%  298 aa  ADT1_MOUSE RecName: Full=ADP/ATP translocase 1;AltName:
   28::196     6e-10  32%  298 aa  ADT1_BOVIN RecName: Full=ADP/ATP translocase 1;AltName:
  104::314     1e-09  27%  317 aa  YIKC_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   19::301     1e-09  32%  306 aa  UCPA_DICDI RecName: Full=Mitochondrial substrate carrier family
   18::261     1e-09  32%  266 aa  SAMC_XENLA RecName: Full=S-adenosylmethionine mitochondrial carrier
   40::325     1e-09  26%  332 aa  GDC_MOUSE RecName: Full=Graves disease carrier protein homolog;    
   49::354     1e-09  24%  363 aa  ARG13_NEUCR RecName: Full=Amino-acid transporter arg-13;
   15::293     1e-09  28%  313 aa  ADT_NEUCR RecName: Full=ADP,ATP carrier protein;AltName:
   14::301     1e-09  30%  301 aa  ADT1_ANOGA RecName: Full=ADP,ATP carrier protein 1;AltName:
   28::310     1e-09  31%  319 aa  S2534_DANRE RecName: Full=Solute carrier family 25 member 34;
   38::323     1e-09  24%  330 aa  GDC_BOVIN RecName: Full=Graves disease carrier protein;       
  119::297     2e-09  31%  308 aa  UCP3_RAT RecName: Full=Mitochondrial uncoupling protein 3;       
   45::205     2e-09  31%  312 aa  TXTP_CAEEL RecName: Full=Putative tricarboxylate transport protein,
   16::293     2e-09  27%  305 aa  TPC1_PICST RecName: Full=Mitochondrial thiamine pyrophosphate
    2::304     2e-09  28%  307 aa  S2538_YEAS7 RecName: Full=Solute carrier family 25 member 38
    2::304     2e-09  28%  307 aa  S2538_YEAS1 RecName: Full=Solute carrier family 25 member 38
    2::293     2e-09  28%  301 aa  ORNT1_MOUSE RecName: Full=Mitochondrial ornithine transporter
   14::299     2e-09  23%  300 aa  ADT2_ANOGA RecName: Full=ADP,ATP carrier protein 2;AltName:
   28::196     2e-09  31%  298 aa  ADT1_RABIT RecName: Full=ADP/ATP translocase 1;AltName:
    6::350     2e-09  28%  360 aa  YQ51_CAEEL RecName: Full=Uncharacterized mitochondrial carrier
   15::291     2e-09  27%  301 aa  TPC1_CANAL RecName: Full=Mitochondrial thiamine pyrophosphate
    2::304     2e-09  28%  307 aa  S2538_YEAST RecName: Full=Solute carrier family 25 member 38
   12::288     2e-09  29%  298 aa  ADT2_BOVIN RecName: Full=ADP/ATP translocase 2;AltName:
   88::357     2e-09  30%  385 aa  ADT2_ARATH RecName: Full=ADP,ATP carrier protein 2,
   66::287     3e-09  24%  291 aa  YFG5_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   23::326     3e-09  27%  326 aa  S2538_RAT RecName: Full=Solute carrier family 25 member 38;
   40::325     3e-09  24%  332 aa  GDC_HUMAN RecName: Full=Graves disease carrier protein;       
   12::288     3e-09  28%  298 aa  ADT3_PIG RecName: Full=ADP/ATP translocase 3;AltName: Full=Adenine
   12::288     3e-09  29%  298 aa  ADT3_BOVIN RecName: Full=ADP/ATP translocase 3;AltName:
   12::288     3e-09  29%  298 aa  ADT2_HUMAN RecName: Full=ADP/ATP translocase 2;AltName:
  257::342     4e-09  31%  345 aa  MCFJ_DICDI RecName: Full=Mitochondrial substrate carrier family
    3::286     4e-09  26%  294 aa  HDCPA_DANRE RecName: Full=Hepatocellular carcinoma down-regulated
   17::298     5e-09  28%  311 aa  UCP3_CANFA RecName: Full=Mitochondrial uncoupling protein 3;       
   17::296     5e-09  27%  309 aa  UCP2_HUMAN RecName: Full=Mitochondrial uncoupling protein 2;       
   17::296     5e-09  27%  309 aa  UCP2_CANFA RecName: Full=Mitochondrial uncoupling protein 2;       
  149::312     5e-09  29%  323 aa  ADT4_BOVIN RecName: Full=ADP/ATP translocase 4;AltName:
   12::288     5e-09  29%  298 aa  ADT2_TACAC RecName: Full=ADP/ATP translocase 2;AltName:
  119::299     7e-09  27%  310 aa  UCP2_DANRE RecName: Full=Mitochondrial uncoupling protein 2;       
   12::288     7e-09  25%  298 aa  ADT1_HUMAN RecName: Full=ADP/ATP translocase 1;AltName:
  128::317     9e-09  27%  323 aa  UCP4_HUMAN RecName: Full=Mitochondrial uncoupling protein 4;       
   17::295     1e-08  26%  308 aa  UCP3_MOUSE RecName: Full=Mitochondrial uncoupling protein 3;       
   17::296     1e-08  27%  309 aa  UCP2_RAT RecName: Full=Mitochondrial uncoupling protein 2;       
   17::296     1e-08  27%  309 aa  UCP2_MOUSE RecName: Full=Mitochondrial uncoupling protein 2;       
   20::318     1e-08  35%  333 aa  TPC1_NEUCR RecName: Full=Mitochondrial thiamine pyrophosphate
    3::294     1e-08  30%  300 aa  S2535_HUMAN RecName: Full=Solute carrier family 25 member 35;
   12::280     1e-08  29%  298 aa  ADT2_PONAB RecName: Full=ADP/ATP translocase 2;AltName:
    1::342     1e-08  27%  359 aa  S2539_RAT RecName: Full=Solute carrier family 25 member 39;
  136::328     1e-08  39%  347 aa  S2538_COCIM RecName: Full=Solute carrier family 25 member 38
    2::293     1e-08  28%  301 aa  ORNT1_HUMAN RecName: Full=Mitochondrial ornithine transporter
   18::290     1e-08  26%  297 aa  MCFP_DICDI RecName: Full=Mitochondrial substrate carrier family
   20::288     2e-08  32%  303 aa  YETC_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
   17::296     2e-08  26%  309 aa  UCP2_PONAB RecName: Full=Mitochondrial uncoupling protein 2;       
  226::297     2e-08  39%  304 aa  S2534_HUMAN RecName: Full=Solute carrier family 25 member 34;
  310::389     2e-08  36%  390 aa  MCFU_DICDI RecName: Full=Mitochondrial substrate carrier family
   32::198     2e-08  27%  309 aa  ADT_DICDI RecName: Full=Mitochondrial substrate carrier family
   18::294     3e-08  26%  307 aa  UCP1_HUMAN RecName: Full=Mitochondrial brown fat uncoupling protein
  204::296     3e-08  44%  297 aa  TPC1_VANPO RecName: Full=Mitochondrial thiamine pyrophosphate
  142::303     4e-08  27%  311 aa  TXTP_BOVIN RecName: Full=Tricarboxylate transport protein,
    8::264     4e-08  34%  267 aa  SAMC_DANRE RecName: Full=S-adenosylmethionine mitochondrial carrier
   89::349     4e-08  30%  386 aa  ADT2_SOLTU RecName: Full=ADP,ATP carrier protein,
   44::263     6e-08  26%  271 aa  YAD8_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  114::317     6e-08  29%  330 aa  S2538_SCLS1 RecName: Full=Solute carrier family 25 member 38
   40::322     6e-08  24%  322 aa  GDC_RAT RecName: Full=Graves disease carrier protein;       
   28::319     6e-08  29%  339 aa  ADT_CHLKE RecName: Full=ADP,ATP carrier protein;AltName:
  126::296     6e-08  27%  298 aa  ADT2_MOUSE RecName: Full=ADP/ATP translocase 2;AltName:
    7::284     7e-08  25%  379 aa  MFRN_DROME RecName: Full=Mitoferrin;
  243::432     7e-08  25%  436 aa  MCFY_DICDI RecName: Full=Mitochondrial substrate carrier family
  126::305     1e-07  30%  314 aa  M2OM_MOUSE RecName: Full=Mitochondrial 2-oxoglutarate/malate
  458::709     1e-07  41%  772 aa  CMC_DICDI RecName: Full=Calcium-binding mitochondrial carrier
  126::296     1e-07  27%  298 aa  ADT2_RAT RecName: Full=ADP/ATP translocase 2;AltName: Full=Adenine
   21::202     1e-07  28%  338 aa  YQ73_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  160::304     1e-07  28%  310 aa  HDMCP_RAT RecName: Full=Hepatocellular carcinoma down-regulated
  160::304     1e-07  38%  310 aa  HDMCP_MOUSE RecName: Full=Hepatocellular carcinoma down-regulated
  141::312     1e-07  26%  312 aa  ADT_DROME RecName: Full=ADP,ATP carrier protein;AltName:
  142::303     2e-07  35%  311 aa  TXTP_RAT RecName: Full=Tricarboxylate transport protein,
  160::303     2e-07  28%  311 aa  TXTP_HUMAN RecName: Full=Tricarboxylate transport protein,
   24::306     2e-07  27%  317 aa  TPC1_KLULA RecName: Full=Mitochondrial thiamine pyrophosphate
  109::315     2e-07  38%  323 aa  GHC1_PONAB RecName: Full=Mitochondrial glutamate carrier 1;        
   30::296     2e-07  27%  309 aa  UCP1_CANFA RecName: Full=Mitochondrial brown fat uncoupling protein
  107::318     2e-07  28%  332 aa  S2538_BOTFB RecName: Full=Solute carrier family 25 member 38
   28::305     2e-07  28%  314 aa  MRS3_YEAST RecName: Full=Mitochondrial RNA-splicing protein MRS3;
   28::204     2e-07  32%  315 aa  GHC2_HUMAN RecName: Full=Mitochondrial glutamate carrier 2;        
  134::290     3e-07  28%  304 aa  S2538_YARLI RecName: Full=Solute carrier family 25 member 38
  209::301     3e-07  33%  304 aa  MRS4_YEAST RecName: Full=Mitochondrial RNA-splicing protein MRS4;
  126::305     4e-07  28%  314 aa  M2OM_BOVIN RecName: Full=Mitochondrial 2-oxoglutarate/malate
  158::302     4e-07  38%  308 aa  HDMCP_HUMAN RecName: Full=Hepatocellular carcinoma down-regulated
   34::112     5e-07  37%  325 aa  TPC1_CHAGB RecName: Full=Mitochondrial thiamine pyrophosphate
  115::302     5e-07  25%  314 aa  S2544_HUMAN RecName: Full=Solute carrier family 25 member 44;
  110::305     5e-07  30%  318 aa  S2538_PYRTR RecName: Full=Solute carrier family 25 member 38
  126::305     5e-07  28%  314 aa  M2OM_HUMAN RecName: Full=Mitochondrial 2-oxoglutarate/malate
  109::315     5e-07  37%  323 aa  GHC1_HUMAN RecName: Full=Mitochondrial glutamate carrier 1;        
  115::302     6e-07  25%  314 aa  S2544_PONAB RecName: Full=Solute carrier family 25 member 44;
  260::515     6e-07  37%  527 aa  MCFV_DICDI RecName: Full=Mitochondrial substrate carrier family
   17::296     8e-07  27%  309 aa  UCP2_PIG RecName: Full=Mitochondrial uncoupling protein 2;       
    4::293     8e-07  24%  306 aa  UCP1_OCHDA RecName: Full=Mitochondrial brown fat uncoupling protein
   10::46      8e-07  33%  293 aa  S2538_ASHGO RecName: Full=Solute carrier family 25 member 38
  109::315     1e-06  38%  323 aa  GHC1_MOUSE RecName: Full=Mitochondrial glutamate carrier 1;        
   31::307     1e-06  24%  307 aa  YMC1_YEAST RecName: Full=Carrier protein YMC1, mitochondrial;Flags:
   44::193     1e-06  35%  301 aa  ORNT2_HUMAN RecName: Full=Mitochondrial ornithine transporter
   17::299     1e-06  28%  309 aa  ADT1_YEAST RecName: Full=ADP,ATP carrier protein 1;AltName:
   18::292     2e-06  26%  307 aa  UCP1_RAT RecName: Full=Mitochondrial brown fat uncoupling protein
   18::292     2e-06  25%  307 aa  UCP1_DICGR RecName: Full=Mitochondrial brown fat uncoupling protein
   45::260     2e-06  31%  274 aa  SAMC_MOUSE RecName: Full=S-adenosylmethionine mitochondrial carrier
  115::302     2e-06  25%  314 aa  S2544_MOUSE RecName: Full=Solute carrier family 25 member 44;
   28::302     2e-06  24%  302 aa  S2538_XENLA RecName: Full=Solute carrier family 25 member 38;
   19::148     2e-06  31%  299 aa  ODC_BOVIN RecName: Full=Mitochondrial 2-oxodicarboxylate
   48::136     2e-06  40%  171 aa  MFRN1_BOVIN RecName: Full=Mitoferrin-1;AltName: Full=Mitochondrial
  126::305     2e-06  28%  314 aa  M2OM_RAT RecName: Full=Mitochondrial 2-oxoglutarate/malate carrier
  215::299     2e-06  31%  316 aa  TPC1_DEBHA RecName: Full=Mitochondrial thiamine pyrophosphate
   24::309     2e-06  32%  309 aa  S2538_LACBS RecName: Full=Solute carrier family 25 member 38
  174::84      2e-06  36%  249 aa  S2535_BOVIN RecName: Full=Solute carrier family 25 member 35;
  161::298     2e-06  28%  301 aa  MCFZ_DICDI RecName: Full=Mitochondrial substrate carrier family
  243::536     2e-06  25%  545 aa  CMC1_YEAST RecName: Full=Calcium-binding mitochondrial carrier
   33::185     3e-06  28%  307 aa  UCP1_PHOSU RecName: Full=Mitochondrial brown fat uncoupling protein
  101::277     3e-06  28%  288 aa  UCP1_BOVIN RecName: Full=Mitochondrial brown fat uncoupling protein
   47::314     3e-06  25%  340 aa  MPCP_CAEEL RecName: Full=Phosphate carrier protein, mitochondrial; 
  231::295     4e-06  37%  298 aa  S2538_VANPO RecName: Full=Solute carrier family 25 member 38
  109::287     4e-06  33%  322 aa  GHC1_BOVIN RecName: Full=Mitochondrial glutamate carrier 1;        
    7::281     5e-06  26%  287 aa  DIC_MOUSE RecName: Full=Mitochondrial dicarboxylate
   79::166     7e-06  40%  186 aa  MFN2B_XENLA RecName: Full=Mitoferrin-2B;AltName: Full=Mitochondrial
   24::85      7e-06  42%  295 aa  DIC1_CANGA RecName: Full=Mitochondrial dicarboxylate
   45::260     9e-06  31%  274 aa  SAMC_HUMAN RecName: Full=S-adenosylmethionine mitochondrial carrier
  254::119     9e-06  36%  357 aa  LEU5_YEAST RecName: Full=Mitochondrial carrier protein LEU5;
   33::215     9e-06  31%  320 aa  GHC2_RAT RecName: Full=Mitochondrial glutamate carrier 2;       
   28::302     1e-05  25%  302 aa  S2538_XENTR RecName: Full=Solute carrier family 25 member 38;
    4::186     1e-05  39%  296 aa  S2538_SCHPO RecName: Full=Solute carrier family 25 member 38
   18::292     2e-05  25%  307 aa  UCP1_MESAU RecName: Full=Mitochondrial brown fat uncoupling protein
   80::166     2e-05  40%  186 aa  MFN2A_XENLA RecName: Full=Mitoferrin-2A;AltName: Full=Mitochondrial
    2::70      2e-05  32%  331 aa  M2OM_NEUCR RecName: Full=Putative mitochondrial
    5::286     2e-05  27%  298 aa  DIC1_YEAST RecName: Full=Mitochondrial dicarboxylate
   52::280     3e-05  26%  283 aa  SAMC_DROME RecName: Full=S-adenosylmethionine mitochondrial carrier
   69::129     3e-05  42%  349 aa  MPCP_CHOFU RecName: Full=Phosphate carrier protein,
  126::183     3e-05  41%  298 aa  MCFN_DICDI RecName: Full=Mitochondrial substrate carrier family
   33::215     3e-05  28%  320 aa  GHC2_MOUSE RecName: Full=Mitochondrial glutamate carrier 2;        
  187::264     3e-05  40%  271 aa  PET8_ASHGO RecName: Full=Putative mitochondrial carrier protein
    7::315     3e-05  24%  326 aa  MCFR_DICDI RecName: Full=Mitochondrial substrate carrier family
  254::324     4e-05  32%  326 aa  YE08_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  125::187     4e-05  35%  307 aa  TPC1_CANGA RecName: Full=Mitochondrial thiamine pyrophosphate
  107::257     6e-05  30%  314 aa  YG04_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  156::298     6e-05  25%  309 aa  UCP2_BOVIN RecName: Full=Mitochondrial uncoupling protein 2;       
  120::297     6e-05  28%  308 aa  UCP1_SUNMU RecName: Full=Mitochondrial brown fat uncoupling protein
   18::291     6e-05  24%  306 aa  UCP1_RABIT RecName: Full=Mitochondrial brown fat uncoupling protein
   18::292     6e-05  25%  307 aa  UCP1_MOUSE RecName: Full=Mitochondrial brown fat uncoupling protein
   26::318     6e-05  31%  327 aa  S2538_ASPOR RecName: Full=Solute carrier family 25 member 38
  237::328     1e-04  33%  329 aa  YMC2_YEAST RecName: Full=Carrier protein YMC2, mitochondrial;Flags:
    7::51      2e-04  42%  348 aa  S2538_NEUCR RecName: Full=Solute carrier family 25 member 38
   56::95      2e-04  41%  297 aa  YB8B_SCHPO RecName: Full=Uncharacterized mitochondrial carrier
  157::294     2e-04  27%  297 aa  S2538_CANGA RecName: Full=Solute carrier family 25 member 38
  149::315     3e-04  32%  334 aa  S2538_MAGGR RecName: Full=Solute carrier family 25 member 38
  168::307     4e-04  25%  309 aa  YFL5_YEAST RecName: Full=Uncharacterized mitochondrial carrier
  168::307     4e-04  25%  309 aa  YFL5_YEAS7 RecName: Full=Uncharacterized mitochondrial carrier
  195::284     4e-04  37%  291 aa  TPC1_PICGU RecName: Full=Mitochondrial thiamine pyrophosphate
  230::261     4e-04  47%  389 aa  MTCH1_MOUSE RecName: Full=Mitochondrial carrier homolog 1;AltName:
  230::261     4e-04  47%  389 aa  MTCH1_HUMAN RecName: Full=Mitochondrial carrier homolog 1;AltName:
  141::295     4e-04  36%  371 aa  MNCP_OXYFA RecName: Full=Macronuclear solute carrier homolog
   67::194     4e-04  32%  298 aa  MCAR1_RAT RecName: Full=Mitochondrial carrier triple repeat protein
  168::307     5e-04  25%  309 aa  YFL5_YEAS6 RecName: Full=Uncharacterized mitochondrial carrier
  168::307     5e-04  25%  309 aa  YFL5_YEAS1 RecName: Full=Uncharacterized mitochondrial carrier
  136::279     6e-04  25%  287 aa  S238B_DANRE RecName: Full=Solute carrier family 25 member 38-B;
  128::272     6e-04  37%  371 aa  MNCP_OXYTR RecName: Full=Macronuclear solute carrier homolog
   20::197     8e-04  23%  292 aa  ORT1_YEAST RecName: Full=Mitochondrial ornithine carrier protein;
   72::193     8e-04  31%  297 aa  MCAR2_HUMAN RecName: Full=Mitochondrial carrier triple repeat
  244::313     3e-04  30%  317 aa  YIKC_SCHPO RecName: Full=Uncharacterized mitochondrial carrier(query 311->385)
  226::295     6e-04  32%  304 aa  S2534_HUMAN RecName: Full=Solute carrier family 25 member 34;(query 197->268)
  320::389     5e-04  29%  390 aa  MCFU_DICDI RecName: Full=Mitochondrial substrate carrier family(query 197->269)
  626::655     6e-04  57%  772 aa  CMC_DICDI RecName: Full=Calcium-binding mitochondrial carrier(query 53->82)
   51::99      7e-06  42%  338 aa  YQ73_SCHPO RecName: Full=Uncharacterized mitochondrial carrier(query 337->384)
  224::315     6e-05  34%  325 aa  TPC1_CHAGB RecName: Full=Mitochondrial thiamine pyrophosphate(query 59->169)
   97::164     6e-04  36%  186 aa  MFN2B_XENLA RecName: Full=Mitoferrin-2B;AltName: Full=Mitochondrial(query 197->269)
   97::164     6e-04  36%  186 aa  MFN2A_XENLA RecName: Full=Mitoferrin-2A;AltName: Full=Mitochondrial(query 197->269)
  229::323     6e-05  29%  326 aa  YE08_SCHPO RecName: Full=Uncharacterized mitochondrial carrier(query 46->164)
  271::332     8e-04  32%  348 aa  S2538_NEUCR RecName: Full=Solute carrier family 25 member 38(query 313->384)
    1::390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxGASRLKDGSEPRQSVMIQSGETDDVEVAPALETKSKPAVKPWAHFFAGAVGGMTAATL
YKQ9_SCHPO      -----------------------------ENSQKTKVLLTKANNASNERAPPPLSHFIAGGVAGMLGAIA
RIM2_YEAST      -------------------------------------------EIENHPTVKPWVHFXXXXXXXXXXXXX
S2536_CHICK     -------------------------------------------------------HLFAGGCGGTVGAIL
S2536_DANRE     -------------------------------------------------------HLFAGGCGGTVGAIL
S2533_DANRE     -------------------------------------------------------HLFAGGCGGTVGAIM
S2536_HUMAN     -------------------------------------------------------HLFAGGCGGTVGAIL
S2533_MOUSE     -------------------------------------------------------HLFAGGCGGTVGAIF
S2536_MOUSE     -------------------------------------------------------HLFAGGCGGTVGAIL
S2533_HUMAN     -------------------------------------------------------HLFAGGCGGTVGAIF
S2533_BOVIN     -------------------------------------------------------HLFAGGCGGTVGAIF
MFTC_HUMAN      -----------------------------------------------------YENLIAGVSGGVLSNLA
MFTC_MACFA      -----------------------------------------------------YENLVAGVSGGVLSNLA
YIA6_YEAST      ----------------------------IKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVA
MCFW_DICDI      ----------------------------------------------------------AGCGAGFMASLF
MCFB_DICDI      --------------------------------------------------VPSWKLLLSGGVAGAVSRTC
YEA6_YEAST      ---------------------------------------------------------------------L
MFTC_MOUSE      -----------------------------------------------------YENLVAGVSGGVLSNLA
S2541_HUMAN     ----------------------PSQQVL-DTGEQLMVPVE-VLEVDNKEAL--WKFLLSGAMAGAVSRTG
SCMC3_HUMAN     -----------------------------------------------------WKQLVAGAVAGAVSRTG
SCM2A_DANRE     -----------------------------------------------------WRHLVSGGGAGAVSRTC
SFC1_YEAST      --------------------------------------------SQKKKASHPAINLMAGGTAGLFEALC
SCMC2_XENTR     -----------------------------------------------------WRHLVAGGGAGAVSRTC
SCMC2_XENLA     -----------------------------------------------------WRHLVAGGGAGAVSRTC
YBC9_SCHPO      ----------------------------------------------------------AGLAAGTASTLI
SCMC2_HUMAN     -----------------------------------------------------WRHLVAGGGAGAVSRTC
SCMC2_BOVIN     -----------------------------------------------------WRHLVAGGGAGAVSRTC
SCMC1_RABIT     ----------------------------------DSLTIPDEFTEEERKSGQWWRQLLAGGIAGAVSRTS
SCMC1_HUMAN     ----------------------------------DSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTS
SCM2B_DANRE     -----------------------------------------------------WRHLVAGGGAGAVSRTC
SCMC1_MOUSE     ----------------------------------DSLTIPDEFTEDEKKSGQWWRQLLAGGVAGAVSRTS
SCM1B_XENLA     ----------------------------------DSLTIPDEFTEEEKKTGQWWKQLMAGGMAGAVSRTG
S2541_MOUSE     ---------------------------VLDTGEQLMVPV-DVLEEENKGTL--WKFLLSGAMAGAVSRTG
SCMC2_MOUSE     -----------------------------------------------------WRHLVAGGGAGAVSRTC
MCFG_DICDI      ----------------------------------------------------------AGSIGGVGQVFT
SCMC3_MOUSE     -----------------------------------------------------WKQLVAGAVAGAVSRTG
SCMC1_XENTR     ----------------------------------DSLTIPDEFTEEEKKTGQWWKQLLAGGMAGAVSRTG
SCMC1_BOVIN     ----------------------------------DSLTIPDEFTEDEKKSGQWWRQLLAGGVAGAVSRTS
SCM1A_XENLA     ----------------------------------DSLTIPDEFTEEEKKTGQWWKHLLAGGMAGAVSRTG
SCMC2_RAT       -----------------------------------------------------WRHLVAGGGAGAVSRTC
AGC1_YEAST      -------------------------------------------------------NFSLGSIAGCIGATV
YH66_SCHPO      ------------------------------------------LSVNAEPDVKPIAKMLSACVGSVITTLT
BT1_MAIZE       ------------------------------------------------------ARLVSGAIAGAVSRTF
MCATL_RAT       ----------------------------------------------------------------------
CMC3_CAEBR      -----------------------RHNLIIDIGE--DGQVPEDFTPQELQSGVWWRHLVAGGVAGAMSRTC
CMC3_CAEEL      -----------------------------------------------------WRHLVAGGVAGAMSRTC
MFRN1_RAT       -------------------------------------------------------HMTAGAMAGILEHSI
MCATL_MOUSE     ----------------------------------------------------------------------
MCFM_DICDI      -------------------------------------------------------------LGSTVATAF
SCMC1_DANRE     -----------------------KKSTVLDIG--DSLTIPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTG
MFRN1_MOUSE     -------------------------------------------------------HMTAGAMAGILEHSI
MCATL_HUMAN     ----------------------------------------------------------------------
MFRN1_HUMAN     -------------------------------------------------------HMTAGAMAGILEHSV
ODC2_YEAST      --------------------------------------------------------FISGAVAGISELTV
YBT5_SCHPO      -------------------------------------------------------YFISGGIAGIVSRTC
MCP62_HUMAN     --------------------------------------------------------FAAGWIGGAASVIV
CMC2_CAEEL      -----------------------------------------------------WRHLVAGGAAGAVSRTC
S2540_DANRE     --------------------------------------------------ITPFQQMMASCSGAIITSLL
PM34_DICDI      --------------------------------------------------VEALGHAISGGVAGMAAIAL
MCFD_DICDI      --------------------------------------------------------FVAGSVGGMSSIMA
MCATL_BOVIN     ----------------------------------------------------------------------
FLX1_YEAST      -----------------------------------------------------WTPLQKEVISGLSAGSV
MCFS_DICDI      ----------------------------------------------------------AGTVAGAACLFT
MCAT_MOUSE      --------------------------------------------------ISPFKNLLAGGFGGMCLVFV
TPC_MOUSE       ----------------------------------------------------------AGSVSGFVTRAL
MCFI_DICDI      -------------------------------------------ETRKDVKFNLGIELLAGTLAGVSSCIL
S2540_XENTR     --------------------------------------------------ITPSQQMIASSMGALLTSFF
S2541_BOVIN     ---------------------EPEHSPSQQVLDTGEQLMVPVLEVDNEGAL--WKFLLSGAMAGAVSRTG
ODC_HUMAN       ----------------------------------------------------------AGGSAGLVEICL
MCFX_DICDI      -----------------------------------------------KNQVKPYSNLIAGAIAGVIGSSV
MCAT_ARATH      -----------------------------------------------------WKDLASGTVGGAAQLVV
YID3_SCHPO      ----------------------------------------------------------------------
TPC1_COCIM      ----------------------------------------------------------AGAIAGMVSRFC
S2543_HUMAN     ----------------------------------------------------------------------
CMC_DROME       ---------------------------------------------------------FAGAVG----ATV
AGC1_ASHGO      -------------------------------------------------------NFTLGSVAGCIGAMV
S2540_XENLA     --------------------------------------------------ITPSQQMIASSVGALLTSFL
S2540_HUMAN     -------------------------------------------ETRGQEIIKPLQQMLASCTGAILTSVI
UCPB_DICDI      --------------------------------------------------------FLFGGLSCMGAAVV
TPC1_SCLS1      ----------------------------------------------------------AGATAGLIARFV
S2535_DANRE     --------------------------------------------------------FILGGVAACGACFF
OAC1_SCHPO      --------------------------------EKQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTL
S2543_MOUSE     ----------------------------------------------------------------------
S2540_BOVIN     ----------------------------------------PESEGPAVITVTPLQQMFASCTGAILTSLM
S2534_RAT       -------------------------------------QMAPA--TDSREMVSPAVDLVLGASACCLACVF
MCFL_DICDI      ----------------------------------------------SKETKEKIRNFIGGFASGAASTLA
TPC_HUMAN       ----------------------------------------------------------AGSVSGLVTRAL
TPC1_MAGGR      ----------------------------------------------------------AGATAGMIARFV
TPC1_BOTFB      ----------------------------------------------------------AGATAGLIARFV
TPC_PONAB       ----------------------------------------------------------AGSVSGLVTRAL
TPC_BOVIN       ----------------------------------------------------------AGSVSGLVTRVL
PM34_HUMAN      -------------------------------------------------------HAVAGAVGSVTAMTV
MFRN_DICDI      -----------------------------------------------------YVHLIAGAAAGFAEHCG
MCAT_MACFA      ----------------------------------------------------------------------
ODC_PONAB       ----------------------------------------------------------AGGSAGLVEICL
MCP62_BOVIN     --------------------------------------------------------FVAGWIGGAASVIV
KMCP1_RAT       -----------------------------------------------------WKPFVYGGLASITAECG
KMCP1_MACFA     -----------------------------------------------------WKPFVYGGLASITAECG
S2534_MOUSE     -------------------------------------QMAPAMD--SREMVSPAVDLVLGASACCLACVF
KMCP1_MOUSE     -----------------------------------------------------WKPFVYGGLASITAECG
S2540_DICDI     ----------------------------------------------------------ASIFGGIMSSLI
S2538_SHEEP     -----------------------------------------------QPVIKA---FLCGSISGTCSTVL
S2534_BOVIN     --------------------------------------------------VPPAVDLVLGASACCLACVF
MCFC_DICDI      -----------------------KDSQILDAGFDNGGFIPPMVEKKEKASSNTITYMLAGSVAGFASRTS
MCAT_RAT        ----------------------------------------------------------------------
CMC1_CAEEL      ----------------------------------------------------------------------
TPC_MACFA       ----------------------------------------------------------AGSVSGLVTRAL
S2540_RAT       -------------------------------------------ETEGPPPVTPLQQMMASCAGAVVTSLM
S2540_MOUSE     ----------------------------------------------------------ASCTGAVLTSLM
KMCP1_HUMAN     -----------------------------------------------------WKPFVYGGLASITAECG
TXTP_YEAST      ----------------------------------------------TKSDVDPLHSFLAGSLAGAAEACI
CMC2_MOUSE      --------------------------------------------------------FGLGSIAGAVGATA
ADT1_GOSHI      --------------------------------------------------------FLMGGVSAAVSKTA
UCP3_PIG        ----------------------------------------------------------AGCTTGAMAVTC
TPC1_ASPNC      ----------------------------------------------------------AGGIAGLVSRFC
TPC1_ASPFU      ----------------------------------------------------------SGGIAGLVSRFC
MTM1_YEAST      ----------------------------------------------------------------------
MCAT_HUMAN      ----------------------------------------------------------------------
YP011_YEAST     --------------------------------------------------------FLAGGVAGAVSRTV
S2543_DANRE     ---------------------------------------------------------------GIFSKTV
PM34_MOUSE      -------------------------------------------------------HAVAGAVGSVTAMTV
ODC_SCHPO       --------------------------------------------------------FAAGAVAGISEVLT
MFRN_CAEEL      -------------------------------------------EYESLPTHSVPVHLTAGALAGAVEHCV
MFRN2_DANRE     -------------------------------------------------------HMLAGAVAGIMEHCL
ADT1_MAIZE      --------------------------------------------------------FMMGGVSAAVSKTA
ODC_MOUSE       ----------------------------------------------------------AGGSAGLVEICL
ADT2_YEAST      --------------------------------------------------------FLMGGVSAAVAKTA
TPC1_NEOFI      ----------------------------------------------------------SGGIAGLVSRFC
ODC1_YEAST      --------------------------------------------------------FTAGAIAGVSELLV
MCP62_MOUSE     --------------------------------------------------------FVAGWIGGVASVIV
KMCP1_XENLA     -----------------------------------------------------WKPFIYGGLASITAECG
S2539_HUMAN     --------------------------------------------------ISPLQQMVASGTGAVVTSLF
ADT_ORYSJ       --------------------------------------------------------FLMGGVSAAVSKTA
TPC1_ASPTN      ----------------------------------------------------------AGGIAGLVSRFC
TPC1_LODEL      --------------------------------------------------VSPYESLFAGSVSGGVARAI
TPC1_EMENI      ----------------------------------------------------------AGGIAGLISRFC
KMCP1_XENTR     -----------------------------------------------------WKPFIYGGLASITAECG
ADT1_WHEAT      -----------------------------------------------KKGVKNFADFLMGGVSAAVSKTA
S2542_RAT       ----------------------------------------------------------------------
S2542_MOUSE     ----------------------------------------------------------------------
MCP62_DANRE     --------------------------------------------------------FLAGWIGGASSVIV
COLT_DROME      ----------------------------------------------------PVKSFLTGGFGGICNVLS
S2542_XENLA     ----------------------------------------------------------------------
S2538_NEOFI     ------------------------------------------------PKLSNWGNLATGAVARTAAGFV
ADT_CHLRE       --------------------------------------------------------FLAGGLSAAVSKTA
TPC1_ASPOR      ----------------------------------------------------------AGGIAGLVSRFC
S2542_XENTR     ----------------------------------------------------------------------
S2538_ASPCL     -------------------------------------------------------HFVAGLCSGLTSSIL
S238A_DANRE     ------------------------------------------------PAVKA---FMCGSLSGTCSTLL
SAMC_XENTR      ------------------------------------------------------ASLLAGGTAGMCVDLI
S2542_HUMAN     ----------------------------------------------------------------------
CMC1_MOUSE      ----------------------------------------------------------------------
S2539_BOVIN     --------------------------------------------------ISPLQQMVASGAGAVVTSLF
ODC_RAT         ----------------------------------------------------------AGGCAGLVEICL
ADT_KLULA       --------------------------------------------------------FLMGGVSAAVSKTA
UCP3_BOVIN      ----------------------------------------------------------AGCTTGAMAVTC
S2545_MOUSE     ----------------------------------------------------PVEEFVAGWISGAVGLVL
S2545_HUMAN     ----------------------------------------------------PVEEFVAGWISGALGLVL
S2538_ASPFU     ------------------------------------------------PKLSNWGNLATGAVARTAAGFV
S2538_ASPFC     ------------------------------------------------PKLSNWGNLATGAVARTAAGFV
MFRN_CAEBR      ----------------------------------------------------------------------
DIF1_CAEEL      -------------------------------------------------------NFIAGGVGGSCTVIV
UCP3_HUMAN      ----------------------------------------------------------AGCTTGAMAVTC
S2542_DANRE     ----------------------------------------------------------------------
S2538_MOUSE     ------------GAGLASPVIEKARSALLQSQDVEDTVETLMLH----PVIKA---FLCGSISGTCSTLL
MCFE_DICDI      -------------------------------------------------------YILTGATSGLLADSI
TPC1_AJECN      ----------------------------------------------------------AGATAGLVSRFC
PM47A_CANBO     ------------------------------------------------------SHAFAGAGGGLLSMTL
M2OM_DICDI      --------------------------------------------------------FVIGGLAGMLSSAF
YM39_YEAST      -----------------------------------------------------WHCVVSGGIGGKIGDSA
MFRN2_MOUSE     -------------------------------------------------------HMVAGAVAGILEHCV
HDCPB_DANRE     --------------------------------------------------------FLAGFTGGVTQVLV
CMC1_PONAB      ----------------------------------------------------------------------
CMC1_HUMAN      ----------------------------------------------------------------------
ADT2_WHEAT      -----------------------------------------------KKGVKNFADFLMGGVSAAVSKTA
TPC1_YARLI      ---------------------------------------------------KGWQEATAGLCAGTASKAL
ODC_DICDI       ---------------------------------------------KSQPL---WHNLVSGGIAGVSEILV
MFRN2_HUMAN     -----------------------------------DYEALPAGATVT-------THMVAGAVAGILEHCV
MCFA_DICDI      --------------------------------------------------------FFSGLIAGIVSRTL
ADT_SCHPO       ----------------------------------------------------------------------
ADT2_MAIZE      -----------------------------------NVPVMPTPLFANAPAEKGGKNFMIDMMGGVSAATA
TPC1_PHANO      ----------------------------------------------------------------------
S2538_BOVIN     -----------------------------------------------QPVIKA---FLCGSISGTCSTLL
EAAC_ARATH      ----------------------------------------------------------AGACAGMTSTLL
YD1K_SCHPO      --------------------------------------------------------FLAGVSGGVAQVLV
UCP5_MOUSE      -----------------------------------------------------WKPFVYGGLASIVAEFG
CMC2_HUMAN      ----------------------------------------------------------------------
MFRN1_DANRE     -------------------------------------------------------HMTAGAVAGILEHTV
ADT1_ARATH      --------------------------------------------------------FLMGGVSAAVSKTA
TPC1_YEAS7      --------------------------------------------------VAAWKTLLAGAVSGLLARSI
TAAC_ARATH      ----------------------------------------------------------AGACAGMTSTLI
S2539_MOUSE     ------------------------------------------MDDQDPGGISPLQQMVASGAGAVVTSLF
S2538_AJECN     -------------------------------GDRDDKRT----RTSALPKLSHTANLLTGAMARTAAGFI
UCP5_HUMAN      -----------------------------------------------------WKPFVYGGLASIVAEFG
S2538_CHAGB     ----------------------------------------------------------------------
ADT4_MOUSE      ----------------------------------------------------------------------
PM47B_CANBO     ------------------------------------------------------SHAFAGAGGGLLSMTL
OAC1_YEAST      ---------------------------------SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTV
ADT1_SOLTU      --------------------------------------------------------FLMGGVSAAVSKTA
TPC1_YEAST      --------------------------------------------------VAAWKTLLAGAVSGLLARSI
CMC2_MACFA      --------------------------------------------------VSPGSLLLAGAIAGMPAASL
S2538_ASPTN     -------------------------------------------------------HFAAGLCSGLTSSIL
S2538_ASPNC     -------------------------------------------------------HFTAGLFSGLTSSIL
S2538_HUMAN     --------------------------------------------------------FLCGSISGTCSTLL
ADT4_MACFA      ----------------------------------------------------------------------
ADT3_YEAST      ----------------------------------------------------------------------
ADT4_HUMAN      ----------------------------------------------------------------------
ADT3_HUMAN      --------------------------------------------------------FLAGGIAAAISKTA
UCP2_CYPCA      --------------------------------------------TKGSEHVGIGSRLMAGCTTGAMAVAL
S2535_MOUSE     --------------------------------------------------------FLMSGVAACGACVF
ADT1_RAT        --------------------------------------------------------FLAGGIAAAVSKTA
ADT1_MOUSE      --------------------------------------------------------FLAGGIAAAVSKTA
ADT1_BOVIN      ----------------------------------------------------------------------
YIKC_SCHPO      -----------------------------------------ALKNRSHQNLENHERLLFGAIAGAASCAT
UCPA_DICDI      --------------------------------------------------------FISGSLASICATTV
SAMC_XENLA      ----------------------------------------------------------------MSVDLI
GDC_MOUSE       --------------------------------------------------------FLAGGIAGCCAKTT
ARG13_NEUCR     -----------------------------------------------------------GSAAGIVGKYI
ADT_NEUCR       ------------------------------------------------------ADFLMGGVSAAVSKTA
ADT1_ANOGA      --------------------------------------------------------FLAGGISAAVSKTA
S2534_DANRE     --------------------------------------------------------FGLGALACCGACVF
GDC_BOVIN       --------------------------------------------------------FLAGGIAGCCAKTT
UCP3_RAT        ----------------------------------------------------------AGCTTGAMAVTC
TXTP_CAEEL      ----------------------------------------------------------------------
TPC1_PICST      --------------------------------------------------VSPYESLLAGSISGAVARAV
S2538_YEAS7     ----------------------------------------------TEQATKPRSHLIGGFFGGLTSAVA
S2538_YEAS1     ----------------------------------------------TEQATKPRSHLIGGFFGGLTSAVA
ORNT1_MOUSE     ---------------------------------------------KSNPAIQAAIDLTAGAAGGTACVLT
ADT2_ANOGA      --------------------------------------------------------FAAGGISAAISKTA
ADT1_RABIT      ----------------------------------------------------------------------
YQ51_CAEEL      -----------------------------ESGKTTNCSGAPSSSCKKQLSVGVLQQVSASSSGAIVTSLF
TPC1_CANAL      --------------------------------------------------VTPTEALVAGSIAGAISRAF
S2538_YEAST     ----------------------------------------------TEQATKPRSHLIGGFFGGLTSAVA
ADT2_BOVIN      --------------------------------------------------------FLAGGVAAAISKTA
ADT2_ARATH      --------------------------------------------------------FMMGGVSAAVSKTA
YFG5_SCHPO      ----------------------------------------------------------------------
S2538_RAT       ---------------------EKARSALLPSQDVEDTVETLMLH----PVIKA---FLCGSISGTCSTLL
GDC_HUMAN       --------------------------------------------------------FLAGGIAGCCAKTT
ADT3_PIG        --------------------------------------------------------FLAGGIAAAISKTA
ADT3_BOVIN      --------------------------------------------------------FLAGGIAAAISKTA
ADT2_HUMAN      --------------------------------------------------------FLAGGVAAAISKTA
MCFJ_DICDI      ----------------------------------------------------PIIHFISGFFAAVFATSI
HDCPA_DANRE     -----------------------------------------------------FADFLAGSFGGACGVAV
UCP3_CANFA      --------------------------------------------------------FLGAGTAACFADLL
UCP2_HUMAN      --------------------------------------------------------FLGAGTAACIADLI
UCP2_CANFA      --------------------------------------------------------FLGAGTAACIADLI
ADT4_BOVIN      ----------------------------------------------------------------------
ADT2_TACAC      --------------------------------------------------------FLAGGVAAAISKTA
UCP2_DANRE      ------------------------------------------------------SRLMAGCTTGAMAVAV
ADT1_HUMAN      --------------------------------------------------------FLAGGVAAAVSKTA
UCP4_HUMAN      -----------------------------------------------------WKSVIGGMMAGVIGQFL
UCP3_MOUSE      --------------------------------------------------------FLGAGTAACFADLL
UCP2_RAT        --------------------------------------------------------FLGAGTAACIADLI
UCP2_MOUSE      --------------------------------------------------------FLGAGTAACIADLI
TPC1_NEUCR      ----------------------------------------------------------AGATAGLISRFV
S2535_HUMAN     --------------------------------------------------------FLMSGLAACGACVF
ADT2_PONAB      --------------------------------------------------------FLAGGVAAAISKTA
S2539_RAT       ------------------------------------------MDDQDPGGISPLQQMVASGAGAVVTSLF
S2538_COCIM     ------------------------------------------------PKLSHTANLITGAVARVAAGFV
ORNT1_HUMAN     ---------------------------------------------KSNPAIQAAIDLTAGAAGGTACVLT
MCFP_DICDI      --------------------------------------------------------FLSGGLAGVTAKSA
YETC_SCHPO      -----------------------------------------------------YAHLLAGAFSGILEHSV
UCP2_PONAB      --------------------------------------------------------FLGAGTAACIADLI
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      ----------------------------------------------------------AGAFG----TTL
ADT_DICDI       ----------------------------------------------------------------------
UCP1_HUMAN      ---------------------------------------------------------FSAGIAACLADVI
TPC1_VANPO      ----------------------------------------------------------AGAISGVISRTI
TXTP_BOVIN      ----------------------------------------------------------------------
SAMC_DANRE      ------------------------------------------------------ASLVAGGCAGMCVDLT
ADT2_SOLTU      --------------------------------------------------------FLMGGVSAAVSKTA
YAD8_SCHPO      ----------------------------------------------------------------------
S2538_SCLS1     ------------------------------------------VHSSSLPKLSNLANLTTGAVARAGAGFV
GDC_RAT         --------------------------------------------------------FLAGSIAGCCAKTT
ADT_CHLKE       --------------------------------------IASPKETQADPMAFV-KDLLAGGTAGAISKTA
ADT2_MOUSE      -----------------------------------------------------------------TSLCF
MFRN_DROME      ---------------------------------------------ESLPTTSVGVNMTAGAIAGVLEHVV
MCFY_DICDI      ---------------------------------------------------------FSGSIAGFAQSFI
M2OM_MOUSE      -----------------------------------------------------------GMTAGATGAFV
CMC_DICDI       ----------------------------------------------------------------------
ADT2_RAT        -----------------------------------------------------------------TSLCF
YQ73_SCHPO      ----------------------------------------------------------AGGIGGATADFL
HDMCP_RAT       ----------------------------------------------------------------------
HDMCP_MOUSE     ----------------------------------------------------------------------
ADT_DROME       -----------------------------------------------------------------TSLCF
TXTP_RAT        ----------------------------------------------------------------------
TXTP_HUMAN      ----------------------------------------------------------------------
TPC1_KLULA      ----------------------------------------------------------AGSVSGVFARMA
GHC1_PONAB      ----------------------------------------------------------AGCGAGTCQVIV
UCP1_CANFA      ---------------------------------------------------------------------I
S2538_BOTFB     ------------------------------------VEQKSMVHSSSLPKLSNLANLTTGAVARAGAGFI
MRS3_YEAST      ------------------------------------------------PTHAPLYHLIAGAFAGIMEHSV
GHC2_HUMAN      ----------------------------------------------------------------------
S2538_YARLI     ----------------------------------------------------------------------
MRS4_YEAST      ----------------------------------------------------PLIHCLCGGISGATCAAL
M2OM_BOVIN      -----------------------------------------------------------GMTAGATGAFV
HDMCP_HUMAN     ----------------------------------------------------------------------
TPC1_CHAGB      ----------------------------------------------------------------------
S2544_HUMAN     ----------------------------------------------------------AGGSASLVAQSI
S2538_PYRTR     --------------------------------------------SSSLPKLSNTANLATGAFARTWAGFI
M2OM_HUMAN      -----------------------------------------------------------GMTAGATGAFV
GHC1_HUMAN      ----------------------------------------------------------AGCGAGTCQVIV
S2544_PONAB     ----------------------------------------------------------AGGSASLVAQSI
MCFV_DICDI      ---------------------------------------------------------FSGAMAGLTSTFF
UCP2_PIG        --------------------------------------------------------FLGAGTAACIADLI
UCP1_OCHDA      ---------------------------------TTATDVAPTMGVK----------IFSAGVAACLADVI
S2538_ASHGO     ------------------------------------------------------AHLVSGFFGGLASVCA
GHC1_MOUSE      ----------------------------------------------------------AGCGAGTCQVIV
YMC1_YEAST      ----------------------------------------------------------AGTAGGIAQVLV
ORNT2_HUMAN     ----------------------------------------------------------------------
ADT1_YEAST      --------------------------------------------------------FLMGGVSAAIAKTG
UCP1_RAT        ---------------------------------------------------------FSAGVSACLADII
UCP1_DICGR      ---------------------------------------------------------FSAGISACLADII
SAMC_MOUSE      ----------------------------------------------------------------------
S2544_MOUSE     ----------------------------------------------------------AGGSASLVAQSI
S2538_XENLA     --------------------------------------------------------FVCGSLSGTCSTLL
ODC_BOVIN       ----------------------------------------------------------AGGSAGLVEICL
MFRN1_BOVIN     -------------------------------------------------------HMTAGAMAGILEHSV
M2OM_RAT        -----------------------------------------------------------GMTAGATGAFV
TPC1_DEBHA      --------------------------------------------------VIPFLEGFCGFIAGATAKGL
S2538_LACBS     ----------------------------------------------------------------------
S2535_BOVIN     ----------------------------------------------------------------------
MCFZ_DICDI      ----------------------------------------------------------------------
CMC1_YEAST      --------------------------------------------------------------------TC
UCP1_PHOSU      ----------------------------------------------------------------------
UCP1_BOVIN      ----------------------------------------------------------AGLMTGGVAVFI
MPCP_CAEEL      ------------------------------------------------------------ALGGVLSCGI
S2538_VANPO     ----------------------------------------------------------------------
GHC1_BOVIN      ----------------------------------------------------------AGCGAGTCQVIV
DIC_MOUSE       ------------------------------------------------------SRWYFGGLASCGAACC
MFN2B_XENLA     ------------------------------------------------------AHMLAGAVAGVMEHCL
DIC1_CANGA      ----------------------------------------------------------------------
SAMC_HUMAN      ----------------------------------------------------------------------
LEU5_YEAST      ------------------------------------------VQKKQRRPLRTWAELISGGLAGMASQTA
GHC2_RAT        ----------------------------------------------------------------------
S2538_XENTR     --------------------------------------------------------FVCGSLSGTCSTLL
S2538_SCHPO     ------------------------------------------IKKTEKLGVKSSKHLAAGALGGFISSTT
UCP1_MESAU      ---------------------------------------------------------FSAGVAACLADII
MFN2A_XENLA     -------------------------------------------------------HMLAGAVAGVMEHCL
M2OM_NEUCR      --------------SSVKQSAQAATSDVVDTAKNATAEVTAATDFLHTPAVRAALPFINGGLSGMVATTV
DIC1_YEAST      -----------------------------------------AKESAGKNIKYPWWY---GGAAGIFATMV
SAMC_DROME      ----------------------------------------------------------------------
MPCP_CHOFU      ----------------------------------------------------------------------
MCFN_DICDI      ----------------------------------------------------------------------
GHC2_MOUSE      ----------------------------------------------------------------------
PET8_ASHGO      --------------------------------------------------VSAWQGAVCGSLAGGIAAAA
MCFR_DICDI      --------------------------------------------TKTSPMVT----LLAGGVSGVIAKST
YE08_SCHPO      ----------------------------------------------------------------------
TPC1_CANGA      ----------------------------------------------------------------------
YG04_SCHPO      -------------------------------------------------------NFLCGTSAGIFATLT
UCP2_BOVIN      ----------------------------------------------------------------------
UCP1_SUNMU      ----------------------------------------------------------AGLMTGCVTVFI
UCP1_RABIT      ---------------------------------------------------------FSAGVAACLADVI
UCP1_MOUSE      ---------------------------------------------------------FSAGVSACLADII
S2538_ASPOR     -------------------------------------------------------HFAAGLCSGLSSAIL
YMC2_YEAST      --------------------------------------------------IPPWKLCLFGAFSGTMLWLT
S2538_NEUCR     -----------------------------------------------KSGTKSTFHFVAGLGSGVLSAIL
YB8B_SCHPO      ----------------------------------------------------------------------
S2538_CANGA     ----------------------------------------------------------------------
S2538_MAGGR     ----------------------------------------------------------------------
YFL5_YEAST      ----------------------------------------------------------------------
YFL5_YEAS7      ----------------------------------------------------------------------
TPC1_PICGU      -------------------------------------EIAREVSAQYKDNI-PFIEGFCGFFAGASSKGI
MTCH1_MOUSE     ----------------------------------------------------------------------
MTCH1_HUMAN     ----------------------------------------------------------------------
MNCP_OXYFA      ----------------------------------------------------------------------
MCAR1_RAT       ----------------------------------------------------------------------
YFL5_YEAS6      ----------------------------------------------------------------------
YFL5_YEAS1      ----------------------------------------------------------------------
S238B_DANRE     ----------------------------------------------------------------------
MNCP_OXYTR      ----------------------------------------------------------AGVLGGFIAGVV
ORT1_YEAST      -----------------------------------------------------------GSIAGACGKVI
MCAR2_HUMAN     ----------------------------------------------------------------------
YIKC_SCHPO      ----------------------------------------------------------------------
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      ----------------------------------------------------------------------
CMC_DICDI       ----------------------------------------------------PMDLLLAGAVAGIPAASL
YQ73_SCHPO      ----------------------------------------------------------------------
TPC1_CHAGB      ----------------------------------------------------------ARTMASVMAKSR
MFN2B_XENLA     ----------------------------------------------------------------------
MFN2A_XENLA     ----------------------------------------------------------------------
YE08_SCHPO      ---------------------------------------------KSDKKLKTWPELLCGAFAGVCGQTV
S2538_NEUCR     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETVQILRSIHVHEGWRALFKGLG
YKQ9_SCHPO      TAPLDVVKTRLQSDFYKDRF--------LKQTAKSKSPLTAAYRHFMDTCIILKNVKVHEGTRALFRGLG
RIM2_YEAST      TCPFDLVKTRLQSDIYKSQAVNISKGSTRPKS---INYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLG
S2536_CHICK     TCPLEVVKTRLQSSSVTLYISEVHL-------NTVNGASVNRVTRVSPPLHCLKMILQKEGPRSLFRGLG
S2536_DANRE     TCPLEVVKTRLQSSFYEVQLSTVNGA-------SVARMAPPGPLH------CLKLILEKEGPRSLFRGLG
S2533_DANRE     TCPLEVLKTRLQSSVFQVQLGTLNGAGVIRPGSVTPGL-----------LQVLRSILEKEGPRSLFRGLG
S2536_HUMAN     TCPLEVVKTRLQSSSVTLYISEV-------QLNTMAGASVNRVVS-PGPLHCLKVILEKEGPRSLFRGLG
S2533_MOUSE     TCPLEVIKTRLQSSRL-----ALRTVY-YPQVH-LGTISGAGMVRPTSVLQVLKSILEKEGPKSLFRGLG
S2536_MOUSE     TCPLEVVKTRLQSSSVTLYISEV-------QLNTMAGASVNRVVS-PGPLHCLKAILEKEGPRSLFRGLG
S2533_HUMAN     TCPLEVIKTRLQSSRL-----ALRTVY-YPQVH-LGTISGAGMVRPTSVTQVLKSILEKEGPKSLFRGLG
S2533_BOVIN     TCPLEVIKTRLQSSRL-----ALRTVY-YPQVH-LGTISGAGVVRQTSVLQVLKSILEKEGPRSLFRGLG
MFTC_HUMAN      LHPLDLVKIR----FAVSDGLELR-----PKYNGIL--------------HCLTTIWKLDGLRGLYQGVT
MFTC_MACFA      LHPLDLVKIR----FAVSDGLELR-----PKYNGIL--------------HCLTTIWKLDGLRGLYQGVT
YIA6_YEAST      VCPLDVAKTRLQAQGLQTRFEN-------PYYRGIMGT--------------LSTIVRDEGPRGLYKGLV
MCFW_DICDI      TTPLDVIKTTLQVDN--------------SSNKTIMSTVKSILDRKG-------------GVKNLYLGLK
MCFB_DICDI      TSPLERLKI-----LNQVGHMNLEQNAPKYKGRGI--------------IQSLKTMYTTEGFIGFFKGNG
YEA6_YEAST      VCPFDVAKTRLQAQGLQNMTHQSQ--------------------HYKGFFGTFATIFKDEGAAGLYKGLQ
MFTC_MOUSE      LHPLDLVKIRFASDGLEVR----------PKYKGIL--------------HCLATIWKVDGLRGLYQGVT
S2541_HUMAN     TAPLDRAKVYMQV--------------------------YSSKTNFTNLLGGLQSMVQEGGFRSLWRGNG
SCMC3_HUMAN     TAPLDRLKVFMQ-------------------------------VHASKTNRLLRSMVLEGGIRSLWRGNG
SCM2A_DANRE     TAPLDRLKVLMQVHGCQGK----------------------SMCLMSGLTQMIKE----GGVRSLWRGNG
SFC1_YEAST      CHPLDTIKVRMQ--IYR---RVAGIEHVKPPGF----------------IKTGRTIYQKEGFLALYKGLG
SCMC2_XENTR     TAPLDRLKV-------------------LMQVHASRSNNMSMLGGFTQMIR-------EGGIRSLWRGNG
SCMC2_XENLA     TAPLDRLKV-------------------LMQVHASRSNNMSILGGFTHMIR-------EGGFRSLWRGNG
YBC9_SCHPO      MHPLDLAKIQMQASMNQ-------------DSKSLFQVFKS-------------NIGSNGSIRSLYHGLS
SCMC2_HUMAN     TAPLDRLKV-------------------LMQVHASRSNNMGIVGGFTQMIR-------EGGARSLWRGNG
SCMC2_BOVIN     TAPLDRLKV-------------------LMQVHASRSNNMCIVGGFTQMIR-------EGGARSLWRGNG
SCMC1_RABIT     TAPLDRLKVMMQ-------------------------------VHGSKSMNIFRQMIKEGGVRSLWRGNG
SCMC1_HUMAN     TAPLDRLKIMMQV-------------------HGSKSDKMNIFGGFRQMVK-------EGGIRSLWRGNG
SCM2B_DANRE     TAPLDRLKV-------------------LMQVHATRSNSMGIAGGFTQMIR-------EGGLRSLWRGNG
SCMC1_MOUSE     TAPLDRLKVMMQ-------------------------------VHGSKSMNIFRQMVKEGGIRSLWRGNG
SCM1B_XENLA     TAPLDRLKVMMQVHGSKGN---------------------------SNIITGLKQMVKEGGIRSLWRGNG
S2541_MOUSE     TAPLDRARVYMQVYSSKSNFRNLLSG--------------------------LRSLVQEGGVRSLWRGNG
SCMC2_MOUSE     TAPLDRLKV-------------------LMQVHASRSNNMCIVGGFTQMIR-------EGGAKSLWRGNG
MCFG_DICDI      GHPLDTIKVRLQTQ---------SVGNPI----------------YSGTMDCLKKTISQEGFAGLYKGVA
SCMC3_MOUSE     TAPLDRLKVFMQ-------------------------------VHASKSNRLLRNMIQEGGVLSLWRGNG
SCMC1_XENTR     TAPLDRLKVMMQ-------------VHGSKGNANIITG--------------LKQMVKEGGIRSLWRGNG
SCMC1_BOVIN     TAPLDRLKVMMQV-------------------HGSKSAKMNIYGGFQQMVK-------EGGIRSLWRGNG
SCM1A_XENLA     TAPLDRLKVMMQ-------------VHGTKGNSNIITG--------------LKQMVKEGGVRSLWRGNG
SCMC2_RAT       TAPLDRLKV-------------------LMQVHASRSNNMCIIGGFTQMIR-------EGGAKSLWRGNG
AGC1_YEAST      VYPIDFIKTRMQA--------------------------QRSLAQYKNSIDCLLKIISREGIKGLYSGLG
YH66_SCHPO      VTPLDVVKTRLQSE----SISQYSSTQPI-SSAKILGKGRPAPKPLGGPVSGLYQIARHEGVRSLWRGLV
BT1_MAIZE       VAPLETIRTHLM----------------------VGSIGVDSMAG------VFQWIMQNEGWTGLFRGNA
MCATL_RAT       --------------------------HPFDTVKVRLQVQNTEKPQYRGTLHCFQSIIKQESVLGLYKGLG
CMC3_CAEBR      TAPFDRIKVYLQVN--------------------------STKTNKLGVVSCVHLLHAEGGLKSFWRGNG
CMC3_CAEEL      TAPFDRIKVYLQVN--------------------------STKTNKLGVVSCVHLLHAEGGIKSFWRGNG
MFRN1_RAT       MYPVDSVKTRMQS------------LNPDPKAR-----------YTSIYGALKRIMHTEGFWRPL-RGLN
MCATL_MOUSE     --------------------------HPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYKGLG
MCFM_DICDI      LQPFDFLKIRLQGSGFA----------------SGGDLNKFKRVGVIDT---CKNVLKNEGIKQFWRGSS
SCMC1_DANRE     TAPLDRMKVFMQV-------------------HSSKTNKISLVNGFKQMIK-------EGGVASLWRGNG
MFRN1_MOUSE     MYPVDSVKTRMQS------------LNPDPKAR-----------YTSIYGALKRIMHTEGFWRPL-RGLN
MCATL_HUMAN     --------------------------HPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYKGLG
MFRN1_HUMAN     MYPVDSVKTRMQS------------------------LSPDPKAQYTSIYGALKKIMRTEGWRPL-RGVN
ODC2_YEAST      MYPLDVVKTR-----FQLEVTTPTAAAVGKQ-----------VERYNGVIDCLKKIVKKEGFSRLYRGIS
YBT5_SCHPO      TAPLDRLKVMLISD---------TGSKPSPK------------YPFATLLHTTKVLWNRNGIRSFFVGNG
MCP62_HUMAN     GHPLDTVKTRLQ-----------------------------AGVGYGNTLSCIRVVYRRESMFGFFKGMS
CMC2_CAEEL      TAPFDRIKVYLQVN--------------------------SSKTNRLGVMSCLKLLHAEGGIKSFWRGNG
S2540_DANRE     VTPLDVVKIRLQAQ-----------KNPFPKGKCFVYCNGKAPGHFSGTLDAFLKIIRMEGIRSLWSGLP
PM34_DICDI      TYPFSTVSTRLXXXXXXXXXXXXSEITTVPYKNSIDAFKR---------------IIKEENWRTLYSGLK
MCFD_DICDI      GHPFDTIKVMLQD-----------ASGNLPK--------------FKNGFQALKYIMKVDGIKGIYRGLS
MCATL_BOVIN     --------------------------HPFDTVKVRLQVQSVEKPQYRGTLHCFQAIIKQESVLGLYRGLG
FLX1_YEAST      TTPLDLLKVRLQLSATSAQ-----KAHYGP---------------FMVIKEIIRS-SANSGTNELYRGLS
MCFS_DICDI      GHPFDTIRVRLQT------------------SNTPIGI----MECFRNTIK-------YEGFSGLYKGVT
MCAT_MOUSE      GHPLDTVKVRLQT-----QPPSLSGQPPM----------------YSGTLDCFRKTLMREGITGLYRGMA
TPC_MOUSE       ISPLDVIKIR-----FQLQIERLCPSDPNAKYHGI----------FQAAKQILQ----EEGPRAFWKGHV
MCFI_DICDI      FYPLECVEAKLQVQSSSTAVAATMLGLKKNXXXXXXXXXXXXXXHQTPNIAMAKSILRNEGFKGFYQGVS
S2540_XENTR     VTPLDVVKIRLQAQSKPFIKGKCFVYCNGLMDHLCLCTNGNGKAHFRGTTDAFVQIIRNEGIKSLWSGLP
S2541_BOVIN     TAPLDRAKVYMQV--------------------------YSSKKNFMNLLGGLRSLIQEGGIRSLWRGNG
ODC_HUMAN       MHPLDVVKTRFQ----------IQRCATDPNSYKSL-------------VDSFRMIFQMEGLFGFYKGIL
MCFX_DICDI      VFPLDFVKTRLQQQ----------------------RVSIDGSKQYNGIIDCFKKVIKNEGGRGLYRGLS
MCAT_ARATH      GHPFDTIKVKLQSQ-------------PTP--------APGQLPRYTGAIDAVKQTVASEGTKGLYKGMG
YID3_SCHPO      --PLDVVKTRKQAQFYST------------------GGGKNTMV-LGGTLSSMRTIFHNEGIAGLYRGVG
TPC1_COCIM      VAPLDVVKIRL-----QLQIHSLSD----PLSHKNI---RGPV--YKGTISTLKAIFREEGITGLWKGNI
S2543_HUMAN     -----------------------------------------------------------EGLRALWKGNA
CMC_DROME       VYPIDLVKTRMQNQ---------RAGSYIGE------------VAYRNSWDCFKKVVRHEGFMGLYRGLL
AGC1_ASHGO      VYPIDMVKTRMQADFSK----------------------------YKNSIDCLLKILSKEGVRGLYSGLG
S2540_XENLA     VTPLDVVKIRLQAQSKPFIKGKCFVYCNGLMDHLCMCTNGNGKAHFRGTMDAFVQIIRSEGIKSLWSGLP
S2540_HUMAN     VTPLDVVKIRLQAQ-----------NNPLPKGKCFV-YSNGLMDHFQGTLDAFFKIIRNEGIKSLWSGLP
UCPB_DICDI      SNPVDVLKTRFQIHGEGIDSKSLGLVNG--------------------TIKIIKN----EGISAMYKGLT
TPC1_SCLS1      IAPLDVVKIRLQ-------LQSHSASDPL--SHRDL---RGSLI-YKGTLPTIKRIFREEGLSALWKGNV
S2535_DANRE     TNPLEVVKTRMQ---LQGELKS----------------RGTYQVYYRNVFHAFYTIGKIDGLAGLQKGLV
OAC1_SCHPO      TNPFEVIKTRFQ---LQGQLTKLDPSKRI----------------YKSVGQAFSLIARHEGIRGLQRGLG
S2543_MOUSE     -----------------------------------------------------RRVWLSEGPRALWKGNG
S2540_BOVIN     VTPFDVVKIRLQAQ-----------NNPFPKGKCFL-YSNGLMGHFQGTLDAFLKIIRNEGIKSLWSGLP
S2534_RAT       TNPLEVVKTRLQ---LQGELQA-PGTYPRPYRGFVSSVTAVARA---------------DGLWGLQKGLA
MCFL_DICDI      GHPFDTLKVRLQTEGSTGRFRGL--AHC-----------------FTTTIK-------EEGFFALYKGVT
TPC_HUMAN       ISPFDVIKIR-----FQLQHERLSRSDPSAKYHGILQASR----------QILQE----EGPTAFWKGHV
TPC1_MAGGR      IAPLDVVKIRL-------QLQTHSLSDPLSQRAELL---RGGPV-YKGTLSTMRHIARQEGITGLWKGNV
TPC1_BOTFB      IAPLDVVKIRLQ-------LQSHSASDPLSQR----DLRGSPI--YKGTIPTIKRIFREEGLAALWKGNV
TPC_PONAB       ISPFDVIKIR-----FQLQHERLSRSDPNAKYHGILQASR----------QILQE----EGPTAFWKGHI
TPC_BOVIN       ISPLDVIKIR-----FQLQIERLSRSDPNAKYHGILQAGR----------QILQ----EEGPTAFWKGHI
PM34_HUMAN      FFPLDTARLRLQVD----EKRKSKTTH-----------------------MVLLEIIKEEGLLAPYRGWF
MFRN_DICDI      MYPIDTIKTHIQA------------------------IKPGAMQ--TSSLQITKHIIQQHGITGLFRGLT
MCAT_MACFA      ----------------------------------------------------------------------
ODC_PONAB       MHPLDVVKTRFQ----------IQRCATDPNSYKSL-------------VDSFRMIFQTERLFGFYKGIL
MCP62_BOVIN     GHPLDTVKARLQ-----------------------------AGSGYGSTLSCIRTVYRRESVFGFFKGMS
KMCP1_RAT       TFPIDLTKTRLQGQTNDAKFREIRYRGML---HALMRIGRE------------------EGLRALYSGIA
KMCP1_MACFA     TFPIDLTKTRLQGQTNDAKFKEIRYRGML---HALVRIGRE------------------EGLKALYSGIA
S2534_MOUSE     TNPLEVVKTRLQ---LQGELQA-PGTYPRPYRGFVSSVAAVARA---------------DGLWGLQKGLA
KMCP1_MOUSE     TFPIDLTKTRLQGQTNDANFREIRYRGML---HALMRIGRE------------------EGLKALYSGIA
S2540_DICDI     VTPLDVVKTRLQTQ---------NTGSHINQKHV-----------FKGTLDAFKKIYKNEGPLTFWRGVT
S2538_SHEEP     FQPLDLLKTRLQT--------------LQPSAHGSRRVGMLALL-----LTVVRT----ESLLGLWKGMS
S2534_BOVIN     TNPLEVVKTRLQ---LQGELQK-RGTYPRLYRGFVASV-----------VAVVRA----DGLCGLQKGLA
MCFC_DICDI      TAPLERVKIMCQLN------------HGKPIS----------------LISAFKACYKDGGIKGFFRGNL
MCAT_RAT        ----------------------------------------------------------------------
CMC1_CAEEL      ----------------------------------------------------------------------
TPC_MACFA       ISPFDVIKIR-----FQLQHERLSRRDPNAKYHGIFQASR----------QILQE----EGLTAFWKGHI
S2540_RAT       VTPLDVVKIRLQAQ-----------NNPFPKGKCFL-YSNGLMDHFHGTLDAFLKIVRNEGIKSLWSGLP
S2540_MOUSE     VTPLDVVKIRLQAQ-----------NNPFPKGKCFL-YSNGLMDHFRGTLDAFLKILRNEGIKSLWSGLP
KMCP1_HUMAN     TFPIDLTKTRLQGQTNDAKFKEIRYRGML---HALVRIGRE------------------EGLKALYSGIA
TXTP_YEAST      TYPFEFAKTRLQ----------------LIDKASKASRNPLVLIYKTAKTQGIGSIYV---------GCP
CMC2_MOUSE      VYPIDLVKTRMQNQ------------------RSTGSFVGELM--YKNSFDCFKKVLRYEGFFGLYRGLL
ADT1_GOSHI      AAPIERVKLLIQNQ--DEMIKSGRLSEPYKGIGDC----------FKRTIK-------DEGFGSLWRGNT
UCP3_PIG        AQPTDVVKVRFQASI-----------HAGPRSNR----------KYSGTMDAYRTIAREEGVRGLWKGIL
TPC1_ASPNC      VAPLDVVKIRLQ-----LQIHSLSD----PISHRDVTGPI-----YKGTLSTMRDIIRQEGITGLWKGNI
TPC1_ASPFU      VAPLDVVKIRLQ-----LQIHSLSD----PASHHDV-----VGPIYKGTLSTMRTIIKQEGITGLWKGNI
MTM1_YEAST      ---------------------------------------KNSSLKFNGTLEAFTKIASVEGITSLWRGIS
MCAT_HUMAN      ----------------------------------------------------------------------
YP011_YEAST     VSPFERVKILLQVQ------------------SSTTSYNRGI---FSS----IRQVYHEEGTKGLFRGNG
S2543_DANRE     TSPLEVVKILSQVGTFHCKRGFL---------HSFVLICQN------------------EGLRAFWKGNM
PM34_MOUSE      FFPLDTARLRLQVD----EKRKSKTTHA-----------------------VLLEIIKEEGLLAPYRGWF
ODC_SCHPO       LYPLDVVKTRMQ-----------------------LSVGKS---DYNGTFDCLKKIVKNEGPHRLYRGIL
MFRN_CAEEL      MFPFDSVKTRMQS------------LCPCPETKC------------PTPVHSLMSIVKREGWLRPLRGVN
MFRN2_DANRE     MFPIDCVKTRMQ------------------------SLQPEPAARYRNVMDALWRIMRTEGWRPI-RGLN
ADT1_MAIZE      AAPIERVKLLIQNQ--DEMIKSGRLSEPY----------KGIVDCFKRTIK-------DEGFSSLWRGNT
ODC_MOUSE       MHPLDVVKTRFQVQ------RSVTD----PQSYRTVRGS-------------FQMIFRTEGLFGFYKGII
ADT2_YEAST      ASPIERVKLLIQN-----QDEMLKQG----------TLDRK----YAGILDCFKRTATQEGVISFWRGNT
TPC1_NEOFI      VAPLDVVKIRLQ-----LQIHSLSD----PASHRDV-----VGPIYKGTLSTMRAIIKQEGITGLWKGNI
ODC1_YEAST      MYPLDVVKTRM-------QLQVTTKGHP------AVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGIT
MCP62_MOUSE     GYPLDTVKTRLQ-----------------------------AGVGYANTFNCIRMVYKRERVFGFFKGMS
KMCP1_XENLA     TFPIDLTKTRLQ---VQGQ----------PNDAKYKEIRYRGMMH--AIVRIWRE----EGVKALYSGIA
S2539_HUMAN     MTPLDVVKVRLQSQ------RPSMASELMPSSR-LWSLSYTKLTRFTGTMDAFVKIVRHEGTRTLWSGLP
ADT_ORYSJ       AAPIERVKLLIQNQ--DEMIKAGRLSEPYKGIGDC----------FGRTIK-------DEGFASLWRGNT
TPC1_ASPTN      VAPLDVVKIRLQ-----LQIHSLSD----PSSHRNVSGPI-----YKGTISTMRAIIREEGITGLWKGNI
TPC1_LODEL      TAPLDTIKIRL-------QLQTKSHKHPHTQKVSALN--------------VVKDLLKNEGVIALWKGNV
TPC1_EMENI      IAPLDVVKIRLQ-----LQIHSLSD----PTSHAHITGPV-----YKGTLSTIKTILREEGLTGLWKGNI
KMCP1_XENTR     TFPIDLTKTRLQ---VQGQANDAKYKE----------------IRYRGMLHAIVRIWKEEGVKALYSGIA
ADT1_WHEAT      AAPIERVKLLIQNQ--DEMIKAGRLSEPYKGIGDC----------FGRTIK-------DEGFGSLWRGNT
S2542_RAT       ------------------------AVAPLDRTKIIFQVS-SKRFSAKEAFRLLYFTYLNEGFLSLWRGNS
S2542_MOUSE     ------------------------AVAPLDRTKIIFQVS-SKRFSAKEAFRLLYFTYLNEGFLSLWRGNS
MCP62_DANRE     GHPLDTVKTRLQ-----------------------------AGKGYKNTFHCVVTIYKKENVIGFFKGLS
COLT_DROME      GHPLDTIKVRLQT-----------MPRPAPGEQP---LYRGTFDCAAKTIK-------NEGVRGLYKGMS
S2542_XENLA     ---------------------------PLDRTKIIFQVS-SNRFSAKEAYRLIYRTYMNDGFLSLWRGNS
S2538_NEOFI     MMPVTVLKVRYESDYYA--YRSLYSAG--------------------------RDIVRTEGVRGLFSGFG
ADT_CHLRE       AAPIERVKLLIQNQ--DEMIKQGRLASPY----------KGIGECFVRTVR-------EEGFGSLWRGNT
TPC1_ASPOR      VAPLDVVKIRL-----QLQIHSLSD----PTSHQNIK-----GPVYKGTLPTIRSIVREEGITGLWKGNI
S2542_XENTR     ---------------------------PLDRTKIIFQVS-SNRFSAKEAYRLIYRTYLNEGFLSLWRGNS
S2538_ASPCL     LQPADLLKTRVQQSHKSASLLTLKTI--LSSPHPIRSLWRGTLPSALRTG--FGSALYFTSLNALRQGIA
S238A_DANRE     FQPLDLVKTRLQT------------------LHSGVQPGTGRVGMVTVFVNVLRT----EKLLGLWRGVS
SAMC_XENTR      LFPLDTIKTRLQSP---------------------LGFSKSG------------------GFRGIYAGVP
S2542_HUMAN     ------------------------AVAPLDRTKIIFQVS-SKRFSAKEAFRVLYYTYLNEGFLSLWRGNS
CMC1_MOUSE      ---------------------------------------------YKNSFDCFKKVLRYEGFFGLYRGLI
S2539_BOVIN     MTPLDVVKVRLQSQ------RPSVASELMPPSR-LWSLSYAKLTRFTGTMDAFVKIVRHEGTRTLWSGLP
ODC_RAT         MHPLDVVKTRFQVQ------RSVTD----PQSYK--SLRDSFQVIFRT-----------EGLFGFYKGII
ADT_KLULA       AAPIERVKLLIQNQDEMIKQGSLDR-------------------RYTGIVECFKRTAADEGVASFWRGNT
UCP3_BOVIN      AQPTDVVKIRFQASM-----------------HTGLGGNRK----YSGTMDAYRTIAREEGVRGLWKGIL
S2545_MOUSE     GHPFDTVKVRLQTQST-----------------------------YQGIVDCVVKTYRHESVLGFFKGMS
S2545_HUMAN     GHPFDTVKVRLQT---QTTYRGI--------------------------VDCMVKIYRHESLLGFFKGMS
S2538_ASPFU     MMPVTVLKVRYESDYYA--YRSLYSAG--------------------------RDIVRTEGVRGLFSGFG
S2538_ASPFC     MMPVTVLKVRYESDYYA--YRSLYSAG--------------------------RDIVRTEGVRGLFSGFG
MFRN_CAEBR      -------------------------------------------------VHSLMSIVKREGWLRPLRGVN
DIF1_CAEEL      GHPFDTVKVRIQT-------------MPMPKP--------GEKPQFTGALDCVKRTVSKEGFFALYKGMA
UCP3_HUMAN      AQPTDVVKVRFQASIHLGPSRSDRK--------------------YSGTMDAYRTIAREEGVRGLWKGTL
S2542_DANRE     ---------------------------PLDRTKIIFQVS-SNRFSAKEAYRLIYRTYLKDGFFSLWRGNS
S2538_MOUSE     FQPLDLLKTRLQ---------ALQPSDLGPRRVGMLAV----------FLKVVRT----ESLLGLWKGMS
MCFE_DICDI      MHPVDTVRARVQ-------------------------IEKVGKSQYKGTFNALNQIIKNEGVSYLYKGFP
TPC1_AJECN      VAPLDVVKIRLQ-----LQIHSLSD----PLSHRDIKGPI-----YKGTISTLKSIFRDEGITGLWKGNI
PM47A_CANBO     TYPLVTLTTKLKKDQEKEKENSNEDGSLSPKSSNTSDVSQKKISQF----EILKKILKDQGAKGLYNGLE
M2OM_DICDI      THPIDSLKVRMQLQGEGTGVGPKRGALKM-------------LVHINQT----------EGFFTLYKGLS
YM39_YEAST      MHSLDTVKTRQQGAPNVKKYRNMISAY--------------------------RTIWLEEGRRGLYGGYM
MFRN2_MOUSE     MYPIDCVKTRMQ------------------------SLQPDPAARYRNVLEALWRIMRTEGWRPM-RGLN
HDCPB_DANRE     MAPADIVKVRLQC-----------------QTEPVQHISQESSSKYRGPVQCLLRIARDEGLLGLYKGSA
CMC1_PONAB      --PIDLVKTRMQNQ---------------RGSGSVVG-----ELMYKNSFDCFKKVLRYEGFFGLYRGLI
CMC1_HUMAN      --PIDLVKTRMQNQ---------------RGSGSVVG-----ELMYKNSFDCFKKVLRYEGFFGLYRGLI
ADT2_WHEAT      AAPIERVKLLIQNQ--DEMIKAGRLSEPYKGIGDC----------FGRTIK-------DEGFGSLWRGNT
TPC1_YARLI      VFPLDTIRKRLQTDVSYKELSGKPGVQRLLDSYNPFVMA--------------RRIIVAEGCRGLYKGFL
ODC_DICDI       MYPLDVVKTRQQLQVGKGQSM------------------------MSSLVTMVR----HDGLK-MYRGIV
MFRN2_HUMAN     MYPIDCVKTRMQ------------------------SLQPDPAARYRNVLEALWRIIRTEGWRPM-RGLN
MCFA_DICDI      TAPLERIKI-------------------LNQVEVILKDGTK----YNRIIPAFKVIIKEEGIAGLFRGNF
ADT_SCHPO       ----------------------------------------------------------------------
ADT2_MAIZE      AAPIERVKLLIQNQ--DEMIKSGRLSEPY----------KGIADCFKRTIK-------DEGFSSLWRGNT
TPC1_PHANO      -APLDVIKIRLQLQI-----------HSLSEPTSYRGLNGPV---YKGTLGTLKQILRDEGVTGLWKGNI
S2538_BOVIN     FQPLDLLKTRLQT--------------LQPSAHGSRRVGMLALL-----LNVVRT----ESPLGLWKGMS
EAAC_ARATH      TYPLDVLRLRL-------------AVEPRYRTMSQVALS------------MLRD----EGIASFYYGLG
YD1K_SCHPO      GQPFDCVKVRLQSQSNVSPI-------------------------YNNALDCVKKISKNEGLAAFYKGTV
UCP5_MOUSE      TFPVDLTKTRLQVQGQSIDVR-------------FKEIKYRGMFH------ALFRIYKEEGILALYSGIA
CMC2_HUMAN      --PIDLVKTRMQNQ------------------RSTGSFVGELM--YKNSFDCFKKVLRYEGFFGLYRGLL
MFRN1_DANRE     MYPVDSVKTRMQSPDPKAQYRSVYGA--------------------------LKRIVRTEGLLRPLRGLN
ADT1_ARATH      AAPIERVKLLIQNQ--DEMIKAGRLSEPYKGIGDC----------FGRTIK-------DEGFGSLWRGNT
TPC1_YEAS7      TAPMDTIKIRLQ-----------------------LTPANGLKPFGSQVMEVARSMIKNEGIRAFWKGNI
TAAC_ARATH      TYPLDVLRLRL-------------AVEPGYRTMSQVALN------------MLRE----EGVASFYNGLG
S2539_MOUSE     MTPLDVVKVRLQS-----QRPSATSELTTPSRFWSLSYTKSSSARFTGTLDAFVKIVRHEGTRTLWSGLP
S2538_AJECN     MMPVTVIKVRYESDYYAYR--------------SIWGAGRD----------IVRS----EGFRGLFSGFG
UCP5_HUMAN      TFPVDLTKTRLQ-----VQGQSIDA--------------RFKEIKYRGMFHALFRICKEEGVLALYSGIA
S2538_CHAGB     ----------------------------------------STLYNYTSLASAARDIAAHEGARGFFAGYG
ADT4_MOUSE      -----------------------------------------------------------DGLIGLYQGFG
PM47B_CANBO     TYPLVTLTTRLXXXXXXXXXXXXXDGSLSPKSSNTSNISQKKISQF----EILKKILKDQGAKGLYNGLE
OAC1_YEAST      TNPIELIKIRMQLQG---------------------EMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN
ADT1_SOLTU      AAPIERVKLLIQNQ--DEMLKAGRLSEPY----------KGIGECFGRTIK-------EEGFGSLWRGNT
TPC1_YEAST      TAPMDTIKIRLQ-----------------------LTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI
CMC2_MACFA      VTPADVIKTRLQ------------------------VAARAGQTTYSGVIDCFKKILREEGPKALWKG--
S2538_ASPTN     LQPADLLKTRVQSQQTAALLPTLKTI--LSSPHPIRSLWRGTLPSALRTG--FGSALYFTTLNALRQPLA
S2538_ASPNC     LQPADLLKTRVQ----QSQNASL-----LPTVKAILSSPNPIRNLWRGTLP--SALRTGFGSALYFTSLN
S2538_HUMAN     FQPLDLLKTRLQT--------------LQPSDHGSRRVGMLAVL-----LKVVRT----ESLLGLWKGMS
ADT4_MACFA      -----------------------------------------------------------DGIAGLYQGFG
ADT3_YEAST      ----------------------------------------------------------------------
ADT4_HUMAN      -----------------------------------------------------------DGIAGLYQGFG
ADT3_HUMAN      VAPIERVKLLLQVQHASKQI--------------------AADKQYKGIVDCIVRIPKEQGVLSFWRGNL
UCP2_CYPCA      AQPTDVVKVRFQAQN-----------------------SAGANKRYHGTMDAYRTIAKEEGFRGLWKGTG
S2535_MOUSE     TNPLEVVKTRMQ---LQGELQA-------PGTY---------QRHYRNVFHAFFTIGKVDGLAALQKGLG
ADT1_RAT        VAPIERVKLLLQVQHASKQI--------------------SAEKQYKGIIDCVVRIPKEQGFLSFWRGNL
ADT1_MOUSE      VAPIERVKLLLQVQHASKQI--------------------SAEKQYKGIIDCVVRIPKEQGFLSFWRGNL
ADT1_BOVIN      ----------------------------------------------------------------------
YIKC_SCHPO      TYPLDIARTRLSIETAGLTSRSLAINNVANNSLKVKPLTL-----WSTLLYIVQ----HEGYPALYNGLP
UCPA_DICDI      TNPIELVKTRLQ---LQGELQ----------------LSQRI---YNGVWDAFKQIYKTEGIRGLQSGLI
SAMC_XENLA      LFPLDTIKTRLQSP---------------------LGFSKSG------------------GFRGIYAGVP
GDC_MOUSE       VAPLDRVKVLLQ-------------AHNRHYKHGVLST--------------LRAVPQKEGYLGLYKGNG
ARG13_NEUCR     EYPFDTVKVRLQS---QPDHLPLRYTGPLDC--------------FRQSIRA-------DGFLGLYRGIS
ADT_NEUCR       AAPIERIKLLVQN-----QDEMIRAGR----------LDR----RYNGIIDCFKRTTADEGVMALWRGNT
ADT1_ANOGA      VAPIERVKLLLQVQAASKQI--------------------AVDKQYKGIVDCFVRIPKEQGIGAFWRGNL
S2534_DANRE     TNPLEVVKTRLQ---LQGELRARGSYRRL----------------YRGVLQALWVVGRTDGLRGLQKGLT
GDC_BOVIN       VAPLDRVKVLLQA-----------------HNHHYRHLG---------VFSTLRAVPKKEGYLGLYKGNG
UCP3_RAT        AQPTDVVKVRFQA---------------------MIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTW
TXTP_CAEEL      ----------------------------------------------------------------------
TPC1_PICST      TAPLDTIKIRLQ-------------------------LQRSAFRSRVSVTTVVKDLLKNEGAIALWKGNV
S2538_YEAS7     LQPLDLLKTRIQQDKKATLWKNLKEIDPLQLWRGTLP---SALRTSIGSALYLSCLNLMRSSLAKRRNAV
S2538_YEAS1     LQPLDLLKTRIQQDKKATLWKNLKEIDPLQLWRGTLP---SALRTSIGSALYLSCLNLMRSSLAKRRNAV
ORNT1_MOUSE     GQPFDTMKVKMQTDLYRG-------------------LTDCCLKTYSQV-----------GFRGFYKGTS
ADT2_ANOGA      VAPIERVKLLLQVQHISKQIAEAD--------------------RYKGMVDCFVRIPREQGFSAFWRGNL
ADT1_RABIT      ----------------------------------------------------------------------
YQ51_CAEEL      MTPLDVVKIRLQQQTRPFPKGECFYYHNGLMEHVCVSCEVRKPCNFRGTADAIVKIARHEGIRSLWSGLS
TPC1_CANAL      TAPLDTIKIRLQ-------------------------LQPKGFKHRKSVVTIVKNLLENEGIIALWKGNV
S2538_YEAST     LQPLDLLKTRIQQDKKATLWKNLKEIDPLQLWRGTLP---SALRTSIGSALYLSCLNLMRSSLAKRRNAV
ADT2_BOVIN      VAPIERVKLLLQVQHASKQI--------------------TADKQYKGIIDCVVRIPKEQGVLSFWRGNL
ADT2_ARATH      AAPIERVKLLIQNQ--DEMLKAGRLTEPYKGIRDC----------FGRTIR-------DEGIGSLWRGNT
YFG5_SCHPO      -----------------------------------------------------------------YRGCS
S2538_RAT       FQPLDLLKTRLQ---------TLQPSDVGPRRVGMLSV----------FLKVVRT----ETLLGLWKGMS
GDC_HUMAN       VAPLDRVKVLLQAHNHHYKHLGVFSA--------------------------LRAVPQKEGFLGLYKGNG
ADT3_PIG        VAPIERVKLLLQVQHASKQI--------------------AADKQYKGIVDCIVRIPKEQGVLSFWRGNL
ADT3_BOVIN      VAPIERVKLLLQVQHASKQI--------------------AADKQYKGIVDCIVRIPKEQGVLSFWRGNL
ADT2_HUMAN      VAPIERVKLLLQVQHASKQI--------------------TADKQYKGIIDCVVRIPKEQGVLSFWRGNL
MCFJ_DICDI      TNPLDVAKTRLQTGVF-------------PENEK------------PNFYTIIKSTIRKEGIRALWKGLV
HDCPA_DANRE     GYPLDTVKVRIQT---QKQFTGIWQC-------IVLTIRK-------------------EGVHGFFKGMF
UCP3_CANFA      TFPLDTAKVRLQ---IQGENQATQAARRI-QYRGVLGT-------------ILTMVRT-EGPRSPYNGLV
UCP2_HUMAN      TFPLDTAKVRLQQGESQGPVRATASAQYRGVMGTILTMVRT------------------EGPRSLYNGLV
UCP2_CANFA      TFPLDTAKVRLQQGERQGPVRAAASAQYRGVLCTILTMVRT------------------EGPRSLYSGLV
ADT4_BOVIN      --PLDFARTRLGADIGKG-----------PEERQFKGLGDCIM-----------KIAKSDGIVGLYQGFG
ADT2_TACAC      VAPIERVKLLLQVQHASKQI--------------------TADKQYKGIMDCVVRIPKEQGVLSFWRGNL
UCP2_DANRE      AQPTDVLKVRFQAQ-----------------------VSAGASKRYHSTMDAYRTIAKEEGFRGLWKGTG
ADT1_HUMAN      VAPIERVKLLLQVQHASKQI--------------------SAEKQYKGIIDCVVRIPKEQGFLSFWRGNL
UCP4_HUMAN      ANPTDLVKV-------QMQMEGKRKLEGKP-------------LRFRGVHHAFAKILAEGGIRGLWAGWV
UCP3_MOUSE      TFPLDTAKVRLQ----------IQGENPGAQS-----------VQYRGVLGTILTMVRTEGPRSPYSGLV
UCP2_RAT        TFPLDTAKVRLQ---IQGESQGLARTAASAQYRGVLGT-------------ILTMVRT-EGPRSLYNGLV
UCP2_MOUSE      TFPLDTAKVRLQQGESQGLVRTAASAQYRGVLGTILTMVRT------------------EGPRSLYNGLV
TPC1_NEUCR      IAPLDVVKIRLQLQHHSL-------------SDPLLHQRRAEIIGYKGTLPTIRHILRTEGLTGLWKGNI
S2535_HUMAN     TNPLEVVKTRMQ---LQGELQA-------PGTY---------QRHYRNVFHAFITIGKVDGLAALQKGLA
ADT2_PONAB      VAPIERVKLLLQVQHASKQI--------------------TADKQYKGIIDCVVRIPKEQGVLSFWRGNL
S2539_RAT       MTPLDVVKVRLQS-----QRPTVASELTTPSRFWSLSYTKSPSTRFTGTLDAFVKIVRHEGTRTLWSGLP
S2538_COCIM     MMPVTVLKVRYESDYYA--YRSLWGA--------------------------AKDIVRHEGVRGLFAGFG
ORNT1_HUMAN     GQPFDTMKVKMQTDLYRG-------------------LTDCCLKTYSQV-----------GFRGFYKGTS
MCFP_DICDI      VAPLERVKILYQ---IKSELYSLNSVY-------------GSMLKIVE----------NEGIKGLWRGNS
YETC_SCHPO      MYPVDAIKTRMQ---------------------MLNGVSRSVSGNIVNSVIKISST---EGVYSLWRGIS
UCP2_PONAB      TFPLDTAKVRLQI-----------------QGESQGPVHATASAQYRGVMGTILTMVRTEGPRSLYNGLV
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      TIPIDVIKTNLQTQDL------------LPKEKRV----------FNGVISAFKYIIKNEGFKGLTKGLS
ADT_DICDI       ----------------------------------------------------------------------
UCP1_HUMAN      TFPLDTAKVRLQ----------VQGECPT-----------SSVIRYKGVLGTITAVVKTEGRMKLYSGLP
TPC1_VANPO      TFPLDTIRRRLQ----------IRTSSELGQGYIGKHMQRSAI---TLCVQIVRD----EGVKVLFRGIG
TXTP_BOVIN      ----------------------------------------------------------------------
SAMC_DANRE      LFPLDTIKTRLQSQFYKAG-----------------------------------------GFRGIYAGVP
ADT2_SOLTU      AAPIERVKLLIQNQ--DEMIKAGRLSEPYKGIGDC----------FSRTIK-------DEGFAALWRGNT
YAD8_SCHPO      --------------------------------------------------------------KAYYRGLP
S2538_SCLS1     LMPMTIIKVRYESNLYAYK--------------SIMGAGRD--------------IFLTEGFRGFFSGFG
GDC_RAT         VAPLDRVKVLLQA--HNHHYKHLGVLSPL------------------------RAVPQKEGYLGLYKGNG
ADT_CHLKE       VAPIERVKLLLQTQDSNPMIKS------------------GQVPRYTGIVNCFVRVSSEQGVASFWRGNL
ADT2_MOUSE      VYPLDFARTRLAADVGKA----------------------GAEREFKGLGDCLVKIYKSDGIKGLYQGFN
MFRN_DROME      MYPLDSVKTRMQS------------LSPPTKNMNIVS--------------TLRTMITREGLLRPIRGAS
MCFY_DICDI      TCPVDLVK-------IQMQIQGIPSSQPXXXXXXXXXKAKG-------NSYFTKLIYREKGLLGFYQGLS
M2OM_MOUSE      GTPAEVALIRMTAD----------GRLPADQRRGYKNV-------FNALVRIARE----EGVPTLWRGCI
CMC_DICDI       ----------------------------------------------------------------------
ADT2_RAT        VYPLDFARTRLAADVGKA----------------------GAEREFKGLGDCLVKIYKSDGIKGLYQGFN
YQ73_SCHPO      MHSLDTVKTRQQAALYTNK--------------------------YNGMVKCYSTILCEEGFHGLYSGVC
HDMCP_RAT       ----------------------------------------------------------------------
HDMCP_MOUSE     ----------------------------------------------------------------------
ADT_DROME       VYPLDFARTRLAAD-----------------------TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFG
TXTP_RAT        ----------------------------------------------------------------------
TXTP_HUMAN      ----------------------------------------------------------------------
TPC1_KLULA      TAPMDTVKIR-----YQLQ--------PVQEDK------------YKGIASTVRTIMKEEGLRALWKGNI
GHC1_PONAB      TTPMEMLKIQLQDAGRIAAQRKIXXXXXXXXXXXXXXPSVEAPAAPRPTIQLTRDLLRSRGIAGLYKGLG
UCP1_CANFA      TFPLDTAKVRLQIQG-EGQGQPPRAPRYRGVLGTVATLART------------------EGLQKLYSGLP
S2538_BOTFB     LMPMTIIKVRYESNLYA--YKSIAGAG--------------------------RDIFLTEGFRGFFSGFG
MRS3_YEAST      MFPIDALKTRIQS----ANAKSLSAKNMLSQ---------------------ISHISTSEGTLALWKGVQ
GHC2_HUMAN      ----------------------------------------------------------------------
S2538_YARLI     ----------------------------------------SSTYHYKSIVDAATSIYKHNGMRGFFYGWA
MRS4_YEAST      TTPLDCIKTVLQ----------VRGSETVS-----IEIMKDANT-FGRASRAILEVH---GWKGFWRGLK
M2OM_BOVIN      GTPAEVALIRMTAD----------GRLPVDQRRG-----------YKNVFNALFRIVQEEGVPTLWRGCI
HDMCP_HUMAN     ----------------------------------------------------------------------
TPC1_CHAGB      ----------------------------------------------------------------------
S2544_HUMAN     TVPIDVVSQHLMMQ---------RKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYV
S2538_PYRTR     MMPITVLKVRYESNLYAY--------------NSLFTASRD----------IFRT----EGLKGFFAGFG
M2OM_HUMAN      GTPAEVALIRMTAD----------GRLPADQRRGYKNV-------FNALIRITRE----EGVLTLWRGCI
GHC1_HUMAN      TTPMEMLKIQLQDAGRIAAQRKIXXXXXXXXXXXXXXPSVEAPAAPRPTAQLTRDLLRSRGIAGLYKGLG
S2544_PONAB     TVPIDVVSQHLMMQ---------RKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILRADGLRGFYRGYV
MCFV_DICDI      TYPLDVVRIRLS---LQGSCSNDYAAH-----------------RYNGITHSFFKIHKDEGVKGLYKGLG
UCP2_PIG        TFPLDTAKVRLQ---IQGERRGPVQAAASAQYRGVLGT-------------ILTMVR-NEGPRSLYNGLV
UCP1_OCHDA      TFPLDTAKVRLQ---IQGECQT------------------TSGIRYKGVLGTITTLAKTEGPLKLYSGLP
S2538_ASHGO     LQPLDLLKTRLQ----QAQASSLRS---------------------------------------------
GHC1_MOUSE      TTPMEMLKIQLQDAGRIAAQRKIXXXXXXXXXXXXXXPSVEAPAPPRPTAQLTRDLLRNHGIAGLYKGLG
YMC1_YEAST      GQPFDTTKVRLQTS----------------------STPTTAM-------EVVRKLLANEGPRGFYKGTL
ORNT2_HUMAN     ----------------------------------------------------------------------
ADT1_YEAST      AAPIERVKLLMQNQEEMLKQGSLDTRY------------KGILDCFKRTA-------THEGIVSFWRGNT
UCP1_RAT        TFPLDTAKVRLQ---IQGEGQA------------------SSTIRYKGVLGTITTLAKTEGLPKLYSGLP
UCP1_DICGR      TFPLDTAKVRLQ---IQGEGQT------------------SSTIRYKGVLGTITTLAKTEGWPKLYSGLP
SAMC_MOUSE      ------------------------------------------------------------GFRGIYAGVP
S2544_MOUSE     TVPIDVVSQHLMMQ---------RKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYV
S2538_XENLA     FQPLDLVKTRIQ-------------AH---------QLSASAAGSRPRMLNLLIKVVRNENILGLWKGVS
ODC_BOVIN       MHPLDVVKTRFQ----------IQRCTTDPNSYKSLGDS-------------FRMIFRTEGLFGFYKGIL
MFRN1_BOVIN     MYPVDSVKTRMQS------------------------LNPDPKAHYTSVYGALKKIIRTEGWRPL-RGLN
M2OM_RAT        GPPAEVALIRMTAD----------GRLPADQRRGYKNV-------FNALIRIARE----EGVPTLWRGCI
TPC1_DEBHA      TFPLDTLRKRIQ----------------------MLSKTRDIDQNSIKAIQLCKTILKNEGIFGFYKGFS
S2538_LACBS     --PFDLLKTRLQ----QGDGSTWRPTRP----------------HTSIILDITRDVIHSGGWRGLWRGTT
S2535_BOVIN     ----------------------------------------------------------------------
MCFZ_DICDI      ----------------------------------------------------------------------
CMC1_YEAST      TAPFDRLKVFLRTDLSSILLNSLLAKNPNADINKISSPLAKAV----------KSLYRQGGIKAFYVGNG
UCP1_PHOSU      ----------------------------------------------------------------------
UCP1_BOVIN      GQPTEVVKVRLQA---QSHLHG-----PKPR--------------YTGTYNAYRIIATTEGLTGLWKGTS
MPCP_CAEEL      THPLDLVKCRIQVN---------------PEKYTGIATG-------------FRTTIAEEGARALVKGWA
S2538_VANPO     ----------------------------------------------------------------------
GHC1_BOVIN      TTPMEMLKIQLQDAGRLAAQRKIXXXXXXXXXXXXXXPSVEAPATPRPTAQLTRDLLRSRGIAGLYKGLG
DIC_MOUSE       THPLDLLKVHLQTQ-QEVKLRMTGMA-----------------------LQVVRT----DGFLALYNGLS
MFN2B_XENLA     MYPVDCVKTRMQ------------------------SLQPDPAARYRNVMDALSKIVRTEGWRPL-RGLN
DIC1_CANGA      ----------------------------------------------------------------------
SAMC_HUMAN      ------------------------------------------------------------GFHGIYAGVP
LEU5_YEAST      AYPFEIIRRRLQ----------VSALSPKTMDHKFQSISEIAHIIFKE-----------RGVRGFFVGLS
GHC2_RAT        ----------------------------------------------------------------------
S2538_XENTR     FQPLDLVKTRLQ-------------AHQLSAS---AAGSRPRMLNL--FIKVIRNENILGLWR----GVS
S2538_SCHPO     LQPLDLLKTRCQ----QSQRDSL--------------------------PKMVRRIILHEGGFSLWKGTL
UCP1_MESAU      TFPLDTAKVRLQIQ-GEGQI--------------------SSTIRYKGVLGTITTLAKTEGLPKLYSGLP
MFN2A_XENLA     MYPVDCVKTRMQ------------------------SLQPDPAARYRNVMDALSKIVRTEGWRPL-RGLN
M2OM_NEUCR      IQPIDMIKVRIQ----------------------------------------------------------
DIC1_YEAST      THPLDLAKVRLQ-------------AAPMPK---------------PTLFRMLESILANEGVVGLYSGLS
SAMC_DROME      ------------------------------------------------------------GFRGIYKXXX
MPCP_CHOFU      ----------------------------------------------------------------------
MCFN_DICDI      ----------------------------------------------------------------------
GHC2_MOUSE      ----------------------------------------------------------------------
PET8_ASHGO      TTPLDVLKTRM-----------------------MLHERRVPMLH------LARTLFREEGARVFFRGIG
MCFR_DICDI      IAPLERVK--------------------------ILYQVKSKMYSFNSVYGLMKNIIKNEGLAGLWKGNT
YE08_SCHPO      ----------------------------------------------------------------------
TPC1_CANGA      ----------------------------------------------------------------------
YG04_SCHPO      SYPLDTMRTKFAS--------YAKTPHMLPAT---------------------KKIYAEAGIKGFFPGLK
UCP2_BOVIN      ---------------------------------------------YQSTVEAYKTIAREEGFRGLWKGTS
UCP1_SUNMU      GQPTEVAKVRMQA---QSSLHWLKP-------------------RYSGTYNAYYVIVKTEGFLGLWKGTS
UCP1_RABIT      TFPLDTAKVRQQ----------IQGEFPITSG-----------IRYKGVLGTITTLAKTEGPLKLYSGLP
UCP1_MOUSE      TFPLDTAKVRLQ---IQGEGQA------------------SSTIRYKGVLGTITTLAKTEGLPKLYSGLP
S2538_ASPOR     LQPADLLKTRVQQSQNAALLPTIKSIISSPNGPSALRTGFGSALYFT-SLNALRQGLAHTGVPVALSSAS
YMC2_YEAST      VYPLDVVKSIIQND----DLRK-------PKYKNSIS-------------YVAKTIYAKEGIRAFFKGFG
S2538_NEUCR     LQPIDLLKTRVQ----QSGKHSLRAA--------------------------------------------
YB8B_SCHPO      ----------------------------------------------------------------------
S2538_CANGA     ----------------------------------------------------------------------
S2538_MAGGR     --PLTVIKVRYESSLYS--YRSIAGA----------------------AGDILRT----EGPRGFFAGFG
YFL5_YEAST      ----------------------------------------------------------------------
YFL5_YEAS7      ----------------------------------------------------------------------
TPC1_PICGU      TFPLDTLRKRMQ-------MRSSKT--------SIIGLART----------ILR----REGLFGFYKGFG
MTCH1_MOUSE     ----------------------------------------------------------------------
MTCH1_HUMAN     ----------------------------------------------------------------------
MNCP_OXYFA      ----------------------------------------------------------------------
MCAR1_RAT       ----------------------------------------------------------------------
YFL5_YEAS6      ----------------------------------------------------------------------
YFL5_YEAS1      ----------------------------------------------------------------------
S238B_DANRE     ----------------------------------------SGRYNYISVAGALKSVCQNEGPKALYSGLT
MNCP_OXYTR      TNPIDIVYNRMQVDELYPQ---------------------AARRNYSNTVQGLAKV-AEEG--ALFRGAG
ORT1_YEAST      EFPFDTVKVRLQT----------QASNVFPTTWSCIKFT-----------------YQNEGARGFFQGIA
MCAR2_HUMAN     ----------------------------------------------------------------------
YIKC_SCHPO      ----------------------------------------------------------------------
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      ----------------------------------------------------------------------
CMC_DICDI       VTPADVIKTRLQ----------------------------------------------------------
YQ73_SCHPO      ----------------------------------------------------------------------
TPC1_CHAGB      TFPLDLVRKRIQ---VQSPTRGRYVHKNIPE-------------YYGGTVGALRTILQREGLRGLYRGLT
MFN2B_XENLA     ----------------------------------------------------------------------
MFN2A_XENLA     ----------------------------------------------------------------------
YE08_SCHPO      SYPFEVCRRKMQ-------IGGIR------KNKSFLRLK-----------QVVQTTYKEAGMRGFFVGLT
S2538_NEUCR     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIHLXXXXXXXXXXXXXXNPIWLVKTRLQLDKS
YKQ9_SCHPO      PNLIGTIPARSINFFSYGNGKRILADLFN--NGQENSQIHLMXXXXXXXXXXXXXNPIWLVKTRLQLDKK
RIM2_YEAST      PNLVGVIPARSINFFTYGTTKDMYAKAFNN-GQETPM-IHLMXXXXXXXXXXXXXNPIWLIKTRVQLDKA
S2536_CHICK     PNLVGVAPSRAIYFAAYSNCKEKLNNIFNPDSTQ----VHMISAGVAGFTAITMTNPIWLVKTRLQLDAR
S2536_DANRE     PNLVGVAPSRAIYFAAYSTSKEKLNNVFDPDSTQ----VHMLSAGLAGFTAITATNPIWLIKTRLQLDAR
S2533_DANRE     PNLVGVAPSRAIYFAAYSKSKETFNGIF--VPNS--GVVHMSSAGFAAFITNSLMNPIWMVKTRMQLEKK
S2536_HUMAN     PNLVGVAPSRAIYFAAYSNCKEKLNDVFD--PDST--QVHMISAAMAGFTAITATNPIWLIKTRLQLDAR
S2533_MOUSE     PNLVGVAPSRAVYFACYSKAKEQFNGIF--VPNSN--TVHILSAGSAAFVTNTLMNPIWMVKTRMQLERK
S2536_MOUSE     PNLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQ----VHMASAAMAGFTAITATNPIWLIKTRLQLDAR
S2533_HUMAN     PNLVGVAPSRAVYFACYSKAKEQFNGIF--VPNSN--IVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQK
S2533_BOVIN     PNLVGVAPSRAVYFACYSKAKEQFNGVF--VPNSN--IVHVFSAGSAAFVTNSLMNPIWMVKTRMQLERK
MFTC_HUMAN      PNIWGAGLSWGLYFFFYNAIKSYKTEGRA---ERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYD
MFTC_MACFA      PNVWGAGLSWGLYFFFYNAIKSYKTEGRA---ERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYD
YIA6_YEAST      PIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLT----NPIWVVKTRLMLQ--
MCFW_DICDI      PTLVGQIPSWAVYFSTYTFCKELFNDKHSLLEKESPL-IFMXXXXXXXXXXXXXXXPIWLIKTRFITQE-
MCFB_DICDI      TNVIRIAPYSAIQFLSYEKYKNFLNDQ-----THLTTYENLFVGGAAGVTSLLCTYPLDLIRSRLTVQVF
YEA6_YEAST      PTVLGYIPTLMIYFSVYDFCRKYSVDIFPH----SPFLSNXXXXXXXXXXXXXXXNPIWVVKTRLMLQ--
MFTC_MOUSE      PNVWGAGLSWGLYFFFYNAIKSYKTE--GRAEQLEPLE-YLVSAAEAGAMTLCITNPLWVTKTRLMLQYG
S2541_HUMAN     INVLKIAPEYAIKFSVFEQCK----NYFCGIQGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRT
SCMC3_HUMAN     INVLKIAPESAIKFMAYEQIKRAILGQQETLHVQE----RFVAGSLAGATAQTIIYPMEVLKTRLTLRRT
SCM2A_DANRE     INVIKIAPETALKFMAYEQIKRVM----GSSQETLGISERFVAGSLAGVIAQSTIYPMEVLKTRLALRKT
SFC1_YEAST      AVVIGIIPKMAIRFSSYEFYRTLLNKESGIVST---GNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHL
SCMC2_XENTR     INVIKIAPESAIKFMAYEQMKRIIGS------DQETLGIHLVAGSLAGVIAQSSIYPMEVLKTRMALRKT
SCMC2_XENLA     INVIKIAPESAIKFMAYEQIKRIIGS------NQETLGIHERFVAGSLAGVIAQSSPMEVLKTRMALRKT
YBC9_SCHPO      INVLGSAASWGAYFCIYDFSKRVVMSMTPFNNGEISVLQTLCSSGFAGCIVAALTNPIWVVKSRILSKRV
SCMC2_HUMAN     INVLKIAPESAIKFMAYEQIKRLVGS------DQETLRIHLVAGSLAGAIAQSSIYPMEVLKTRMALRKT
SCMC2_BOVIN     INVLKIAPESAIKFMAYEQIKRLIGS------DQETLRIHLVAGSLAGAIAQSSIYPMEVLKTRMALRKT
SCMC1_RABIT     TNVIKIAPETAVKFWVYEQYKKLLTEEGQKIGTFE----RFISGSMAGATAQTFIYPMEVMKTRLAVGKT
SCMC1_HUMAN     TNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFE----RFISGSMAGATAQTFIYPMEVMKTRLAVGKT
SCM2B_DANRE     INVLKIAPESAIKFMAYEQIKRLIGSN-----QETLGILELVSGSLAGAIAQSSIYPMEVLKTRLAL---
SCMC1_MOUSE     TNVIKIAPETAVKFWAYEQYKKLLTEEGQKLGTFE----RFISGSMAGATAQTFIYPMEVLKTRLAVAKT
SCM1B_XENLA     VNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAE----RFVAGSLAGATAQTSIYPMEVLKTRLAV---
S2541_MOUSE     INVLKIAPEYAIKFSVCEQSK----NFFYGVHSSQLFQERVVAGSLAVAVSQTLINPMEVLKTRLTLRFT
SCMC2_MOUSE     INVLKIAPESAIKFMAYEQMKRLVGS------DQETLRIHLVAGSLAGAIAQSSIYPMEVLKTRMALRKT
MCFG_DICDI      SPLVGLSIMNSVMFLAYGQSKTLIQKLSDNPNEXXXXXXXXXXXXXXXXXXXFVDAPVDLFKSQMQVQQ-
SCMC3_MOUSE     INVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQE----RFVAGSLAGATAQTIIYPMEVLKTRLTLRRT
SCMC1_XENTR     VNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAE----RFIAGSLAGATAQTSIYPMEVLKTRLAVGKT
SCMC1_BOVIN     TNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFE----RFVSGSMAGATAQTFIYPMEVLKTRLAVGKT
SCM1A_XENLA     VNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAE----RFIAGSLAGATAQTSIYPMEVLKTRLAVGKT
SCMC2_RAT       INVLKIAPESAIKFMAYEQMKRLVGS------DQETLRIHLVAGSLAGAIAQSSIYPMEVLKTRMALRKT
AGC1_YEAST      PQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFP----EIISGASAGACQVIFTNPLEIVKIRLQVQ--
YH66_SCHPO      PSLTMLLPANTVQFLGYEQLLPLYSDW-GF------PXXXXXXXXXXXXXXXXXVSPIELFRTRVQAVGG
BT1_MAIZE       VNVLRVAPSKAIEHFTYDTAKKFLTPK-GDEPPKIPIPTPLVAGALAGFASTLCTYPMELIKTRVTIEKD
MCATL_RAT       SPLMGLTFINALVFGVQGNTLRALGQ-------DSPLNQFLAGAAAGAIQCVICC-PMELAKTRLQLQAA
CMC3_CAEBR      INVIKIAPESAMKFMSYDQIKRWIQEYKG--GAELTTYERLFAGSSAGAISQTAIYPMEVMKTRLALRRT
CMC3_CAEEL      INVIKIAPESAMKFMCYDQIKRWMQEYKG--GAELSTIERLLAGSSAGAISQTAIYPMEVMKTRLALRRT
MFRN1_RAT       VMMMGAGPAHAMYFACYENMKRTLNDVFSH-----QGNSHLIAGSMATLLHDAVMNPAEVVKQRLQMYNS
MCATL_MOUSE     SPLMGLTFINALVFGVQGNTLRALGQ-------DSPLNQFLAGAAAGAIQCVICC-PMELAKTRLQLQAV
MCFM_DICDI      PTIVASGIAWGTYMHFYEAYKNILKS--KYNVTQLNTFDHFICAVGASATQVFITNPIFLIKTRMQL---
SCMC1_DANRE     VNVIKIAPETAIKFMAYEQYKKLLSKDGGKVQSHE----RFMAGSLAGATAQTAIYPMEVMKTRLTLRKT
MFRN1_MOUSE     VMMMGAGPAHAMYFACYENMKRTLNDVFSH-----QGNSHLVAGSMATLLHDAVMNPAEVVKQRLQMYNS
MCATL_HUMAN     SPLMGLTFINALVFGVQGNTLRALGH-------DSPLNQFLAGAAAGAIQCVICC-PMELAKTRLQLQDA
MFRN1_HUMAN     VMIMGAGPAHAMYFACYENMKRTLNDVFHH-----QGNSHLIAGSMATLLHDAVMNPAEVVKQRLQMYNS
ODC2_YEAST      SPMLMEAPKRATKFACNDQYQKIFKNLFN--TNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS
YBT5_SCHPO      INVLKVMPESSIKFGTYEAMKRVLG-ISSSSENHSPLYSYLAGGMAGSVAQMFIY-PVDTLKFRIQCSDL
MCP62_HUMAN     FPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQKS
CMC2_CAEEL      INVIKIAPESAIKFMCYDQLKRLIQKKKGN--EEISTFERLCAGSAAGAISQSTIYPMEVMKTRLALRKT
S2540_DANRE     PTLIMAVPATVIYFTCYDQLFALLKLKMGDRSDLAP----LFAGAIARVGSATVISPLELIRTKMQSEKQ
PM34_DICDI      SALIGIGASSFVYYYWYTXXXXXXXXXXXXQELGTIENLAIAALAGCANVLTTL--PIWVVNTRLQINSD
MCFD_DICDI      VPLFSVSFTNSVFFATNNNGEDILIPYHKXXXXXXXXXXVISLLI----------TPRDLVKSKLQVQPF
MCATL_BOVIN     SPLLGLTFINALVFGVQGNTLRALG-------RDSPLNQFLAGAAAGAIQCVICC-PMELAKTRLQLQEA
FLX1_YEAST      INLFGNAIAWGVYFGLYGVTKELIYKSVAK-PGETQLKIYLSAGASSGLMTAILTNPIWVIKTRIM----
MCFS_DICDI      SPLFGMMFETAVLFAGYGQMKVLLQK-----DENTPLTVGXXXXXXXXXXXXXXLTPVELVKCRLQVQTT
MCAT_MOUSE      APIIGVTPMFAVCFFGFGLGKKLQEDELSYPQLFTAGML-------SGVFTTGIMTPGERIKCLLQIQAS
TPC_MOUSE       PAQILSIGYGAVQFLAFEELTELL--YQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQ--
MCFI_DICDI      PTILG----NAVNWGVYFSIYRATNHWWNSTDIQGPAWVHSVSAITAGVITTAIVNPFWVLKIRLATSK-
S2540_XENTR     PTLVMAVPATVIYFTCYDQ----LRDILIRSMPERAEIASLVAGATARLWSATLISPLELIRTKMQY---
S2541_BOVIN     INVLKIAPEYAIKFSVFEQCK----NYFCGVHESPPFQERLLAGSLAVATSQTLINPMEVLKTRLTLRRT
ODC_HUMAN       PPILAETPKRAVKFFTFEQYKKLL----GYV-SLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRN
MCFX_DICDI      SNLIGIIPEKAL--------KLAMNDYFSYIKLEEVASGGL-----AGMCQVVATNPMELVKIRMQV---
MCAT_ARATH      APLATVAAFNAVLFTVRGQMEGLLRSEAG-----VPLTIXXXXXXXXXXXXXXXXLPTELIKCRXXXXXX
YID3_SCHPO      PMMLGYLPSWSIYFVVYEKCKVLFGVNKKYTSLHIKASLQIFSAVIAGAASVTLTNPIWVVKTRLQTDRT
TPC1_COCIM      PAELLYIFYGAIQFTTYRTVTQSLHTLPPPYRLPQPAESFVSXXXXXXXXXXXXY-PFDLLRTRFAAQ--
S2543_HUMAN     VACLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSS----IMAGSLAGMVSTIVTYPTDLIKTRLIMQNI
CMC_DROME       PQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWA----EVLAGGCAGASQVVFTNPLEIVKIRLQVAGE
AGC1_ASHGO      PQLIGVAPEKAIKLTVNDHMRATLAGRDGKL--SLPCEI--ISGATAGACQVVFTNPLEIVKIRLQVKSD
S2540_XENLA     PTLVMAVPATVIYFTFYDQLRVIL---IRRMP-ERAEIASLVAGATARLGSATLISPLELIRTKMQY---
S2540_HUMAN     PTLVMAVPATVIYFTCYDQLSALLRSKLG----ENETCIPIVAGIVARFGAVTVISPLELIRTKMQSKKF
UCPB_DICDI      PSLLREATYSTLRM----GGYDVIKNYFIDSNGKTNLLSKVTSGALSGALGACITSPTDLIKVRMQASS-
TPC1_SCLS1      PAELMYVSYSAIQFTTYRSVTLALQDTVGEHRMPXXXXXXXXXXXXXXXXXXXXY-PLDLLRTRFAAQ--
S2535_DANRE     PGLV---------YQFFMNGVRLLTESLGYIHTDVSATKXXXXXXXXXXXXXXXXXPIYLVKTHLQ-SQS
OAC1_SCHPO      TAYVYQICLNGCRLGFYEPIRRTLNTWFLDDPKGNKLAINVXXXXXXXXXXXXXXXPFFLVKTRMQ---S
S2543_MOUSE     VACLRLFPCSMVQLAAYRKFVVLFMDDLGRISQWSS----IVTGSLAGMVSTIVTYPTDLIKTRLMVQNV
S2540_BOVIN     PTLVMAVPATVIYFTCYDQLTALLRSKLG----ENESRIPIVAGIVARLGAVTVISPLELIRTKMQSKKF
S2534_RAT       AGLLYQGLMNGVRFYCYS-----LACQAGL--TQQPXXXXXXXXXXXXXXXXXX-SPAYLVKTQLQA-QT
MCFL_DICDI      PPLLGM---SIINSCMFG----AMNIVKSKIHTDKSTPISLGEIMVSGAITGWIVSPIETVKSKLQVQYT
TPC_HUMAN       PAQILSIGYGAVQFLSFEMLTELVHR--GSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQ--
TPC1_MAGGR      PAELLYITYSAVQFATYRSAAQLLHRVAGEDRQLPXXXXXXXXXXXXXXXXXXXXYPLDLLRTRF-----
TPC1_BOTFB      PAELMYVSYSAIQFTTYRSVTLGLQDAFGELPXXXXXXXXXXXXXXXXXXXXY---PLDLLRTRFAAQ--
TPC_PONAB       PAQILSIGYGAVQFLSFEMLTELVHR--GSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQ--
TPC_BOVIN       PAQLLSIGYGAVQFLSFEALTELV--HRASVRDARDFSVHFLCGGLSACVATLAVHPVDVLRTRFAAQ--
PM34_HUMAN      PVISSLCCSNFVYFYTFNSLKALWVK-----GQHSTTGKDXXXXXXXXXXXXXXTTPLWVVNTRLKLQGA
MFRN_DICDI      XXXXXXXXXXXXXFSIY---ELLKFKFIGSDEDHHPIKVGIAGAIATMTSEAVA-SPMDVVKQRLQLQIT
MCAT_MACFA      -------------------------------------------------------HPLDTVKVRLQ---T
ODC_PONAB       PPILAETPKRAVKFFTFEQYKKLL----GYV-SLSPALTFTIAGLGSGLTEAIVVNPFEVVKVGLQANRN
MCP62_BOVIN     FPLASIAVYNSVVFGVFSNTQRFLSHHRCQEPEAGPPHVLLLASMVAGVVSVGLGAPVDLIEIRLQMQEA
KMCP1_RAT       PAMLRQASYGTIKIGTYQSLKRLAVER----PEDETLLINVVCGILSGVISSAIANPTDVLKIRMQ----
KMCP1_MACFA     PAMLRQSSYGTIKIGTYQSLKRL----FVERPEDETLLINVICGILSGVISSTIANPTDVLKIRMQAQSS
S2534_MOUSE     AGLLYQGLMNGVRFYCYS-----LACQAGL--TQQPXXXXXXXXXXXXXXXXXX-SPAYLVKTQLQA-QT
KMCP1_MOUSE     PAMLRQASYGTIKIGTYQSLKRLAVER----PEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQAQNS
S2540_DICDI     PSLLMTIPSATIYFTSYEYLKEYLNDTEAYNIYTVP----LVAGTLARIFSASVTSPFELLRTNSQIVLQ
S2538_SHEEP     PSIVRCVPGVGIYFGTLYS----LKQYFGHPPTALESVI---LGAGSRSVAGVCMSPITVIKTRYESGRY
S2534_BOVIN     AGLLYQGLMNGVRFYCYSLACQA--------GLSQQPXXXXXXXXXXXXXXXXXXSPAYLVKTQLQAQTV
MCFC_DICDI      ANIIKVSPESAVKFGTYEYVKKL----FAENDCELTSAQRFISGSVAGVVSHTTLFPLEVVRLRLSAEIA
MCAT_RAT        -------------------------------------------------------HPLDTVKVRLQ---T
CMC1_CAEEL      --------------------------------------------------------PIDLVKTRMQNQRT
TPC_MACFA       PAQILSIGYGAVQFLSFEMLTELVHR--GSVYDAREFSVHFVCGGLAACTATLTVHPVDVLRTRFAAQ--
S2540_RAT       PTLVMAVPATVIYFTCYEQLSTFLKTKLG----ENETRIPIVAGIVARFGAVTMISPLELIRTKMQ----
S2540_MOUSE     PTLVMAIPATVIYFTCYEQLSAFLKTKLG----ENETRIPIVAGVVARFGAVTVISPLELIRTKVQSKKF
KMCP1_HUMAN     PAMLRQASYGTIKIGTYQSLKRLFIER----PEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSN
TXTP_YEAST      AFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVI--AGLGAGLLESVAAVTPFEAIKTALIDDKQ
CMC2_MOUSE      PQLLGVAPEKAIKLTV----NDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRLQV---
ADT1_GOSHI      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLD---YARTRLANDAK
UCP3_PIG        PNITRNAIVNCAEMVTYDVIKEKVLDY--HLLTDN-LPCHFVSAFGAGFCATVVASPVDVVKTRYM----
TPC1_ASPNC      PAELMYVCYGVIQFSAYRTTTQALAQLDTYLP---PSAESFVXXXXXXXXXXXXXYPLDLLRTRFAAQ--
TPC1_ASPFU      PAELMYVCYGALQFTAYRTTTQILAQLDPHLP---PALESFVSGAVAGGLATASTYPLDLLRTRFAAQ--
MTM1_YEAST      LTLLMAIPANM----VYFSGYEYIRDV-SPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQ-SIP
MCAT_HUMAN      -------------------------------------------------------HPLDTVKVRLQ---T
YP011_YEAST     LNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQLFSGALCGGCSVVATYPLDLIKTRLSIQTA
S2543_DANRE     VSCLRLFPYSAIHLATYKNIVNLHIDELGDISQWRXXXXXXXXXXXXXXXTY----PLEVVETRLIAQNC
PM34_MOUSE      PVISSLCCSNFVYFYTFNSLKAVWVK-----GQRSSTGKDXXXXXXXXXXXXXXTTPLWVVNTRLKLQGA
ODC_SCHPO       PPILMEAPKRALKFASNDTYSKLWRKVFK--RKDSSPALSILTGSCAGFTETFVVVPFELMKIRLQ-DVK
MFRN_CAEEL      AVAAGSMPAHALYFTVYEKMKGYLT---GNSAGHSNTLAYGASGVVATLIHDAIMNPAEVVKQRMQMAFS
MFRN2_DANRE     ITAVGAGPAHALYFACYERLKKVLSDII-----HPGANSHLAAGCVATLLHDAAMNPTEVVKQRMQMYNS
ADT1_MAIZE      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAG---NLXXXXXXXXXXLFFVYSLDYARTRLANDAK
ODC_MOUSE       PPILAETPKRAVKFSTFELYKKFL----GYMSL-SPGLTFLIAGLGSGLTEAVVVNPFEVVKVGLQVNRN
ADT2_YEAST      ANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYAKWFXXXXXXXXXXXXXXXXFVYSLRTRLAADSK
TPC1_NEOFI      PAELMYVCYGALQFTAYRTTTQVLAQLDPHLP---PALESFVSGAVAGGLATASTYPLDLLRTRFAAQ--
ODC1_YEAST      SPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNS
MCP62_MOUSE     FPLASIAIYNSVVFGVFSNTQRFLSKYCGELEAGPGRSLSLLASMLTGVVSVGLGGPVELIKIRLQMQRE
KMCP1_XENLA     PAMLRQASYGTIKIGTYQSLKRLFVD----CPEDETLVLNAFCGVLSGVVSSCIANPTDVLKIRMQ----
S2539_HUMAN     ATLVMTVPATAIYFTAYDQGRALTSDL--YAPMVAGALARLGTVTVI--------SPLELMRTKLQAQHV
ADT_ORYSJ       ANVIRYFPTQALNFAFKDYFKRLFNDKDGYWKW---FGGNLXXXXXXXXXXLFFVYSLDYARTRLANDAK
TPC1_ASPTN      PAELMYVCYGGVQFTTY----RTTTQALAQLPHRLPQPVEFVXXXXXXXXXXXXXYPLDLLRTRFAAQ--
TPC1_LODEL      PAEILYVMYGAVQFTTYSALSKSLSQMEKDYSIVMPSSVHLLAGVGAGIASTLTTYPFDLLRTRLVANKK
TPC1_EMENI      PAELLYVCYGGIQFTTYRTTTQLLAQLD---PHRLPQPIEFISXXXXXXXXXXXXYPLDLLRTRFAAQGS
KMCP1_XENTR     PAMLRQASYGTIKIGTYQSLKRLFVD----CPEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGS
ADT1_WHEAT      ANVIRYFPTQALNFAFKDYFKRMFNDKDGYWKW---FGGNLXXXXXXXXXXLFFVYSLDYARTRLANDAK
S2542_RAT       ATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRXXXXXXXXXXXXXXXYPLDLVRARMAVTPK
S2542_MOUSE     ATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRXXXXXXXXXXXXXXXYPLDLVRARMAVTPK
MCP62_DANRE     FPLASITLYNSMVFGFFSNTQRLISKY-RYGDGRHPCSMLTVASMLTGLVSVGVGAPVDLVKIRLQMQTA
COLT_DROME      APLTGVAPIFAMCFAGYALGKRLQQR--GEDAKLTYPQIFVAGSFSGLFSTLIMA-PGERIKVLLQTQQG
S2542_XENLA     ATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRXXXXXXXXXXXXXXXYPLDLVRARMAVTQK
S2538_NEOFI     ATAARDAPYAGLYVLFYEQLKRRLASVASSEQSEQPSSINFVSXXXXXXXXTAITNPFDAVKTRLQL---
ADT_CHLRE       ANVIRYFPTQALNFAFKDKFKRM----FGFNKDKEYWKWFXXXXXXXXXXXXVSLSFVYSLRTRLANDAK
TPC1_ASPOR      PAELMYVCYGAIQFAAYRTTTQALSQLDPYLP---PPAESFVXXXXXXXXXXXXXYPLDLLRTRFAAQ--
S2542_XENTR     ATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRXXXXXXXXXXXXXXXYPLDLVRARMAVTPK
S2538_ASPCL     QTRTPLAIASASSDGKARTSSSALPKLSNWANLATGAIARVAAGFVMM--------PVTVLKVRYESDYY
S238A_DANRE     PSFVRCIPGVGIYFSTYFTLKQ------HYFSSGAPGPLQVLLGAGARCVAGVFMLPVTVIKTRFE----
SAMC_XENTR      STAVGSFPNAAAFFVTYESAKQLLRSDSSYLSP----IIHMAAASLGEVVACLIRVPSEVIKQRAQVSPS
S2542_HUMAN     ATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFXXXXXXXXXXXXXYPLDLVRARMAVTPK
CMC1_MOUSE      PQLIGVAPEKAIKLTV----NDFVRDKFTKRDGSIPLPAEILAGGCAGGSQVIFTNPLEIVKIRLQV---
S2539_BOVIN     ATLVMTVPATAAYFTAYDQGRALTSDL--YAPMVAGALARL--------GTVTVISPLELVRTKLQ----
ODC_RAT         PPILAETPKRAVKFSTFELYKKFL----GYMSL-SPGLTFPIAGLGSGLTEAVVVNPFEVVKVGLQVNRN
ADT_KLULA       ANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYAKWFXXXXXXXXXXXXXXXXFVYSLRTRLAADSK
UCP3_BOVIN      PNITRNAIVNCGEMVTYDIIKEKLLDY--HLLTDN-FPCHFVSAFGAGFCATLVASPVDVVKTRYM----
S2545_MOUSE     FPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTFIAGCTGGLLQAYCLAPFDLIKVRLQNQTE
S2545_HUMAN     FPIASIAVVNSVLFGVYSNTLLVLTTSHQERRAQPPSYMHIFLAGCTGGFLQAYCAPFDLIKVRLQNQTE
S2538_ASPFU     ATAARDAPYAGLYVLFYEQLKRRLALVASSEQSEQPSSINFVSXXXXXXXXTAITNPFDAVKTRLQL---
S2538_ASPFC     ATAARDAPYAGLYVLFYEQLKRRLALVASSEQSEQPSSINFVSXXXXXXXXTAITNPFDAVKTRLQL---
MFRN_CAEBR      AVAAGSMPAHALYFTVYEKMKSFLT---GNTAGHEHTLAYGASGVVATLIHDAVMNPAEVVKQRMQMAYS
DIF1_CAEEL      APLVGVSPLFAVFFGGCAVGKWLQQTD----PSQEMTFINANAGALAGVFTTIVMVPGERIKCLLQVQQA
UCP3_HUMAN      PNIMRNAIVNCAEVVTYDILKEKLLDY--HLLTDN-FPCHFVSAFGAGFCATVVASPVDVVKTRYM----
S2542_DANRE     ATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKALPPVPRXXXXXXXXXXXXXXXYPLDMVRARMAVTPK
S2538_MOUSE     PSIVRCVPGVGIYFGTLYSSKQ----YFGHPPTALESVI---LGMGSRSVAGVCMSPITVIKTRYESGTY
MCFE_DICDI      IVATATVPAHALYFLGYEYSKQWVTDRYGKKWGESTIT-HFSAGFVADALGSLIWVPMDIIKQRLQV-QT
TPC1_AJECN      PAELLYICYGGIQFSSY----RAISSALRTLPHPLPQPVESFISGAVAGGIATTSTPLDLLRTRFAAQ--
PM47A_CANBO     SALFGIAVTNFVYYYFYELTGKTLNRRSNPQTASNSKKVALAAGAVAGTISRVATNPIWVANTRMTILSK
M2OM_DICDI      ASLLRQATYTTTRFGLYD----LIKDIVAKDDKPLPFTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGK
YM39_YEAST      AAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTIT----HLSAGFLGDFISSFVYVPSEVLKTRLQLQGR
MFRN2_MOUSE     VTATGAGPAHALYFACYEKLKKTLSDVIH--PGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNS
HDCPB_DANRE     ALALRDGPSFATYFLTYNTICEILTT-----ENQRPGPVVLLAGGVSGMCGWAVGTPMDVIKSRLQVDGV
CMC1_PONAB      PQLIGVAPEKAIKLTV----NDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQV---
CMC1_HUMAN      PQLIGVAPEKAIKLTV----NDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQV---
ADT2_WHEAT      ANVIRYFPTQALNFAFKDYFKRMFNDKDGYWKW---FGGNLXXXXXXXXXXLFFVYSLDYGRTRLANDAK
TPC1_YARLI      VSLIKSAPTSAITMYTFEKSLSIL--------------------------------PLDVVKIRLQLQKD
ODC_DICDI       PPILVEAPKRAIKFASNKFYEKQILSYCGNTPTQMQA---IGSGVLAGITEAFIVVPFELVKIRLQA-KE
MFRN2_HUMAN     VTATGAGPAHALYFACYEKLKKTLSDVIH--PGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNS
MCFA_DICDI      VNIIKAGPQSAIRFYSYGAFKRMASEPDGSISVIN----RMWAGASSGVVSVALTHPLDVIKTHITVIAP
ADT_SCHPO       -------------------------------------------------------------RTRLANDAK
ADT2_MAIZE      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAG---NLXXXXXXXXXXLFFVYSLDYARTRLA--NX
TPC1_PHANO      PAELLYLTYGSVQFSAYTNISQMLDTIPA--PYTLPSSANSFISXXXXXXXXTTVTPLDLLRTRFAAQ--
S2538_BOVIN     PSIVRCVPGVGIYFGTLYS----LKQYFGHPPTALESII---LGAGSRSVAGVCMSPITVIKTRYESGRY
EAAC_ARATH      PSLVGIAPYIAVNFCIFDLVKKSLPEEY-----RKKAQSSLLTAVLSAGIATLTCYPLDTVRRQMQM---
YD1K_SCHPO      LPLLGIGFCVSIQFTTFEYCKR----FFSRDGTPVTMPQYYVSGAISGLANSFLVGPVEHVRIRLQIQT-
UCP5_MOUSE      PALLRQASYGTIKIGIYQSLKRL---FVERLEDET-LLINMICGVVSGVISSTIANPTDVLKIRMQAQGS
CMC2_HUMAN      PQLLGVAPEKAIKLTV----NDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQV---
MFRN1_DANRE     ITVLGAGPAHALYFACYERIKRSLSDVISHIANGVAGSV-------ATVLHDAVMNPAEVVKQRMQMYNS
ADT1_ARATH      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLD---YARTRLANDXX
TPC1_YEAS7      PGSLLYVTYGSAQFSSYSLFNRYLT------PFGLEARLHLVVGAFAGITSSIVSYPFDVLRTRLVANNQ
TAAC_ARATH      PSLLSIAPYIAINFCVFDLVKKSLPEKY-----QQKTQXXXXXXXXXXXXXXGTCYPLDTIRRQMQL---
S2539_MOUSE     ATLVMTVPATAIYFTAYDQGQSLTSDL--YAPMVAGALARM--------GTVTVVSPLELVRTKLQ----
S2538_AJECN     ATAIRDAPYAGLYVVFYEQSKKNLNALFGGLTTARPLSVNFVSGALAAGLATSITNPFDVVKTRLQL---
UCP5_HUMAN      PALLRQASYGTIKIGIYQSLKRL---FVERLEDET-LLINMICGVVSGVISSTIANPTDVLKIRMQAQGS
S2538_CHAGB     ATAVRDAPYAGLYVLFYEQGKKRLSQLFGPMGLQHAASINFASGVLAGVICSVVSNPFDAVKTRIQLQ--
ADT4_MOUSE      VSVQGIIVYRASYFGAYDTVKGLLPK-----PKETPFLVSFIIAQIVTTCSGILSYPFDTVRRRMMMQSG
PM47B_CANBO     SALFGIAVTNFVYYYFYELTGKTLSRRSNPQTTSGSKKVTLAAGAVAGTISRVATNPIWVANTRMTILSK
OAC1_YEAST      AAYIYQIGLNGSRLGFYEPIRSSLNQLF--FPDQEPVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQ-SYS
ADT1_SOLTU      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAG---NLXXXXXXXXXXLFFVYSLDYARTRLANDRK
TPC1_YEAST      PGSLLYVTYGSAQFSSYSLFNRYLT------PFGLEARLHLVVGAFAGITSSIVSYPFDVLRTRLVANNQ
CMC2_MACFA      --------------------------------------------------------PIDLVKTRMQNQRS
S2538_ASPTN     QSLTG------------SNGSANKGTKSSSALPKLSNWANLGTGAVARVAAGFVMMPVTVIKVRYESDYY
S2538_ASPNC     ALRTGLVQT---------NGIAPVTNSSSALP-KLSNTXXXXXXXXXXXXXGFVMMPVTVIKVRYESDYY
S2538_HUMAN     PSIVRCVPGVGIYFGTLYS----LKQYFGHPPT---ALESVMLGVGSRSVAGVCMSPITVIKTRYESGKY
ADT4_MACFA      VSVQGIIVYRASYFGAYDTVKGLLPK-----PKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSG
ADT3_YEAST      ----------------------------------------------------------------------
ADT4_HUMAN      VSVQGIIVYRASYFGAYDTVKGLLPK-----PKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSG
ADT3_HUMAN      ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKHTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
UCP2_CYPCA      PNITRNAIVNCTELVTYDLIKDALLK-SSLMTDDLPC--HFTSAFGAGFCTTVIASPVDVVKTRYM----
S2535_MOUSE     PALLYQFLMNGIRLGTYG-----LAESRGYLHTNTHSPVRXXXXXXXXXXXXXXXSPIYMVKTHLQ---A
ADT1_RAT        ANVIRYFPTQALNFAFKDKYKQIFKQFWRYFXXXXXXXXXXXXTSLCFVY------PLDFARTRLAADVG
ADT1_MOUSE      ANVIRYFPTQALNFAFKDKYKQIFKQFWRYFXXXXXXXXXXXXTSLCFVY------PLDFARTRLAADVG
ADT1_BOVIN      --------------------------------------------------------PIERVKLLLQVQ--
YIKC_SCHPO      ATLLNVVPYVSIXXXXXXXXXXXXXSN-----ADLTAFQKLFLGGFTGIIGQTLTFPADVLRRRFQVNR-
UCPA_DICDI      PAYFSQATMQGIRLGSFD----LISNALGAKPNQDYFFLNLLXXXXXXXXXXXXXSPFDLVKVRMQ----
SAMC_XENLA      STAVGSFPNAAAFFVTYESAKRFLGSDSSYLSP----IIHMAAAFLGELVACLIRVPSEVIKQRAQVSPS
GDC_MOUSE       AMMIRIFPYGAIQFMAF-------EHYKTFITTKLGVSGHLMAGSMAGMTAVICTYPLDVVRVRLAFQVK
ARG13_NEUCR     APLVGAALENSSLFFFERIGRSLLYSS-GFAPRDSELSLSALWFTGGFSGAFTSLTPVELVKCKIQVP-D
ADT_NEUCR       ANVIRYFPTQALNFAFRDKFKKMFGDVDGYWKWMXXXXXXXXXXXXTSLLFVYSLD---YARTRLANDAK
ADT1_ANOGA      ANVIRYFPTQALNFAFKDVYKQV---FLGGVDKNTQFWRYFXXXXXXXXXXXXXXXPLDFARTRLGADV-
S2534_DANRE     AALLGLMNGLRLGSYAQMQAAGV---------TDGPCC-SXXXXXXXXXXXXXXXSPAYLVKTHLQAQTV
GDC_BOVIN       AMMIRIFPYGAIQFMAFEHYKTLITTKLG-----VSGHVHLMAGSMAGMTAVICTYPLDMVRVRLAFQVK
UCP3_RAT        PNITRNAIVNCAEMVTYDIIKEKLLD--SHLFTDN-FPCHFVSAFGAGFCATVVASPVDVVKTRYM----
TXTP_CAEEL      --------------------------------------------------------PTEYVKTQLQLDER
TPC1_PICST      PAEILYVLYGAAQFTTYSSISRWLSHLSDTSGFNLPSSAHLVSGTGAGVVSTLVTYPFDLLRTRLAANSE
S2538_YEAS7     PSLT--------------NDSNIVYNKSSSLPRLTMYE-NLLTGAFARGLVGYITMPITVIKVRYESTLY
S2538_YEAS1     PSLT--------------NDSNIVYNKSSSLPRLTMYE-NLLTGAFARGLVGYITMPITVIKVRYESTLY
ORNT1_MOUSE     PALIANIAENSVLFMCYGFCQQVVRKVVGLDQQAKLSDLNXXXXXXXXXXXXLVLCPTELVKCRLQTMYE
ADT2_ANOGA      ANVIRYFPTQALNFAFKDKYKQV---FLGGVDKNTQFTRYLASGGMAGATSLCFVYPLDFARTRLAADVG
ADT1_RABIT      --------------------------------------------------------PIERVKLLLQVQ--
YQ51_CAEEL      PTMVMALPATVFYFTTYDNLKKKMCCRRAFSPEKTPPSAAAVAGIVARTIAVTVVSPIEMIRTKMQ----
TPC1_CANAL      PAEILYILYGGVQFGSYSISKSVSKLENNYRINLSSANHSLIVGIGSGIVSTLVTYPFDLLRTRL-----
S2538_YEAST     PSLT--------------NDSNIVYNKSSSLPRLTMYE-NLLTGAFARGLVGYITMPITVIKVRYESTLY
ADT2_BOVIN      ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKRTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
ADT2_ARATH      ANVIRYFPTQALNFAFKDYFKRLFNDKDGYWKWFAGNXXXXXXXXXXXXXFVYSLD---YARTRLANDSK
YFG5_SCHPO      TVIVGNSLKAAVRFFAFDSIKKSLSDEHGHL---TGPRTVLAGLGAGVAESVLVLTPFESIKTAIIDDRK
S2538_RAT       PSIVRCVPGVGIYFGTLYSSKQ----YFGHPPTALESVI---LGMGSRSVAGVCMSPITVVKTRYE----
GDC_HUMAN       AMMIRIFPYGAIQFMAFEHYKTLITTKLGI-----SGHVHLMAGSMAGMTAVICTYPLDMVRVRLAFQVK
ADT3_PIG        ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKHTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
ADT3_BOVIN      ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKRTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
ADT2_HUMAN      ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKRTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
MCFJ_DICDI      PSLLTSTPYSMISIFLYEEVKKL---------------------------------PLDVIRTRLQVQGS
HDCPA_DANRE     LPITTISMTSSVVFGTYRNCLQALS----YIRKAENTKLDVFMSGLAGGVAQVSVSPGDIVKVRLQCQTE
UCP3_CANFA      AGLQRQMSFASIRIGLYDSVKQF------YTPKGSDHSTRILAGCTTGAMAVSCAQPTDVVKVRFQASIH
UCP2_HUMAN      AGLQRQMSFASVRIGLYDSVKQF------YTKGSEHASIRLLAGSTTGALAVAVAQPTDVVKVRFQ----
UCP2_CANFA      AGLQRQMSFASVRIGLYDSVKQF------YTKGSEHAGIRLLAGSTTGALAVAVAQPTDVVKVRFQ----
ADT4_BOVIN      VSVQGIIVYRASYFGAYDTVKGLLPK-----PKETHFLVSFFIAQVVTTCSGILSYPFDTVRRRMMMQSG
ADT2_TACAC      ANVIRYFPTQALNFAFKDKYKQI---FLGGVDKRTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
UCP2_DANRE      PNITRNAIVNCTELVTYDLIKDALLK-SSLMTDDLPC--HFTSAFGAGFCTTIIASPVDVVKTRYMNSAQ
ADT1_HUMAN      ANVIRYFPTQALNFAFKDKYKQLFKQFWRYFXXXXXXXXXXXXTSLCFVY------PLDFARTRLAADVG
UCP4_HUMAN      PNIQRAALVNMGDLTTYDTVKHVLNT-----PLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIM---N
UCP3_MOUSE      AGLHRQMSFASIRIGLYDSVKQF------YTPKHSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIR
UCP2_RAT        AGLQRQMSFASVRIGLYDSVKQF------YTKGSEHAGIRLLAGSTTGALAVAVAQPTDVVKVRFQ----
UCP2_MOUSE      AGLQRQMSFASVRIGLYDSVKQF------YTKGSEHAGIRLLAGSTTGALAVAVAQPTDVVKVRFQ----
TPC1_NEUCR      PAELLYVSYAAVQFTTYRSITQFLQAAFPKDQNQLPPSVEFIXXXXXXXXXXXXXYPLDLLRTRFAAQ--
S2535_HUMAN     PALLYQFLMNGIRLGTYG-----LAEAGGYLGTHSPAR-SXXXXXXXXXXXXYLGSPIYMVKTHLQ---A
ADT2_PONAB      ANVIRHFPTQALNFAFKDKYKQI---FLGGVDKRTQFWRYFXXXXXXXXXXXXTSYPLDFARTRLAADVG
S2539_RAT       ATLVMTVPATAIYFTAYDQGQSLTSDL--YAPMVAGALARMGTVTVV--------SPLELVRTKLQAQHV
S2538_COCIM     ATAIRDAPYAGLYVVFYEQXXXXXXXXXXXXPTESTASINFISXXXXXXXXXXITNPFDVVKTRVQLMPS
ORNT1_HUMAN     PALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLNXXXXXXXXXXXXLVLCPTELVKCRLQTMYE
MCFP_DICDI      ATILRVFPYAAVQFLSYETIKN-------HLVADKSSSFQIFLAGSAAGGIAVCATPLDLLRARLAIEIX
YETC_SCHPO      SVIMGAGPSHAIYFSVLEFFKSKIN-----ASPDRPLASAL-AGACAITISDAFMTPFDVIKQRMQLP--
UCP2_PONAB      AGLQRQMSFASVRIGLYDSVKQF------YTKGSEHASIRLLAGSTTGALAVAVAQPTDVVKVRFQ----
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      TRLIHIVPSAGLSFCAYEYIKKLL----------------------------------------------
ADT_DICDI       --------------------------------------------------------PIERVKLLLQVQ--
UCP1_HUMAN      AGLQRQISSASLRIGLYDTVQEFLT-----AGKETAPSLKILAGLTTGGVAVFIGQPTEVVKVRLQAQ--
TPC1_VANPO      LGLLKSVPNTAINLWVYENLMRVL----------------------------------------------
TXTP_BOVIN      --------------------------------------------------------PMETIKVKFIHDQT
SAMC_DANRE      SAAIGSFPNAAAFFVTYESTKSVFS---GYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPS
ADT2_SOLTU      ANVIRYFPTQALNFAFKDYFKRLFNDRDGYWKWFAGNXXXXXXXXXXXXXFVYSLD---YARTRLANDXX
YAD8_SCHPO      ISLTLITPATCLYLSTYVEAKRRFKPSVG-----EGAILYSICGMTAEVVSSFVWTPLEVIKARTQISQK
S2538_SCLS1     ATAIRDAPYAGLYVLFYEQLKKRLSHIVHSVPQSTSASINFGSGVLAAGLATAITNPFDAIKTRIQL---
GDC_RAT         AMMIRIFPYGAIQFMAF-------EHYKTFITTKLGVSGHVHRLMAGSMAGKMSMTPLDVVRVRLAFQVK
ADT_CHLKE       ANVVRYFPTQAFNFAFKDTIKGLFPKYSPKTDFWRFFVVNXXXXXXXXXXXXXIVYPLDFARTRLAADVG
ADT2_MOUSE      VSVQGIIIYRAAYFGIYDTAKGMLPD-----PKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQ--
MFRN_DROME      AVVLGAGPAHSLYFAAYEMTKELTAKF-----TSVRNLNYVISGAVATLIHDAISSPTDVIKQRMQMYNS
MCFY_DICDI      PTLFRDVPGLAIFFTTY----ETLKKQFGQLSTQSPTEFIVLSGGSAGVFYHGLTHPFDIAKTLIQSDRS
M2OM_MOUSE      PTMARAVVVNAAQLASYSQSKQFLLDS-GYFSDNILC--HFCASMISGLVTTAASMPVDIVKTRIQ----
CMC_DICDI       --------------------------------------------------------PIDLVKTRMQ----
ADT2_RAT        VSVQGIIIYRAAYFGIYDTAKGMLPD-----PKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQ--
YQ73_SCHPO      PMLIGSLPATALFFSSYEYTKRHLMSNYNLPET----LCFLLAGFVGDLFASVVYVPSEVLKTRLQLQGR
HDMCP_RAT       ----------------------------------------------------------------------
HDMCP_MOUSE     ----------------------------------------------------------------------
ADT_DROME       VSVQGIIIYRAAYFGFYDTARGMLPD-----PKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSG
TXTP_RAT        --------------------------------------------------------PMETVKVKFIHDQT
TXTP_HUMAN      ----------------------------------------------------------------------
TPC1_KLULA      PATAMYVVYGAVQF---GSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSYPLDLLRTRL-----
GHC1_PONAB      ATLLRDVPLSVVYFPLFAN----LNQ-LGRPASESPFYVSFLXXXXXXXXXXXXXNPCDVVKTRLQSLQR
UCP1_CANFA      AGLQRQVGFASLRIGLYDSVREWLSPGQG---AAASLGSRISAGVMTGGAAVFIGQPTEVVKVRLQAQ--
S2538_BOTFB     ATAIRDAPYAGLYVLFYEELKKRLSHIVHSSPQSTSASINFGSGVLAAGLATAITNPFDAIKTRIQL---
MRS3_YEAST      SVILGAGPAHAVYFGTYEFCKKNLSDTQTHHPFKTAIS-----GACATTASDALMNPFDTIKQRIQLNTS
GHC2_HUMAN      --------------------------------------------------------PIDLAKTRLQNQHG
S2538_YARLI     ATFARDAPYAGLYMLFYEQLKVALPSIFSDITTXXXAMINSVAAATSAGIATTCTNPFDTVKTRMQLAP-
MRS4_YEAST      PRIVANIPATAISWTAYECAKHFL----------------------------------------------
M2OM_BOVIN      PTMARAVVVNAAQLASYSQSKQFLLDS-GYFSDNILC--HFCASMISGLVTTAASMPVDIVKTRIQ----
HDMCP_HUMAN     ----------------------------------------------------------------------
TPC1_CHAGB      --------------------------------------------------------PLDVVKIRLQLQTH
S2544_HUMAN     ASLLTYIPNSAVWWPFY----HFYAEQLSYLPKECPHIVQAVSGPLAAATASILTNPMDVIRTRVQVEGK
S2538_PYRTR     ATAVRDAPYAGLYVLFYEQSKRKLSSLATKIETSTSAGINFVSGVAAAGLGTTITNPFDAIKTRIQL---
M2OM_HUMAN      PTMARAVVVNAAQLASYSQSKQFLLDS-GYFSDNILC--HFCASMISGLVTTAASMPVDIAKTRIQ----
GHC1_HUMAN      ATLLRDVPFSVVYFPLFANLNQL-----GRPASESPFYVSFLXXXXXXXXXXXXXNPCDVVKTRLQSLQR
S2544_PONAB     ASLLTYIPNSAVWWPFY----HFYAEQLSYLPKECPHIVQAVSGPLAAATASILTNPMDVIRTRVQVEGK
MCFV_DICDI      TSIASIVPWVSISFATYEGFKII-----------------------------------------------
UCP2_PIG        AGLQRQMSFASVRIGLYDSVKHF------YTKGSEHAGIRLLAGSTTGALAVAVAQPTDVVKVRFXXXXX
UCP1_OCHDA      AGLQRQISFASLRIGLYDT----VQEFWGGEEATPSLRSKICAGLTTGGVAVFIGQPTEVVKVRLQAQ--
S2538_ASHGO     ----------------------------------------------------------------------
GHC1_MOUSE      ATLLRDVPFSIVYFPLFAN----LNQ-LGRPSSESPFYVSFLXXXXXXXXXXXXXNPCDVVKTRLQSLER
YMC1_YEAST      TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTG
ORNT2_HUMAN     ----------------------------------------------------------------------
ADT1_YEAST      ANVLRYFPTQALNFAFKDKIKSLLSERDGYAKWXXXXXXXXXXXXXXXXXXVYSLD---YARTRLAADAR
UCP1_RAT        AGIQRQISFASLRIGLYDT----VQEYFSS-GRETPASLKISAGLMTGGVAVFIGQPTEVVKVRMQAQ--
UCP1_DICGR      AGIQRQISFASLRIGLYDT----VQEYFSS-GKETPPTLRISAGLMTGGVAVFIGQPTEVVKVRLQAQ--
SAMC_MOUSE      SAAVGSFPNAAAFFLTYEYVKSLLH-------TDSTSHFHMLAASTGEVVACLIRVPSEVVKQRAQVSAS
S2544_MOUSE     ASLLTYIPNSAVWWPFYHFYAEQLS---RLCPQECPHIVQAISGPLAAATASILTNPMDVIRTRVQVEGK
S2538_XENLA     PSFLRCIPGVGLYFSTLYTLK---HHFFSERDPKPLESVMLGAGSRTVAAVCML--PFTVVKTRYESGKY
ODC_BOVIN       PPILAETPKRAVKFFTFEQYKKLL----GYV-SLSPALTFAVAGLGSGLTEAIVVNPFEVVKVGLQANRN
MFRN1_BOVIN     VMMMGAGPAHAMYFACYENMKRTLNAVF------------------------------------------
M2OM_RAT        PTMARAVVVNAAQLASYSQSKQFLLDS-GYFSDNILC--HFCAIMISGLVTTAASMPVDIVKTRIQ----
TPC1_DEBHA      ISILKSAPTSAISLFTY---------------------------------------PLDTIKIRLQLQIQ
S2538_LACBS     PSLVRNVPGVALYMTSLTQLRALMSPYFASLANKNTSSVNLIAGATTRVGVGFLLNPFSVLKARFE----
S2535_BOVIN     --------------------------------------------------------PFDVVSTRLYNQPT
MCFZ_DICDI      ----------------------------------------------------------------------
CMC1_YEAST      LNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSYPIDTLKFRVQCAPL
UCP1_PHOSU      --------------------------------------------------------PLDTAKVRLQIQGE
UCP1_BOVIN      PNLTTNVIINCTELVTYDLMKEALVKN-KLLADDVPC--HFVSAVVAGFCTTVLSSPVDVVKTRF-----
MPCP_CAEEL      PTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLRTSLYLAASASAEFFADILLAPMEATKVRIQTSPG
S2538_VANPO     ----------------------------------------------------------------------
GHC1_BOVIN      ATLLRDVPFSIVYFPLFANLNELGRPASG---EKSPFYVSFLXXXXXXXXXXXXXNPCDVVKTRLQSLQR
DIC_MOUSE       ASLCRQMTYSLTRFAIYETMRDYMTDSQGPLPFYNKVLL----GGISGLTGGFVGTPADLVNVRMQNDMK
MFN2B_XENLA     VTATGAGPAHALYFACYEKLKKTLSD--------------------------------------------
DIC1_CANGA      ----------------------------------------------------------------------
SAMC_HUMAN      SAAIGSFPNAAAFFITYEYVKWFLHDSSSYL---TPMK-HMLAASAGEVVACLIRVPSEVVKQRAQVSAS
LEU5_YEAST      IGYIKVTPMVACSFFVY-----------------------------------------------------
GHC2_RAT        --------------------------------------------------------PIDLAKTRLQ----
S2538_XENTR     PSFLRCIPGVGLYFSTLYTLK---HHFFSERDPKPLESVMLGAGSRTVAAVCML--PFTVVKTRYESGKY
S2538_SCHPO     PSILRSTTGSSCYFY-------FLNWLRHFAPSKNIASSHLWMXXXXXXXXXXXXMPVTVIKVRYE----
UCP1_MESAU      AGIQRQISFASLRIGLYDT----VQEYFS-SGKETPPTLRISAGLMTGGVAVFIGQPTEVVKVRLQAQ--
MFN2A_XENLA     VTATGAGPAHALYFACYEKLKKTLSD--------------------------------------------
M2OM_NEUCR      -------------------------------------------------------NPADLALIRMQ---S
DIC1_YEAST      AAVLRQCTYTTVRFGAYDLLKE------NVIPRETNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSA
SAMC_DROME      XXXXXXXXXXXXFFCTYECGKQFLSSV---TQTKDSPYVHMXXXXXXEVLACLIRVPVEIAKQRSQTLQG
MPCP_CHOFU      --------------------------------------------------------PLDLVKCRLQVDAD
MCFN_DICDI      ----------------------------------------------------------------------
GHC2_MOUSE      --------------------------------------------------------PIDLAKTRLQ----
PET8_ASHGO      PRTMWISAGGAIFLGVY-----------------------------------------------------
MCFR_DICDI      ATILRIFPYSAIQWTSYDYLK---NNFV----TDKKSSVQIFIAGSLGFSCAILLTPLDVIRARLALXXX
YE08_SCHPO      ----------------------------------------------------------------------
TPC1_CANGA      ----------------------------------------------------------------------
YG04_SCHPO      FSVIQIGPYAGCFFMFYRASEAVLSP-LGLALSSTLSGVIAGAGSKAIMF------PVDTVVKTLQTFPS
UCP2_BOVIN      PNVARNAIVNCAELVTYDLIKDTL--LKAHLMTD-DLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAL
UCP1_SUNMU      LNLTRNVIINCTELVVYDVLKEALVKN-NVLADDIPC--HLLAALTAGFCTTALASPVDVVKTRF-----
UCP1_RABIT      AGLQRQISFASLRIGLYDTVQEFFTS-----GEETPSGSKISAGLTTGGVAVFIGQPTEVVKVRLQAQ--
UCP1_MOUSE      AGIQRQISFASLRIGLYDS----VQEYFSS-GRETPASLKISAGLMTGGVAVFIGQPTEVVKVRMQAQ--
S2538_ASPOR     ANGKGVASSSAL--------------------PKLSNSXXXXXXXXXXXXXGFVMMPVTVLKVRYE----
YMC2_YEAST      PTMVRSAPVNGATFLTFELVMRFLGE--------------------------------------------
S2538_NEUCR     -------------------------------------------------------NPFDAVKTRIQLQP-
YB8B_SCHPO      ----------------------------------------------------------------------
S2538_CANGA     ----------------------------------------------------------------------
S2538_MAGGR     ATALRDAPYAGLYVLLYEQFKRRLGGVVSSMGVSRAAAVNFSSGVLAAVACSVVSNPFDAVKTRIQLR--
YFL5_YEAST      ----------------------------------------------------------------------
YFL5_YEAS7      ----------------------------------------------------------------------
TPC1_PICGU      ISLIKTAPTSAVSLFVY-----------------------------------------------------
MTCH1_MOUSE     ----------------------------------------------------------------------
MTCH1_HUMAN     ----------------------------------------------------------------------
MNCP_OXYFA      -------------------------------------------------------NPIDIVYNRMQVDEL
MCAR1_RAT       ----------------------------------------------------------------------
YFL5_YEAS6      ----------------------------------------------------------------------
YFL5_YEAS1      ----------------------------------------------------------------------
S238B_DANRE     ATLLRDAPFSGIYVMFYSQAKKAL-------PQEISSSVNFGCGVVAGILASLATQPADVIKTHMQVSPA
MNCP_OXYTR      ANGFKLAAICSSMTNIYDWCKE--NSYFFFGPHWIN---RLWXXXXXXXXXXXXSMPFDMIRTRLHTMRP
ORT1_YEAST      SPLVGACLENATLFVSYNQCSKFLEKHTNVF----PLGQILISGGVAGSCASLVLTPVELVKCKLQVANL
MCAR2_HUMAN     ----------------------------------------------------------------------
YIKC_SCHPO      ----------------------------------------------------------------------
S2534_HUMAN     --------------------------------------------------------PFDVVSTRLY---N
MCFU_DICDI      --------------------------------------------------------PIDVIKTNLQTQDL
CMC_DICDI       ----------------------------------------------------------------------
YQ73_SCHPO      ----------------------------------------------------------------------
TPC1_CHAGB      VSLLKAAPASAVTMWTY---ERALKFYSG-----------------------------------------
MFN2B_XENLA     --------------------------------------------------------PVDCVKTRMQ----
MFN2A_XENLA     --------------------------------------------------------PVDCVKTRMQ----
YE08_SCHPO      IGYIKVIPMVSTSFFVYNHSKALL----------------------------------------------
S2538_NEUCR     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILXXXXXXXXXDP
YKQ9_SCHPO      S-----GQAAQYRSSIDCIIKTIRLEGFRGLYKGLSASLLGVGESTLQWVLYEKFKHAV-AIRQLRRKEL
RIM2_YEAST      GKTSV----RQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQ
S2536_CHICK     N------RGEKRMSAFECVRKVYRSDGIKGFYRGMSASYAGISETVIHFVIYESIKRKLLEHKTASAMDS
S2536_DANRE     N------RGERRMSAFECVRRVYQSDGLRGFYRGMSASYAGISETVIHFVIYESIKRKLIEHKANSNMDD
S2533_DANRE     ------ARGEKKMNALQCARYVYKTEGMRGFYRGLTASYAGISETMICFLIYETLKKYL-AQSRFTTPDT
S2536_HUMAN     N------RGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTME-
S2533_MOUSE     V------RGCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESLKKCLKDAPIVSSTD-
S2536_MOUSE     T------RGEKQMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLCKTASMMETDE
S2533_HUMAN     V------RGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPL-----A
S2533_BOVIN     V------RGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPL-----A
MFTC_HUMAN      AVVNSPHR--QYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQ---------
MFTC_MACFA      AVINSPHR--QYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQ---------
YIA6_YEAST      --SNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNS
MCFW_DICDI      ----MVGRQKKYRGIVHSMVSIYHEEGFRGLYKGLGPSLLGVLHVGVQFPLYEKFKSILKEKNKNKELGI
MCFB_DICDI      --------GNKYNGIADTCKMIIREEGVAGLYKGLFASALGVAPYAINFTTYENLKKTFIPK--------
YEA6_YEAST      --TGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPLYENLK-------IRFGYSE
MFTC_MOUSE      GVAS-PSQ-RQYKGMFDALVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLK--LKYNKHINRLPE
S2541_HUMAN     G---------QYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDP
SCMC3_HUMAN     G---------QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPAGIDLAVYETLKNWWLQQYSHDSADP
SCM2A_DANRE     G---------QYKGISDCAKHILKTEGMSAFYKGYVPNMLGIIPAGIDLAVYETLKNTWLQRYGTENADP
SFC1_YEAST      TPSE-PNAGPKYNNAIHAAYTIVKEEGVSALYRGVSTAARQATNQGANFTVYSKLKEFLQNYHQ------
SCMC2_XENTR     G---------QYQGMLDCGKKILLKEGVSAFYKGYVPNMLGIIPAGIDLAVYETLKNAWLQRYATSSADP
SCMC2_XENLA     G---------QYQGVLDCGKKILLQEGLSAFYKGYVPNMLGIIPAGIDLAVYETLKNAWLQRYATSSADP
YBC9_SCHPO      N----------YTNPFFGFYDLIKNEGLRGCYAGFAPSLLGVSQGALQFMAYEKLKL-------------
SCMC2_HUMAN     G---------QYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPAGIDLAVYETLKNAWLQHYAVNSADP
SCMC2_BOVIN     G---------QYSGMLDCARKILAREGMAAFYKGYVPNMLGIIPAGIDLAVYETLKNAWLQRYAVNSADP
SCMC1_RABIT     G---------QYSGIYDCAKKILKYEGFGAFYKGYVPNLLGIIPAGIDLAVYELLKSHWLDNFAKDSVNP
SCMC1_HUMAN     G---------QYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPAGIDLAVYELLKSYWLDNFAKDSVNP
SCM2B_DANRE     ------GRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPAGIDLAVYETLKNSWLQRFATDSADP
SCMC1_MOUSE     G---------QYSGIYGCAKKILKHEGFGAFYKGYIPNLLGIIPAGIDLAVYELLKSYWLDNFAKDSVNP
SCM1B_XENLA     ------GRTGQYSGMFDCAKKIMQKEGIRAFYKGYIPNILGIIPAGIDLAIYETLKNYWLQNHAKDSANP
S2541_MOUSE     G---------QYKGLLDCARQILERDGTRALYRGYLPNMLGIIPYACTDLAVYELLQCLWQKLGRDMKDP
SCMC2_MOUSE     G---------QYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPAGIDLAVYETLKNTWLQRYAVNSADP
MCFG_DICDI      ------GDKNQYKSTADCAKQIWKVGGVRGVFQGLGATLVDIPANACYFGAYELCRDFLASKDNISVNQL
SCMC3_MOUSE     G---------QYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPAGIDLAVYETLKNRWLQQYSHESANP
SCMC1_XENTR     G---------QYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPAGIDLAIYETLKTFWLQNYATDSANP
SCMC1_BOVIN     G---------QYSGMFDCAKKILKYEGMGAFYKGYVPNLLGIIPAGIDLAVYELLKSHWLDNFAKDSVNP
SCM1A_XENLA     G---------QYSGMFDCAKKIMQKEGILAFYKGYIPNILGIIPAGIDLAIYETLKNYWLQNYAKDSANP
SCMC2_RAT       G---------QYSGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPAGIDLAVYETLKNTWLQRYAVNSADP
AGC1_YEAST      --SDYVGENIQQAN--ETATQIVKKLGLRGLYNGVAACLMDVPFSAIYFPTYAHLKKDLFDFDPNDKTKR
YH66_SCHPO      HYP--PGHAREIANEVDGLKLMIHQKGILNLWSGVSVTWRDVPFSAFYWWSYERIRLFLLGHPSLQAFSS
BT1_MAIZE       ----------VYDNVAHAFVKILRDEGPSELYRGLTPSLIGVVPAACNFYAYETLKRLYRRATGR-----
MCATL_RAT       ------GPARAYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSGVYFLTYDVLTRAMGCEPGDRLLVP
CMC3_CAEBR      --------GQLDRGMIHFAHKMYDKEGIRCFYKGYLPNLLGIIPAGIDLTVYETLK-------------S
CMC3_CAEEL      --------GQLDKGMFHFAHKMYTKEGIKCFYKGYLPNLLGIIPAGIDLTVYESLKSM------------
MFRN1_RAT       ----------QHQSALSCIRTVWRTEGLGAFYRSYTTQLMNIPFQSIHFITYEFLQ------------EQ
MCATL_MOUSE     ------GPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSGVYFLTYDVMTRAMGCEPGDRLLVP
MCFM_DICDI      ---QTPGSANYYTGIFDGIKKTVKVEGFKGLYKGVIPSLWLTFHGGIQMSSYEHIKFYFSSNSGKSLDS-
SCMC1_DANRE     G---------QYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPAGIDLAVYETLKNTWLSHYAKDTANP
MFRN1_MOUSE     ----------QHQSAFSCIRTVWRTEGLGAFYRSYTTQLMNIPFQSIHFITYEFLQ------------EQ
MCATL_HUMAN     ------GPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSGVYFLTYDALTRALGCEPGDRLLVP
MFRN1_HUMAN     ----------QHRSAISCIRTVWRTEGLGAFYRSYTTQLMNIPFQSIHFITYEFLQ------------EQ
ODC2_YEAST      S----------YLGPMDCLKKTIKNEGIMGLYKGIESTMWALWNGGYFGVIYQVRNSM----------PV
YBT5_SCHPO      S------RGQHGKSILSNAKELYKSVGIRGYYRGVLVGILGMFPSATDLGTFEGLKRTIGILASRDNVDP
MCP62_HUMAN     RAV-APAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLDVPGYCLYFIPYVFLSEITPEACTGPSPCA
CMC2_CAEEL      --------GQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPAGIDLAIYETLKR-------------
S2540_DANRE     S----------YREMSAVIRSALKNEGLRSLWRGWGPTLLDVPFSAMYWFNYEKGKWWLCKRYSCSEPTV
PM34_DICDI      ------------KGIVGQFKYIIKNEGFGGLYKGLIPALILVSNPSVQFVSYEKLRALWRRQSGRTKLGG
MCFD_DICDI      GSTNV---SLQYKGPIDVIRQTIKRDGIKGMFKGIRSTFCDIPGDAVYFVVYEFMKRKLLALSKXXXXXX
MCATL_BOVIN     ------GPARTYRGPLDCLAQIYRQEGLRGVNRGMVSTLLRETPSGVYFLTYDVLTRALGCEPGDRLLVP
FLX1_YEAST      --STSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLD-
MCFS_DICDI      GP-------QKYKGSLDCLVQILKEGGIRGAYRGFTPTIAREFVGNMAFFTYETCKRYFKNKENKPNDDP
MCAT_MOUSE      SGEN------KYSGTLDCAKKLYQEFGIRGFYKGTVLTLMDVPASGMYFMTYEWLKNLFGKSVSDLSVPR
TPC_MOUSE       ------GEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIPYAGLQFSCYRSLKRAYDWLIPPDGKQT
MCFI_DICDI      ----------KYSGMKHAFQSILRSEGVGGFWKGVGVSFIGVSEGLFQFVSYEYILNQMKESNLKMNGGE
S2540_XENTR     -------RPLSYKELRQCIQSSVAKDGWLALWKGWGPTVLDVPFSALYWHNYELVKQSL-----------
S2541_BOVIN     G---------QYKGLLDCARQILEQEGTRALYRGYLPNMLGIIPYACTDLAVYEMLNCLWLKSGRDMKDP
ODC_HUMAN       TFAEQP-------STVGYARQIIKKEGLQGLNKGLTAT-LGGVFNMVYFGFYYNVKNMI-----PVNKDP
MCFX_DICDI      --SGLSGK----KASL---KEVVSELGIKGLYKGTASTLLDVPFSMIYFSIYGRMKHNL-----------
MCAT_ARATH      XXXXXXXXXXKYGGPMDVARHVLRSEGARGLFKGLFPTFARVPGNATMFAAYEAFKRFLA----------
YID3_SCHPO      NVKSSPSQSPAYNNTFDAFRKIYKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEYFKSFL--DDFFGKKSN
TPC1_COCIM      ------GNDKIYPSLLTAIRSIHAHEGSRGFFRGVSAAVAQIVPMGLFFATYESVR---------VPISS
S2543_HUMAN     LEPS-------YRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSASLLVYMNLEKI------------
CMC_DROME       IASGSKIRA----------WSVVRELGLFGLYKGARACLLDVPFSAIYFPTYAHTKAMMAD---------
AGC1_ASHGO      YVADAA------RNSVNAI-SVIKNLGLIGLYRGAGACLLDIPFSAIYFPTYAHIKSNVFNFDPKDSDKR
S2540_XENLA     -------RPLSYKELMICIQSSLAKDGWLSLWKGWGPTVLDVPFSALYWHNYELVKQSL-----------
S2540_HUMAN     S----------YVELHRFVSKKVSEDGWISLWRGWAPTVLDVPFSAMYWYNYEILKKWLCEKSGLY--EP
UCPB_DICDI      -------KGVKYDSISSAFKEIIAKEGIKGLWKGVTTQRAALLTAS-QIPSYDHIKHMILDHGIIQV-DG
TPC1_SCLS1      ------GVERIYTSLRASIRDIAVNEGPRGFFQGLGAGYMGIF-----FATYETLRVPLGTLHMPFGS--
S2535_DANRE     TSSIAVGHQYKHRGMTNALFAIHKQHGILGLWRGASAAIPRVSVSAAQLATFSASKEMVNDLQVFSEGS-
OAC1_SCHPO      YSPKFPGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILTVSGSSVQLPIYNWAKRM------------
S2543_MOUSE     LEPS-------YRGLIHAFSTIYQQEGFLALYRGVSLTVLGVPFSAGSLLVYMNLEKVW-----------
S2540_BOVIN     S----------YEELHRFVSKKVSEDGWISLWRGWAPTILDVPFSAMYWYNYEVLKKWL--CAKSGLYEP
S2534_RAT       GAAVAVGHQHQHQGVLSALETIWRQQGMLGLWRGVGAAVPRVTVSAAQLATFTSAKAWVQD---------
MCFL_DICDI      GV-------KLYNGPIDCIKKI----GIRGLYKALIPTGFQRNSLYAYFGCYELAQRYLRREDGSMTMGR
TPC_HUMAN       ------GEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPAGLQFSCYSSLK--------------
TPC1_MAGGR      -AAQGSGDDRVYQSLRRAVADIWRDEGYRGFFRGITFPFMGIF-----FAAYESLRAPLADL--------
TPC1_BOTFB      ------GIERVYTSLRSSIRDIAISEGPRGFFQGLGAGYMGIF-----FATYESLRLPMGTLNMPF----
TPC_PONAB       ------GEPKVYNTLCHAVGTMYRSEGPQVFYKGLAPTLIAIFPAGLQFSCYSSLK--------------
TPC_BOVIN       ------GEPRVYKTLRDAVVTMYRTEGPLVFYKGLNPTLIAIPYAGFQFSIYSSLKRAYEWALPAEGKKN
PM34_HUMAN      KFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGXXXXXXXXXXXXXXXD
MFRN_DICDI      D----------YKGLTDCTKRIWVKEGIRGFYSGYTTTLMNVPYNIVYFASYESLKKIIQPWFNNKNPE-
MCAT_MACFA      QPPSLPGQPPMYSGTFDCFRKTLFREGIRGLYRGMAAPIIGVTPMAVCFFGFGLGKKLQQKHPEDVLSYP
ODC_PONAB       TFAKQP-------STVGYARQIIKKEGLQGLNKGLTAT-LGGVFNMVYFGFYYNVKNMIPVN--------
MCP62_BOVIN     NLGLKPGEQPAYQGPVHCFATIVRTEGLAGLYRGASAMLLDVPGYCLYFIPYVFLSDWITPEACAGPSPC
KMCP1_RAT       -AQNSAVQGGMIGNFISIYQQ----EGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLIL---------
KMCP1_MACFA     TI-----QGGMIGNFMNIYQQ----EGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLILSGLMG----
S2534_MOUSE     VATMAVGHQHQHQGVLSALETIWRQQGMLGLWRGVGGAVPRVTVSAAQLATFTSAKAWVQD---------
KMCP1_MOUSE     AVQG---------GMIDSFMSIYQQEGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLIL---------
S2540_DICDI     NAGTIPLSSEQRFNSFKLYRDIVNNVGIKGLWRGLGPTLVDVPFSAIYWAGYEVLKNKLMKSQI----DP
S2538_SHEEP     G----------YQSIYAALRSICHSEGFRGLFSGLTATLLDAPFSGIYLMFYSQTKNVV-----------
S2534_BOVIN     AAMAV-GHQHHHESLLGALETIWRQQGLAGLWRGVSAAQLATFASAKAWVQE------------------
MCFC_DICDI      GT---------YNGIFDCFKKAISEKSIRPFYRGLGASITAIPHSGVNMMVYEFLKHKVIKMTGNEFPTA
MCAT_RAT        QPPSLPGQPPMYSGTIDCFRKTLFREGITGLYRGMAAPIIGVTPMAVCFFGFGLGKRLQQKSPEDELTYP
CMC1_CAEEL      SGSFVGEV--MYKNSLDCFKKVVKFEGLLGLYRGLLPQIVGVAEKAIKLTMNDYMRD-------------
TPC_MACFA       ------GEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPAGLQFSCYSSLK--------------
S2540_RAT       ------SKTFSYKELYQIVSMKVSEDGWISLWKGWAPTILDVPFSAMYWYNYENLRRWLCEK--------
S2540_MOUSE     S----------YKELYQFVSMRVSEDGWISLWKGWAPTILDVPFSAMYWYNYENLKRWL--CEKSGLYEP
KMCP1_HUMAN     TI-----QGGMIGNFMNIYQQ----EGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLILSGLMG----
TXTP_YEAST      SATP-----KYHNNGRGVVRNLVRDKGFSGLYRGLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKP
CMC2_MOUSE      -AGEITTGPRVSALSV------VRDLGFFGIYKGAKACFLDIPFSAIYFPCYAHVKASF-----------
ADT1_GOSHI      AAKK--GGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGMYDSLKPVLLTGSMQDSFFA
UCP3_PIG        --NSPPG---QYQNPLDCMLKMVTQEGPTAFYKGFTPSFLRLSWNVVMFVSYEQLKRAL-----------
TPC1_ASPNC      ------GTDRVYTSLMSSVRDIARNEGYAGFFRGCSAAVGQIVPMGLFFATYEALRPPLAQYQDLPF---
TPC1_ASPFU      ------GTERIYTSLLASVRDIARSEGPAGFFRGCSAAVGQIVPMGLFFATYESLRPVLSGLENMPF---
MTM1_YEAST      RSSKSTKTWMMVKDLLNETRQEMKMVGSRALFKGLEITWRDVPFSAIYWSSYELCKERLWLDSTRFASKD
MCAT_HUMAN      QPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMAVCFFGFGLGKKLQQKHPEDVLSYP
YP011_YEAST     NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXVWPTSLGVVPYALNFAVYEQLREFGVNS--------
S2543_DANRE     QEPT-------YRGLLHSLSVIYRNEGLQALYRGFSLTVLGAVPFSVGYAVYINLDKL---------WQE
PM34_MOUSE      KFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAIQFMFYE---------------GX
ODC_SCHPO       NAS-------KYNGTVDCFTKIVKQERILALYNGFEATWRHVVWNAGYFGVIQKIRNSL---------TP
MFRN_CAEEL      ----------PYGSSLECARCVYNREGVAAFYRSYTTQLMNVPFQAIHFMSYEFWQHVL---------NP
MFRN2_DANRE     ----------PYRSVLDCMRCVWQREGALAFYRSYTTQLMNVPFQALHFMTYEYLQELL-----------
ADT1_MAIZE      AAKG--GGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGLYDSIKPVVLTGNLQDNFFA
ODC_MOUSE       LFKEQP-------STFAYARQIIKKEGLQGLNKGLTATLHGIF-NMVYFGFYHNVKNIIPSSK-------
ADT2_YEAST      SSKK--GGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGVVYRGLYFGMYDSLKPLLLTGSLEGSFLA
TPC1_NEOFI      ------GTERIYTSLLASVQDIARNEGPAGFFRGCSAAVGQIVPMGLFFATYESLRPVLSGLENMPF---
ODC1_YEAST      ----------QFKTPIEVVKNSVVKGGVLSLFNGLEATWRHVLWNAGYFGIIFQIRKLL----------P
MCP62_MOUSE     ASHGLKSRAAAYQGPVHCIATIVQMEGLTGLYRGASAMLLGYCFYFIPYVFLSEW---------------
KMCP1_XENLA     -AQGNVMQGGMIVNFINIYQQ----EGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLILSGLMG----
S2539_HUMAN     S----------YRELGACVRTAVAQGGWRSLWLGWGPTALDVPFSALYWFNYELVKSWLNGLRPK---DQ
ADT_ORYSJ       AAKG--GGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGMYDSLKPVVLTGSLQDNFFA
TPC1_ASPTN      ------GTERVYTSLLASVRDIARIEGPAGFFRGCSAAVGQIVPMGLFFATYESLRPSLATVQDLPFGSG
TPC1_LODEL      ---------KNLLSMTGTFRKILHAEGISGLFAGIRPAMISVASTTLMFWSYELAREF--------SSEY
TPC1_EMENI      ------GDNRVYESLFASLRDIAKTEGTVGFFRGCSAAVGQIVPMGLFFATYEALRPVMATAPELSPIPL
KMCP1_XENTR     LI-----QGGMIGNFINIYQQ----EGTRGLWKGLTAQRAAIVVG-VELPVYDITKKHLILSGLMG----
ADT1_WHEAT      ASKG--GGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGLYDSLKPVLLTGTLQVCFFA
S2542_RAT       ---------EMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPAGLSFFTYESLKSLHREYSGRPQPYP
S2542_MOUSE     ---------EMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPAGLSFFTYESLKSLHREYSGRPQPYP
MCP62_DANRE     ENFNLAGNGSVYRGPLHCISTVLQNEGIQGLYRGAGAMILDIPGYALYFIPYTLFCNWLNPDDNS---SP
COLT_DROME      Q-----GGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLDLPANGLYFLVYEALQDVAKSKSETGQIST
S2542_XENLA     ---------EMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPAGISFFTYETLKKL------------
S2538_NEOFI     ----MPGK---YGNMIRAVRLMIREDGVRSLFGGLGLRITKALSSALAWTVYEEL---------------
ADT_CHLRE       SAKK-GGGDRQFNGLVDVYRKTIASDGIAGLYRGFNISCVGVVYRGLYFGMYDSLKPVVLVGPXXXXXXX
TPC1_ASPOR      ------GTERVYTSLYASVRDIAQNEGPKGFFRGCSAA-VGVPYMGLFFATYESLRPVMSGLHDLPFXXX
S2542_XENTR     ---------EMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPAGISFFTYETLKKL------------
S2538_ASPCL     AYRSLVGAGRDI----------VRTEGVRGLFSGFGATAADAPYAGLYVLFYEQLKRRLASVASSEYSEQ
S238A_DANRE     -----SGRYR-YSGVFGALRSVCQTEGPKALFSGLMATLLRDAPFSGIYVMYSQTKNLLPPEISQSSYAP
SAMC_XENTR      STT------------YQMLSATLRQEGIKGLYRGYKSTVLEIPFSLVQFPLWESLKDLW-----------
S2542_HUMAN     ---------EMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPAGLSFFTYETLKSLHREYSGRRQPYP
CMC1_MOUSE      -AGEITTGPRV--SALNVLQDL----GLFGLYKGAKACFLDIPFSAIYFPVYAHCKLLLAD-------EN
S2539_BOVIN     ------AQHLSYRELGTCVRAAVAQGGWRSLWLGWGPTALDVPFSALYWFNYELVK--------------
ODC_RAT         MFTEQP-------STFAYARQIIKKEGFQGLNKGFTATLHGIFNMTYFGFYYNVKDNI-----------P
ADT_KLULA       SAKK--GGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGVVYRGLYFGLYDSLKPLLLTGSLENSFLA
UCP3_BOVIN      --NSPPG---QYHSPFDCMLKMVTQEGPTAFYKGFTPSFLRLSWNVVMFVTYEQMKRAL-----------
S2545_MOUSE     PRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTGMYFVTYEGLCRQYTPEGQNPSSAT
S2545_HUMAN     PRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTGIYFITYEGLCRQYTPEGQNPSSAT
S2538_ASPFU     ----MPGK---YGNMIRAVRLMIREDGVRSLFGGLGLRITKALSSALAWTVYEEL---------------
S2538_ASPFC     ----MPGK---YGNMIRAVRLMIREDGVRSLFGGLGLRITKALSSALAWTVYEEL---------------
MFRN_CAEBR      ----------PYGSSLECARCVYNREGFAAFYRSYTTQLMNVPFQAIHFMGYEFWQQVL---------NP
DIF1_CAEEL      GSA---GSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAYLVYEYLKKKFSGEGAQRTLSP
UCP3_HUMAN      --NSPPG---QYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLSWNVVMFVTYEQLKRAL-----------
S2542_DANRE     ---------EMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPAGLSFFTYETLKK-------------
S2538_MOUSE     S----------YESIYAALRSIYCSEGHRGLFRGLTATLLRDAPFSGLYLMFYSQTRTAV----------
MCFE_DICDI      NTQKLNPNQTYYKGSFHAGKIILQEEGIRGLYRGFMPAFVGIYFS-----VYEKCKSTISSLLSKEKDQY
TPC1_AJECN      ------GNDRIYASLRVSVRDIARTEGPHGFFRGATAAIAQIVPMGLFFAGYEALRSPIASLELPF----
PM47A_CANBO     NQGKL-GK----LNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQYTIFEQLKSFIITYPYITLRSR
M2OM_DICDI      LPFNL---RRNYKNVFDGIFRISKEEGIISLWKGCSPNLIAMFMTAGQVSSYDQTKQLMLASGYFHDDIK
YM39_YEAST      FNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLADLPFSALQFAFYEKFRQLAF---------K
MFRN2_MOUSE     ----------PYHRVTDCVRAVWQNEGAGAFYRSYTTQLMNVPFQAIHFMTYEFLQEHFNPQ--------
HDCPB_DANRE     S-------GRRYRGFLHCITHSVRTEGSGVLFRGLTVNCIRAFPVNMSFAMYEAVVRLL-----------
CMC1_PONAB      -AGEITTGPRV--SALNVLRDL----GIFGLYKGAKACFLDIPFSAIYFPVYAHCKLLLAD-------EN
CMC1_HUMAN      -AGEITTGPRV--SALNVLRDL----GIFGLYKGAKACFLDIPFSAIYFPVYAHCKLLLAD-------EN
ADT2_WHEAT      ASKG--GGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGLYDSLKPVLLTGTLQVCSFA
TPC1_YARLI      GS-------RYYRGIFQTMQQIVRDEGVTALWKGIPAELLYVFYGATQFVTYHHVNQV------------
ODC_DICDI       NAG-------KYTSTMDCVNKTFRAEGLSGFFKGLESTWRHACWNGGYFGLIHTIKSAL--------PKP
MFRN2_HUMAN     ----------PYHRVTDCVRAVWQNEGAGAFYRSYTTQLMNVPFQAIHFMTYEFLQEHFNPQ--------
MCFA_DICDI      TAATIK----------NVTKGIYRDLGIIGFFRGLSAGILNIAPAALNFTFYETIKE--KTQQYILKSPP
ADT_SCHPO       SAKK--GGERQFNGLVDVYRKTYRSDGLRGLYRGFGPSVVGVVYRGLYFGMYDTLKPVVLVGPLEGNFLA
ADT2_MAIZE      XXXXXXXXXRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIVYRGLYFGLYDSIKPVVLTGSLQDNFFA
TPC1_PHANO      ------GKDRVYTSIVASLKSIAQHEGPTGFFRGLGAGVSQIVPMGLFFASYESLKPVMADSPLPLPLGX
S2538_BOVIN     G----------YESVYAALRSICHSEGFRGLFSGLTATLLDAPFSGIYLMFYSQTKNVV-----------
EAAC_ARATH      -------RGTPYKSIPEAFAGIIDRDGLIGLYRGFLPNALTLPNSSIRLTTFDMVKRLI-----------
YD1K_SCHPO      ------GKNVLYHGPWDCIKKISSQYGLSGIMKGYNPTAAREAHGGMYFLAYEAL--VKNTMAKHHLTDR
UCP5_MOUSE      LF-----QGSMIGSFIDIYQQ----EGTRGLWRGVTAQRAAIVVG-VELPVYDITKKHLIVSGMLG----
CMC2_HUMAN      -AGEITTGPRVSALSV------VRDLGFFGIYKGAKACFLDIPFSAIYFPCYAHVKASFANEDGQVSPGS
MFRN1_DANRE     ----------PYRSLYDCVLMVSRKEGLAAFYRSYTQLTMNIPFQAVHFITYEFMQEHFN----------
ADT1_ARATH      XXXXXXXX-RQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIVYRGLYFGLYDSVKPVLLTGDLQDSFFA
TPC1_YEAS7      MHSMSITRE---------VRDIWKLEGLPGFFKGSIASMTTITLTAS--IMFGTYETIRIYCDENEKTTA
TAAC_ARATH      -------KGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALSMPNSSIKLTTFDIVKKLI-----------
S2539_MOUSE     -AQHV-----SYRELASSVQAAVTQGGWRSLWLGWGPTALDVPFSALYWFNYELVK--------------
S2538_AJECN     ----MPNK---YRNMAHAVRLVLREDGVRSLFGGLGLRMRKAISSALAWTVYEEL---------------
UCP5_HUMAN      LF-----QGSMIGSFIDIYQQ----EGTRGLWRGVTAQRAAIVVG-VELPVYDITKKHLIL---------
S2538_CHAGB     -----PGR---YRNMVSGARRMVGEEGVRALWDGLALRMRKAVSSALAWTVYEEL---------------
ADT4_MOUSE      ESD------RQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLVLYDKIKEFL-----------
PM47B_CANBO     NQGKL-GK----LNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQYTIFEQLKSFIVKIKKRNVTP-
OAC1_YEAST      EFIKI-GEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTAGSSVQLPIYNTAKNILVKNDLMKDGPA
ADT1_SOLTU      ASKK--GGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIVYRGLYFGMYDSLKPVLLTGNLQDSFFA
TPC1_YEAST      MHSMSITRE---------VRDIWKLEGLPGFFKGSIASMTTITLTAS--IMFGTYETIRIYCDENEKTTA
CMC2_MACFA      TGSFVGEL--MYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPE----------KAIKLTVNDFVRDKF
S2538_ASPTN     AYRSLYGAGRDI----------VRTEGFRGLFSGFGATAADAPYAGLYVLFYEQLKRHLAGLKHSGTADQ
S2538_ASPNC     AYRSLFGAGRDI----------VRTEGFRGLFSGFGATAADAPYAGLYVLFYEQLKRRLAGXXXXXXXXX
S2538_HUMAN     G----------YESIYAALRSIYHSEGHRGLFSGLTATLLDAPFSGIYLMFYNQTKNIVPHDQVDATLIP
ADT4_MACFA      EAK------RQYKGTLDCFVKIYQHEGINSFFRGAFSNVLRGTGGALVLVLYDKIK--------------
ADT3_YEAST      ---------RQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGVVYRGLYFGMFDSLKPLVLTGSLDGSFLA
ADT4_HUMAN      EAK------RQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIK--------------
ADT3_HUMAN      KS----GTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIYRAAYFGVYDTAKGML--------PDP
UCP2_CYPCA      --NSAPG---QYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLSWNVVMFVTYEQLKRAM-----------
S2535_MOUSE     QAASEIAVGHQYKHQFQALTEIGQKHGLVGLWRGAVGGLPRVVGSSTQLCTFSSIKDLLSQWEIF-----
ADT1_RAT        KGSS----QREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIYRAAYFGVYDTAKGMLP--------DP
ADT1_MOUSE      KGSS----QREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIYRAAYFGVYDTAKGMLP--------DP
ADT1_BOVIN      HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTALNFAFKDKYKQIFLGGVDR-----
YIKC_SCHPO      ----IPGIGHNYKNIKSAIFHIYKTEGINGFFRGYSSNMLKIIPMSITWYTYETVSKML-----------
UCPA_DICDI      -AANMYKNDPQYSSSFAAFKQIIQKEGFKGLTRGLTSAQRTAVGSAIQLSTYGSCKNL------------
SAMC_XENLA      STT------------YQMLSVTLREEGIKGLYRGYKSTVLEIPFSLVQFPLWEFLKNLW-----------
GDC_MOUSE       GEHTYSGIIHAFKTIY------AKEGGFLGFYRGLMPTILGMAPAGVSFFTFGTLKSVGLSYAPALLGRP
ARG13_NEUCR     EPGGAGARQRQLK-PIPVIKEIFRHEGLRGFWHGQCAAWFGSKETTSKWFRGRNERALLKRGASQEEVVA
ADT_NEUCR       SAKK--GGERQFNGLVDVYRKTIASDGIAGLYRGFGPSVAGVVYRGLYFGLYDSIKPVLLVGDLKNNFLA
ADT1_ANOGA      ------GRGREFNGLLDCLKKTVKSDGIIGLYRGFNVSVQGI-------IIYRAAYFGCFDTAKGMLPDP
S2534_DANRE     AAIAV-GHQHNHQGMSSALVSIYRREGVCGLWRGVNGAVPRVVGSATQLATFSSAKDWI-----------
GDC_BOVIN       GEHTYTGIIHAFKTIY------AKEGGFLGFYRGLMPTILGMAPAGVSFFTFGTLKSVGLSYAPTLLGRP
UCP3_RAT        NAP--PGR---YRSPLHCMLRMVAQEGPTAFYKGFMPSFLRLSWNVMMFVTYEQLKRAL-----------
TXTP_CAEEL      SATP------KFRGPIDCVKQTVNGHGFFGLYRGLSVLLYGIPKSSFRFGTFEYLK-----------SQA
TPC1_PICST      ---------KKLLSMSGTAREIISSEGFTGLFAGIKPAMLSITTTGLMFWSYELVRETLGDRDIPF----
S2538_YEAS7     NYSSLK----------EAITHIYTKEGLFGFFRGFGATCLDAPYAGLYVLLYEKSKQLLPMVLPSRFIH-
S2538_YEAS1     NYSSLK----------EAITHIYTKEGLFGFFRGFGATCLDAPYAGLYVLLYEKSKQLLPMVLPSRFIH-
ORNT1_MOUSE     METS--GKIAASQNTVSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFF----------
ADT2_ANOGA      KGAE----AREFKGLGDCISKIFKTDGLVGLYRGFGVSVQGI---------------IIYRAAYFGFYDT
ADT1_RABIT      HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTALNFAFKDKYKQIFLGGVDR-----
YQ51_CAEEL      ------SKRLTYHEIGHLVRSSMATKGISSFYLGWTPTMLDIPFSGIYWAGYDLFKTNL-----QRRQGP
TPC1_CANAL      ----IANKNRGLLSMTGTIKDIIKLEGIRGIYAGIRPAMLSVSSTTLMFWSYELARELSNNYQRVPFIEA
S2538_YEAST     NYSSLK----------EAITHIYTKEGLFGFFRGFGATCLDAPYAGLYVLLYEKSKQLLPMVLPSRFIH-
ADT2_BOVIN      KA----GAEREFRGLGDCLVKIYKSDGIRGLYQGFNVSVQGIIYRAAYFGIYDTAKGMLP--------DP
ADT2_ARATH      SAKKGGGE-RQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIVYRGLYFGLYDSVKPVLLTGDLQDSFFA
YFG5_SCHPO      RPNP------RLKGFLQASRIIVHENGIRGLYRGLAATVARAANSGVRFTAYNSIKQSLQSRLPP-----
S2538_RAT       ------SGAYSYESVYAALRSIYCSEGSRGLFRGLTATLLRDAPFSGLYLMFYSQTRATV----------
GDC_HUMAN       GEHSYTGIIHAFKTIY------AKEGGFFGFYRGLMPTILGMAPAGVSFFTFGTLKSVGLSHAPTLLGRP
ADT3_PIG        KSAT----EREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGI-------IIYRAAYFGVYGTAKGMLPDP
ADT3_BOVIN      KS----GSEREFRGLGDCLVKITKSDGIRGLYQGFNVSVQGIIYRAAYFGIYDTAKGML--------PDP
ADT2_HUMAN      KA----GAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIYRAAYFGIYDTAKGMLP--------DP
MCFJ_DICDI      Q--NVIQSFPQYNGTFDGFKKLIRLEGKRALYKGFLTSECGLCSRAIYFGSYEFVKQ-------------
HDCPA_DANRE     SRHSVNPKYSKYSGPIHCLLSICREQGLSGLYRGALPLALGPSFATYFLTYHTLCARLTPDGQKEPEWTV
UCP3_CANFA      LGA---GSNRKYSGTMDAYRTIAREEGVRGLWKGTLPN---ITRNAIEMVTYDIIKEKLLDYHLLTDNFP
UCP2_HUMAN      -AQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVANAIVNCAELVTYDLIKDALLKANLMTDDLP
UCP2_CANFA      -AQARAGSGRRYQSTVDAYKTIAREEGFRGLWKGTSPNVANAIVNCAELVTYDLIKDALLKANLMTDDLP
ADT4_BOVIN      EAE------RQYKGTLDCFMKIYQQEGIGAFFRGAFSNILRGTGGALVLVLYDKIKDLL-----------
ADT2_TACAC      KA----GDAREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIIYRAAYFGIYDTAKGML--------PDP
UCP2_DANRE      G---------QYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLSWNVVMFVTYEQLKRAM-----------
ADT1_HUMAN      KGA----AQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIYRAAYFGVYDTAKGMLP--------DP
UCP4_HUMAN      QPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPSMVFWLTYEKIREM------------
UCP3_MOUSE      LGT---GGERKYRGTMDAYRTIAREEGVRGLWKG---TWPNITRNAIEMVTYDIIKEKLLESHLFTDNFP
UCP2_RAT        -AQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVANAIVNCTELVTYDLIKDTLLKANLMTDDLP
UCP2_MOUSE      -AQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVANAIVNCAELVTYDLIKDTLLKANLMTDDLP
TPC1_NEUCR      ------GVERVYPSLVQALKTIYASEGVTGYFRGLGPGLAQIIPMGTFFCVYETLRPRLSKLELP-----
S2535_HUMAN     QAASEIAVGHQYKHQFQALTEIGQKHGLVGLWRGALGGLPRVVGSSTQLCTFSSTKDLLSQWEIF-----
ADT2_PONAB      KA----GAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIYRAAYFGIYDTAKGMLP--------DP
S2539_RAT       S----------YRELXXXXXXXXXXXXWRSLWLGWGPTALDVPFSALYWFNYELVK--------------
S2538_COCIM     ----------KYKNMMRATALMLREDGMRSLFGGLGLRMRKALSSALAWTVYEEL---------------
ORNT1_HUMAN     METS--GKIAKSQNTVSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDEVP
MCFP_DICDI      XXXXXXXXXXX---------STFTKDGVKGIYRGIQPTLIGILPGGISFSTFEFLKRIAPLNEID---EN
YETC_SCHPO      --------SRKYKSALHCATTVFRNEGLGAFYISYTCIAMSIPFTAIQVATYDTCMSFL---------NP
UCP2_PONAB      -AQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVANAIVNCAELVTYDLIKDALLKANLMTDDLP
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      ----------------------------------------------------------------------
ADT_DICDI       SASTQIAADKQYKGIVDCFVRVSKEQGVISLWRGNLANVIRYFPTALNFAFKDKYKKFFVRHTAKE----
UCP1_HUMAN      --SHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMSVIINCTELVTYDLMKEAFVKNNILADDVP
TPC1_VANPO      ----------------------------------------------------------------------
TXTP_BOVIN      SASP------KYRGFFHGVREIVREQGLKGTYQGLTATVL--KQGSNQGIRFFVMTSLRNWYRGDNPNKP
SAMC_DANRE      ISTY-----RVLLNSL-------QEEGFRGLYRGYGSTVLEIPFSLVQFPLWEYLKAVWW----------
ADT2_SOLTU      XXXXXXXX-RQFDGLVDVYRKTLKSDGVAGLYRGFNISCVGIVYRGLYFGMYDSLKPVLLTGKMEDSFFA
YAD8_SCHPO      GSV------------INTISTLARSEGLKGFYRGYVAIYLPTTVS--WWVCYEESKKYLQKQSNWDISVI
S2538_SCLS1     -------QPKKYTNLVMAGRKMVGEEGVKSLFDGLGLRMRKAVSSALAWTIYEELIR-------------
GDC_RAT         GEHTYSGIIHAFKTIY------AKEGGFLGFYRGLMPTILGMAPASVSFFTFGTLKSVGLSYAPTLLGRP
ADT_CHLKE       S-----GKSREFTGLVDCLSKVVKRGGPMALYQGFGVSVQGIVYRGAYFGLYDTAKGVLFK---------
ADT2_MOUSE      --SGRKGTDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKK-------------
MFRN_DROME      ----------PYTSVVSCVRDIYKREGFKAFYRAYTQLVMNLPYQTIHFTTYEFFQNKM--NLERKYNPP
MCFY_DICDI      --------ATKYKGTFDCLKQVYQNQGPKSLFKGFSAVAIKSFQSNAVGFLVYEM---------------
M2OM_MOUSE      NMRMIDGKP-EYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLPHTVLTFIFLEQMNK-------------
CMC_DICDI       NQRAVDPAKRLYVNSWDCFKKVVKFEGVRGLYKGILPQMVGV----------------------------
ADT2_RAT        --SGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK-------------
YQ73_SCHPO      YNNPHFQSNYNYPSFRGAVKQIAKQEGMKTFFYGYRATILDIPFSGFQLLFYEKLRQV------------
HDMCP_RAT       ----------KYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHSATYFLSYAVLSEWLTPAGQSQPDXX
HDMCP_MOUSE     ----------KYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHSFATYFLSYAM---------------
ADT_DROME       RKATEV----IYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL-----------
TXTP_RAT        SSNP------KYRGFFHGVREIVREQGLKGTYQGLTATVL--KQGSNQAIRFFVMTSLRNWYQGDNPNKP
TXTP_HUMAN      ----------KYRGFFHGVREIVREQGLKGTYQGLTATVL--KQGSNQAIRFFVMTSLRNWYRGDNPNKP
TPC1_KLULA      ----IANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTSTAIMFLTYETVNIVCE----------
GHC1_PONAB      GVNE-----DTYSGILDCARKILRHEGLKGAYRALVIAFLGIAESLL-----------------------
UCP1_CANFA      --SHLHGRKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMNVIINCTELVTYDLMKEALVKNHLLADDLP
S2538_BOTFB     -------QPKKYTNLVMAGKKMVGEEGVKSLFDGLGLRMRKAVSSALAWTIYEELIR-------------
MRS3_YEAST      ------------ASVWQTTKQIYQSEGLAAFYYSYTTLVMNIPFAAFNFVIYESSTKFL---------NP
GHC2_HUMAN      KA--------MYKGMIDCLMKTARAEGFFGMYRGAAVNLTLVTEKAIKLAANDFFRRLLMEDGMQRNLKM
S2538_YARLI     ---------KEYPNFLTSVKTIIQHEGIQALFRGLALRICKACQAGISWCIYEDL---------------
MRS4_YEAST      ----------------------------------------------------------------------
M2OM_BOVIN      NMRMIDGKP-EYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLPHTVLTFIFLEQMNK-------------
HDMCP_HUMAN     ----------KYRGPLHCLATVAREEGLCGLYKGSSALVLRDGHSFATYFL-----------------SY
TPC1_CHAGB      SLSDPLSHGPIYKGTLPTLRHILRSEGITGLWKGVPAELLYVCYSAIQFTTYRTTTLLL-----------
S2544_HUMAN     NSIIL------------TFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVYESLKKL------------
S2538_PYRTR     ----MPER---YGNMVQATKKMYMEEGLRCFFDGLGIRIAKAVSSALAWTLYEELIR-------------
M2OM_HUMAN      NMRMIDGKP-EYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLPHTVLTFIFLEQMNK-------------
GHC1_HUMAN      GVNE-----DTYSGILDCARKILRHEGLKGAYRALVIAFLGIAESLL-----------------------
S2544_PONAB     NSIIL------------TFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVYESLKKL------------
MCFV_DICDI      ----------------------------------------------------------------------
UCP2_PIG        XXXXXX-----YRSTVDAYKTIAREEGLRGLWKGTSPNVANAIVNCAELVTYDLIKDTLLKADLMTDDLP
UCP1_OCHDA      --SHLHGLKPRYTGTYNAYRIIATTESLSTLWKGTTPNLLNIIINCTELVTYDLMKGALVRNDILADDVP
S2538_ASHGO     -----------YNGLAEATRHIWRSEGARGFFKGAAATTLDAPYAGLYVLLYEQAKEMLPRALPATLLGA
GHC1_MOUSE      GVNE-----DTYSGFLDCARKIWRHEGLKGAYRALVIAFLGIAESLL-----------------------
YMC1_YEAST      SGTN-----AEFKGPLECIKK-LRHN--KALLRGLTPTILREGHGGTYFLVYEAL--IANQMNKRRGLER
ORNT2_HUMAN     -----------YKGLTDCFLKTYAQVGLRGFYKGTGPALMAVAENSVLFMCYGFCQQFVRK---------
ADT1_YEAST      GSKSTSQR--QFNGLLDVYXXXXXXXXXXXXYRGFVPSVLGIVYRGLYFGLYDSFKPVLLTGALEGSFVA
UCP1_RAT        --SHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMNVIINCTELVTYDLMKGALVNHHILADDVP
UCP1_DICGR      --SHLHGIKPRYTGTYNAYRIIATTESFSTLWKGTTPNLMNVIINRTELVTYDLMKGALVNNQILADDVP
SAMC_MOUSE      S------------KTLQIFLTILSEEGIQGLYRGYKSTVLREIPFSLQFPLWESLKALW-----------
S2544_MOUSE     SSIVL------------TFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVYESLKKL------------
S2538_XENLA     GYNSVYG----------ALKAIYKTEGPRGLFSGLTATLMDAPFSGIYLMFYTRAKKLAPHDQIDPLFSP
ODC_BOVIN       RFTEQP----------------------------------------------------------------
MFRN1_BOVIN     ----------------------------------------------------------------------
M2OM_RAT        NMRMIDEKP-EYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLPHTVLTFIFLEQMNK-------------
TPC1_DEBHA      GYDTYKGASKTFVS-------ICKNEGVKALWKGVPAEILYILYGAIQFTSYSALSKALSEFEKNNRN--
S2538_LACBS     --SNIYAY-----ESLTGAFGTIVRQGPSELLRGFLASSLDAPYAGLFVVFYEGIKH-----------EA
S2535_BOVIN     DAQ---GKGLMYRGLLDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRMV-----------
MCFZ_DICDI      -------------------RDVLREEGFQGLYKGGSATLLRITNHMIRFPTFYAISDYLKGGDHS-----
CMC1_YEAST      D-TKLKGNNLLFQTAKDMFREG----GLRLFYRGVTVGIVGIFPAALDLGTFSALKKWYIAKQAKTLNLP
UCP1_PHOSU      GQTSSTIR---YKGVLGTITTLAKTEGLPKLYSGLPAGIQRISFASLRIGLYDTVQE-------------
UCP1_BOVIN      -VNSSPGQNTSVPN---CAMMMLTREGPSAFFKGFVPSFLRLGSWNIMFVCFERLKQEL-----------
MPCP_CAEEL      APPTLRG----------CAPMIYKAEGLTGFYKGLPPLWMRIPYTMMKFACFEKTVEALYQYVVPKP---
S2538_VANPO     ----------------------------------------------------------------------
GHC1_BOVIN      GINE-----DTYSGFLDCARKILQNEGPSAFLKG------------------------------------
DIC_MOUSE       LP---PSQRRNYSHALDGLYRVAREESLRKLFSGATASSRGALVTVGQLSCYDQAKQLVLSTGYLS----
MFN2B_XENLA     ----------------------------------------------------------------------
DIC1_CANGA      ----------------------------------------------------------------------
SAMC_HUMAN      T------------RTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLQFPLWESLKAL------------
LEU5_YEAST      ----------------------------------------------------------------------
GHC2_RAT        ---NQQGKD-VYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTEKAIKLAANDFLRQLLMQ---------
S2538_XENTR     G----------YKSVYGALKNIYKTEGPRGLFSGLTATLMDAPFSGIYLMFYTRAKKLVPQDQIDPLFSP
S2538_SCHPO     --SNL----YSYTTIYSSIRDIWKKEGISGFFRGFGVTALRDAPHAGLYVYFYELSK-------------
UCP1_MESAU      --SHLHGIKPRYTGTYNAYRIIATTESFSTLWKGTTPNLLNVIINCVELVTYDLMKGALVNNQILADDVP
MFN2A_XENLA     ----------------------------------------------------------------------
M2OM_NEUCR      DGLKPVAERKNYKSVIDALGGIARNEGVAALWAGAAPTVVRAMALNFQLAFFSEAK--------------
DIC1_YEAST      LEA---AKRRNYKNAIDGVYKIYRYEGLKTLFTGWKPNMVGILMTASQVVTYDVFKNYLVTKLDF-----
SAMC_DROME      NK----------QSGLQILLRAYRTEGLRGLYRGFGSTIMRIPFSLIQFPLWEYFK-----------LQW
MPCP_CHOFU      ----------KYKNVVNGFRVSVREEGLRGLAKGWAPTFIGYSLQGLKFGLYEVFK--------------
MCFN_DICDI      ----------------------------------------------------------------------
GHC2_MOUSE      ---NQQGKD-VYRGMTDCLMKTARAEGFLGMYRGAAVNLTLVTEKAIKLAANDFLRQLLMQ---------
PET8_ASHGO      ----------------------------------------------------------------------
MCFR_DICDI      XXXXXXXXXKVLKNGIGAIEKSIDFNGFKGIWRGILPTLYGIPYAGVGYSSFEYFKRIAPDSFRNEKGDV
YE08_SCHPO      ----------------------------------------------------------------------
TPC1_CANGA      ----------------------------------------------------------------------
YG04_SCHPO      N----------YKSFKDCFLSIYRNSGIKGLYRGLSVSMLKV----------------------------
UCP2_BOVIN      G---------QYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLSWNVVMFVTYEQLKRAL-----------
UCP1_SUNMU      -INSPPG---YYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLSWTVIMHVTFEQLKKEL-----------
UCP1_RABIT      --SHLHGLKPRYTGTYNAYRIIATTESLTSLWKGTTPNLLNVIINCTELVTYDLMKGALVRNEILADDVP
UCP1_MOUSE      --SHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMNVIINCTELVTYDLMKGALVNNKILADDVP
S2538_ASPOR     ------XXXXXXXXXXXXXRDILRTEGVRGLFAGFGATAADAPYAGLYVLFYEQLKRRFASLADSGTGDQ
YMC2_YEAST      ----------------------------------------------------------------------
S2538_NEUCR     ---------KKYRNMVQASRKMLAEEGVRSMMDGLALRMRKAMSSALAWTVYEELIR-------------
YB8B_SCHPO      -----------------CFQNAVKNEGLKGLYRGLTLPLISATLSSVSFTVYDSLK--------------
S2538_CANGA     --------------------------GIRGFFRGFGPTCLDAPYSGLYVLLYEKLKHTLPTILPKSLLQE
S2538_MAGGR     -----PGR---YRNMVVAARTMMAEEGARSFFSGLLRMSRKALSSALAWTLYEEL---------------
YFL5_YEAST      ---------------LPAVKHMYQTRGPAAFVQGTTATFRQIANTSIQFTAYTAFKRLL-----------
YFL5_YEAS7      ---------------LPAVKHMYQTRGPAAFVQGTTATFRQIANTSIQFTAYTAFKRLL-----------
TPC1_PICGU      ----------------------------------------------------------------------
MTCH1_MOUSE     ----------------------------------------------------------------------
MTCH1_HUMAN     ----------------------------------------------------------------------
MNCP_OXYFA      YPQ---AARRNYSNTIQGLAK-VAEEG--ALFRGAGANGFKLA------AICSSMTNIY---------DW
MCAR1_RAT       ----------------DAILQ-LRKDGFRNLYRGILPPLMQKTTTALMFGLYEDLSRLLRK---------
YFL5_YEAS6      ---------------LPAVKHMYETRGPAAFVQGTTATFRQIANTSIQFTAYTAFKRLL-----------
YFL5_YEAS1      ---------------LPAVKHMYETRGPAAFVQGTTATFRQIANTSIQFTAYTAFKRLL-----------
S238B_DANRE     ----------LYPKTSDAMRHVYVKHGLSGFFRGAVPRSLRRTMAAMAWTVYEQL---------------
MNCP_OXYTR      ----LPNGQMPYNGMFDCFNKIIKYE--------------------------------------------
ORT1_YEAST      QVASAK---TKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWATYEIVKKSL-----------
MCAR2_HUMAN     ----------------------LRRDGFRNLYRGILPPLMQKTTTALMFGLYEDLSCLLR----------
YIKC_SCHPO      ----------------------------------------------------------------------
S2534_HUMAN     QPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLPHTILSMLFWDELRKL------------
MCFU_DICDI      ----LPKEKRVFNGVISAFKYIIKNEGFKGLTKGLSTRLIHIVPSALSFCAYEYIKKLL-----------
CMC_DICDI       ----------------------------------------------------------------------
YQ73_SCHPO      ----------------------------------------------------------------------
TPC1_CHAGB      ----------------------------------------------------------------------
MFN2B_XENLA     --SLQPDPAARYRNVMDALSKIVRTEGFWRPLRGLNVTATGAGPAALYFACYEKLKKTL-----------
MFN2A_XENLA     --SLQPDPAARYRNVMDALSKIVRTEGFWRPLRGLNVTATGAGPAALYFACYEKLKKTL-----------
YE08_SCHPO      ----------------------------------------------------------------------
S2538_NEUCR     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AHVRGWTDTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
YKQ9_SCHPO      GIQETIYDKVLDWGGKLGGAGIAKFMAAGIAYPHEVVRTRLRQSPSING-----TPKYTGLIQCFKLVWM
RIM2_YEAST      AETKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQT---PKENGK--RKYTGLVQSFKVIIK
S2536_CHICK     EDES--AKEASDFVGMMMAAATSKTCATSIAYPHEVVRTRLREEGT----------KYRSFFQTLSLLVR
S2536_DANRE     EDES--VKDASDFVGMMLAAATSKTCATSIAYPHEVIRTRLREEGS----------KYRSFFQTLNMVFR
S2533_DANRE     DNDKGASD----FLGLMFAAAFAKGCASCIAYPHEVIRTRLREEGS----------KYKYFFQTARLVAV
S2536_HUMAN     -NDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGT----------KYRSFFQTLSLLVQ
S2533_MOUSE     ----GAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGS----------KYRSFVQTARLVFR
S2536_MOUSE     ESVKEASDFVRMMLAAAT----SKTCATTIAYPHEVVRTRLREEGT----------KYRSFFQTLSLIVQ
S2533_HUMAN     SSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGT----------KYKSFVQTARLVFR
S2533_BOVIN     SSTNGTEKNSTNFFGLMAAAALSKGCASCVAYPHEVIRTRLREEGS----------KYKSFVQTARLVFR
MFTC_HUMAN      -HINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQ----------HMFYSGVIDVITKTWR
MFTC_MACFA      -HINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQ----------HMFYSGVIDVITKTWR
YIA6_YEAST      INLQ----------RLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP---DSIQRR---LFPLIKATYA
MCFW_DICDI      VEI-------------MXXXXXXXXXXXXXXYPHEVLRARSQSSPDSP------NRTYRGIIQMFKQIVR
MCFB_DICDI      -------DTTPTVVQSLTFGAISGATAQTLTYPIDLIRRRLQ----VQGIGGK-DILYNGTFDAFRKIIR
YEA6_YEAST      XXXXXXXXXXXNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLP---NTVQRH---LLPLIKITYR
MFTC_MOUSE      AQL----STAEY----ISVAALSKIFAVAATYPYQVVRARLQDQ----------HVSYGGVTDVITKTWR
S2541_HUMAN     S-----------GXXXXXXXXXXXXCGQMASYPLTLVRTRMQAQDTVEGSNPTMR----GVLQ---RILA
SCMC3_HUMAN     GILVLLA------CGTISSTCGQIA-----SYPLALVRTRMQAQASIEGGP---QLSMLGLL---RHILS
SCM2A_DANRE     GFVLLACGTVSSTCGQLA------------SYPLALIRTRMQAQASVE---GSSQVSMTGL---FKQIMK
SFC1_YEAST      ------MDVLPSW-ETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISL------EKQSGMKKIITILLK
SCMC2_XENTR     GFVLLACGTISSTCGQLA------------SYPLALVRTRMQAEASVE---GAPQMTMSKL---FKHIVK
SCMC2_XENLA     GFVLLACGTVSSTCGQLA------------SYPLALVRTRMQAEASVE---GAPQMTMSKL---FKHIVK
YBC9_SCHPO      -----WKQRRPTSLDYIFMSAASKVFAAVNMYPLLVIRTRLQ----------VMRSPHRSIMNLVLQTWR
SCMC2_HUMAN     GFVLLACGTMSSTCGQLA------------SYPLALVRTRMQAQASIE-GAPEVTMS-----SLFKHILR
SCMC2_BOVIN     GFVLLACGTMSSTCGQLA------------SYPLALVRTRM-QAQASMEGAPEVTMS-----SLFKQILR
SCMC1_RABIT     G-----------VLVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE---GAPQLNMVGL---FRRIIS
SCMC1_HUMAN     G-----------VMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE---GSPQLNMVGL---FRRIIS
SCM2B_DANRE     GFVLLACGTMSSTCGQLA------------SYPLALVRTRMQAQASQE---GSPQMTMSGL---FRHIVR
SCMC1_MOUSE     GVMV-----------LLSCGALSSTCGQLASYPLALVRTRMQAQATVE---GAPQLSMVGLFQ--RIVSK
SCM1B_XENLA     GVVLLGCGTASSTCGQLA------------SYPLALIRTRMQAQASIE---GAPQLNMGGL---FRKIVA
S2541_MOUSE     S-----------GXXXXXXXXXXXXCGQMASYPLTLVRTRMQAQDTVEGSNPTMQ-------GVFKRILS
SCMC2_MOUSE     GFVLLACGTISSTCGQLA------------SYPLALVRTRMQAQASIE-GAPEVTMS-----SLFKQILR
MCFG_DICDI      SSLQGGAGGVSYWT---------------LTYPADVVKSTMQTDAIV-----KSQRKYKNMIDCASKIYK
SCMC3_MOUSE     GIL------VLLGCGTISSTCGQIA-----SYPLALVRTRMQAQASIEGGP---QVSMVGLL---RHILS
SCMC1_XENTR     GVVLLGCGTASSTCGQLA------------SYPLALIRTRMQAQASIE---GAPQLNMGGL---FRKIVA
SCMC1_BOVIN     G-----------VMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMIEK---SPQLNMVGL---FRRILS
SCM1A_XENLA     GVL------VLLGCGTVS-----STCGQLASYPLALIRTRMQAQASIE---GAPQLNMGGL---FRKIVA
SCMC2_RAT       GFVLLACGTISSTCGQLA------------SYPLALVRTRMQAQASIE-GAPEVTMS-----SLFKQILR
AGC1_YEAST      NRLKTWE--------LLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR------KGETKYNGIFHAIRTILK
YH66_SCHPO      SQ-----STKDLYINFVS-GGISGTLATLLTQPFDVSKTAKQHGHTLTRG------------QFMLTLWK
BT1_MAIZE       ---RPGADVGP--VXXXXXXXXXXXXXXXXXFPLEVARKQMQ----VGAVGGR--QVYQNVLHAIYCILK
MCATL_RAT       LLLAGGTSGITSWLS---------------TYPMDVVKSRLQ------ADGLQGTPRYRGIVDCMRQSYQ
CMC3_CAEBR      CYTQYYTEHTEPGVALLACGTCSSTCGQLASYPLALVRTRLQARAISPKNSSQPDT----MIGQFKHILQ
CMC3_CAEEL      -YTKYYTEHTEPGVALLACGTCSSTCGQLASYPLALVRTRLQARAISP----KNSTQPDTMVGQFKHILQ
MFRN1_RAT       VNPRRDYNPQSH----IISXXXXXXXXXXXTTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQ
MCATL_MOUSE     LLLAGGTSGITSWLS---------------TYPMDVVKSRLQ------ADGLQGTPRYRGIVDCMRQSYQ
MCFM_DICDI      ------LNASEIFIAS----SISKFLASTILYPFQVVKTRLQDERNIP-NQNNVRV-YNGTKDVIFKILK
SCMC1_DANRE     GVL------VLLGCGTIS-----STCGQLASYPLALIRTRM-QAMASMEGSEQVSMS-----KLVKKIMQ
MFRN1_MOUSE     VNPRRDYNPQSH----IISXXXXXXXXXXXTTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQ
MCATL_HUMAN     LLLAGGTSGIVSWLS---------------TYPVDVVKSRLQ------ADGLRGAPRYRGILDCVHQSYR
MFRN1_HUMAN     VNPHRTYNPQSH----IISXXXXXXXXXXXTTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQ
ODC2_YEAST      AKTKGQKTRNDLIAGAI-----GGTVGTMLNTPFDVVKSRIQSVDAV----SSAVKKYNWCLPSLLVIYR
YBT5_SCHPO      QDVKLPNGLV------MAFGALSGSTGATIVFPLNVIRTRLQTQ-----GTSAHPATYDGFIDCFYKTTK
MCP62_HUMAN     VWLAGGMAGAISW-GTAT--------------PMDVVKSRLQ-------ADGVYLNKYKGVLDCISQSYQ
CMC2_CAEEL      TYVRYYTNSSEPGVALLACGTCSSTCGQLSSYPFALVRTRL-QALSIT----RYSPQPDTMFGQFKYILQ
S2540_DANRE     AI----TFTAGALSGSIASII---------TLPFDVVKTK-RQVEMGELQTMKLSTQVSSTCSVMKRIVA
PM34_DICDI      LEVFXXXXXXXXXXXXV-------------TYPYLLVKSRLQSQSGNASNPESQQQQYKGTLDAIGKIFK
MCFD_DICDI      XXXXXXXXSSPKWV-AIGAGGCAGMSFWMSIYPMDVVKTRIQTQP------DHLPPQYTSVLQTITKIYR
MCATL_BOVIN     LLLAGGTSGIASWLS---------------TYPVDVVKSRLQ------ADGLQGAPRYRGIVDCVQQSYR
FLX1_YEAST      IHLTN--------LETIEITSLGKMVSVTLVYPFQLLKSNLQSF--------RANEQKFRLFPLIKLIIA
MCFS_DICDI      AIISGGLGGMAYWT---------------VLYPVDVAKSKIQ----ISEGAG----PSPSIVKVLKEIYS
MCAT_MOUSE      ILVAGGFAGIFNWAVAI---------------PPDVLKSRFQTAPP-----GKYP---NGFRDVLRELIR
TPC_MOUSE       GNLK-----------NLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRYRGLLDLTQQVLQ
MCFI_DICDI      LSVGNYLGTARLIAGVL-------------TYPYLLIRSSL-QSETCP---------YKSMSEAVKGIYK
S2540_XENTR     --CQRYNTLQPTFAISFTAGAVSGSIAAIVTLPFDVVKTR-RQVEV-----GELEMRSSSTWKLMRAIVI
S2541_BOVIN     S---------------------------------------------------------------------
ODC_HUMAN       I-LEFW---RKFGIGLLS-----GTIASVINIPFDVAKSRIQGPQPVPG-----EIKYRTCFKTMATVYQ
MCFX_DICDI      ------TDQETGEIGILLCGITAGSIAASVSTPFDVIKTRIQVKP------GPNDPHYKGIADCFRKTIQ
MCAT_ARATH      ----GGSDTSSLGQGSIMAGGVAGASFWGIVYPTDVVKSVLQV-------DDYKNPRYTGSMDAFRKILK
YID3_SCHPO      FHIVLAATLSKIAASTV-------------TYPHEVLRTRLQDAPT-----------HNSATLLIRDIWR
TPC1_COCIM      LHL-------PFGSGDATAGVIASVIAKTGVFPLDLVRKRLQQGPTRSRYIHQNIPEYNGVLSTMKMVLR
S2543_HUMAN     -----WNGPRDQFSQNFANVCLAAAVTQTLSFPFETVKRKMQQSPYLPHSGG-VDVHFSGAVDCFRQIVK
CMC_DROME       ------KDGYNHPLTLLXXXXXXXXXXXSLVTPADVIKTRLQ----VVARSG--QTTYTGVWDATKKIMA
AGC1_ASHGO      NKLNTWQ--------LLVSGGLAGMPAAFLTTPFDVIKTRLQIDPK------KGESVYNGIWDAARTILK
S2540_XENLA     --CQRYNTLQPTFAISFTAGAVSGSIAAIVTLPFDVVKTRRQ----VEVGELEVHKRSSSTWKLMSAIVA
S2540_HUMAN     TFMINFTSGA-----------LSGSFAAVATLPFDVVKTQ-KQTQLWTYESHKISMPHMSTWIIMKNIVA
UCPB_DICDI      LQVHIVSSIFAGLIASIT------------TSPVDLVKTRIMNQPFDSNGVGLI---YKSSYDCFKKTFQ
TPC1_SCLS1      --------------GDATAGVLASVIAKTGIFPFDLIRKRLQQGPTRERYVHKNIPVYNGVFRTMRHIIQ
S2535_DANRE     ------------WLIALSAGMISSVVVVLAMTPFDVVSTRLYNQPVDHLGKG---MLYRGFVDCFSKTLK
OAC1_SCHPO      --IEHYNLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQ--------KNKELYKNPIDCILKTIR
S2543_MOUSE     ---NGPRDRFSH-LQNFANVCVAAAVSQTLSFPFDTVKRKMQQSPYLPHYGG-VDVHFSGAADCFRQIVK
S2540_BOVIN     TFMINFTSGA-----------LSGSFAAVVTLPFDVVKTQ-KQTQLWIYESQKISMPQMSTWTIMKNIVA
S2534_RAT       ---QQWF-LEDSWLATLAGGMISSIAVVAVMAPFDVVSTRLYNQPVDRAGRGQL---YGGLTDCLVKTCQ
MCFL_DICDI      SFIAGGIAGTGFWL---------------TNFPFDVIRSRIMTMPY-----NESPPRYKGMIDCAKHIYR
TPC_HUMAN       -HLYKWAIPAEENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGEHARAAFGQVR-RYKGLMDCAKQVLQ
TPC1_MAGGR      --------KLPFWGGXXXXXXXXXXXXXXXVFPLDLVRRRIQQGPTRSKYVHKNIPEYKGTFSTISTIAR
TPC1_BOTFB      ----GSADASAGVIASVIAKTGI--------FPFDLIRKRLQQGPTRERYVHKNIPVYNGVFQTMRHILH
TPC_PONAB       -HLYKWAIPAEENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGEHARAAFGQVR-RYKGLMDCAKQVLQ
TPC_BOVIN       GNFK-----------NLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEQARASFGQVRYKGLLDCAGQVLR
PM34_HUMAN      VFIIGAVAKA---IATTV------------TYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVR
MFRN_DICDI      -------ERSYQLIDHLVXXXXXXXXXXXFTNPFDVVKTRLQTQSDFIASSAKSIKRYGGMMDAMKTIWI
MCAT_MACFA      QLFAAGMLSGIFTTGIMT--------------PGERIKCLLQ----IQASSG--ETKYTGTLDCAKKLYQ
ODC_PONAB       ------KDPTLEFLRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPG-----EIKYRTCFKTMATVYQ
MCP62_BOVIN     AWLAGGMAGAISW-GTAT--------------PMDVVKSRLQ-------ADGVYVNKYRGVLDCMSQSYQ
KMCP1_RAT       SGLMGDT-VSTHFLSSFTCGLVGALA----SNPVDVVRTRMMNQRDLRDGRCS---GYKGTLDCLLQTWK
KMCP1_MACFA     -------DTVTHFLSSFTCGLAGALA----SNPVDVVRTRMMNQRVLQDGRCS---GYTGTLDCLLQTWK
S2534_MOUSE     ---RQWF-LEDSWLVTLAGGMISSIAVVAVMTPLDVVSTRLYNQPVDRAGRGQL---YGGLADCLVKTCQ
KMCP1_MOUSE     SGLMGDT-VATHFLSSFTCGLVGALA----SNPVDVVRTRMMNQRALRDGRCA---GYKGTLDCLLQTWK
S2540_DICDI     NFSRN--SKSPFFINFIAGATSGTLAAVLTT-PIDVIKTRIQQQTLSPSLTPQQQLKNNSSIYHLKQILS
S2538_SHEEP     LHSTDQLDAVLVPVVNFSCGIFAGILASLVTQPADVIKTHMQLSP----------VKFRWIGQSVTLIFK
S2534_BOVIN     ---RQWLPE-DSWLVALAGGMISSIAVVAVMTPFDVVSTRLYNQPVDGAGRGKL---YGGLTDCLVKIWR
MCFC_DICDI      GQLLVCASTSS-------------VCGQLVGYPFHVVKSRL-----ITQGSSVNQEKYTGLFDGLTKIIK
MCAT_RAT        QLFTAGMLSGVFTTGIMT--------------PGERIKCLLQ----IQASSGK--NKYSGTLDCAKKLYQ
CMC1_CAEEL      ---KFTKDGKIPLYGEIIAGGTGGMCQVVFTNPLEIVKIRLQTAGEVQQAGKKIGV--------FTVL-K
TPC_MACFA       -HLYKWAMPAEENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGEHARAAFGQVR-RYKGLMDCAKQVLQ
S2540_RAT       ------SDLYESFMINFTAGALSGSFAAVATLPFDVVKTQKQTQLWTHEYCKFPEPLDMSTWSIMKNIVA
S2540_MOUSE     TFMINFTSGA-----------LSGSFAAVATLPFDVVKTQTNEYCKFPA---PLDMSTWTIM---KNIVA
KMCP1_HUMAN     -------DTVTHFLSSFTCGLAGALA----SNPVDVVRTRMMNQRVLRDGRCS---GYTGTLDCLLQTWK
TXTP_YEAST      LS-SGLTFLVGAFSGIVTVYS---------TMPLDTVKTRMQSLDST---------KYSSTMNCFATIFK
CMC2_MOUSE      ANEDGQVSPG----SLLLAGAIAGMPAASLVTPADVIKTRLQVAAR--AG----QTTYNGVTDCFRKILR
ADT1_GOSHI      SFVLGWLIT---------------NGAALASYPIDTVRRRMMMT------SGKA-VKYKSSLDAFSQILK
UCP3_PIG        ----------------------------------------------------------------------
TPC1_ASPNC      ----GSGDAAAGVIASVSSKTVM--------FPLDLIRKRLQQGPTRQLYIHRNIPEYQGVFNTMKLILR
TPC1_ASPFU      ----GSGDAAAGVIASVLAKSG--------VFPLDLVRKRLQQGPTRTLYVHRNIPEYRGVFSTIAMIVR
MTM1_YEAST      AN---WV----HFINSFASGCISGMIAAICTHPFDVGKTRWQISMSDPKGGNRSR----NMFKFLETIWR
MCAT_HUMAN      QLFAAGMLSGVFTTGIMT--------------PGERIKCLLQ----IQASSG--ESKYTGTLDCAKKLYQ
YP011_YEAST     ------SDAQPSWKSNLTIGAISGGVAQTITYPFDLLRRRFQ---VLAMGGNELGFRYTSVWDALVTIGR
S2543_DANRE     RHVR-FTSLQNFINGCLAAGVAQTL-----SFPFETVKKKMQQSLVLPHCGG-VDVHFNGMADCFRQVIK
PM34_MOUSE      XXXXXXXXXXXXXXDVFXXXXXXXXXXTTVTYPMQTVQSILRFGRHRLNPENRTLGSLRNVLSLLHQRVK
ODC_SCHPO       ASSR----IGEIRNNLIAXXXXXXXXXXLST-PFDVIKSRIQTVPRIAGQVPKYNWAYPALV----TVAR
MFRN_CAEEL      EHK---YDPKSH----XXXXXXXXXXXXXXTTPMDCVKTVLNTQQAAEADPAQARYRYRGISDAVRTIYS
MFRN2_DANRE     -NPQRHYNPSSHMVS----XXXXXXXXXXXTTPLDVCKTLLNTQESLAVDSSRSGRHITGLGHAFRTVYR
ADT1_MAIZE      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFQQILK
ODC_MOUSE       -------DPTLEFLRKFGIGFVSGTMGSVFNIPFDVAKSRIQGPQPVPG-----EIKYRSCFKTMEMIYR
ADT2_YEAST      SFLLGWVVT----TGAST-----------CSYPLDTVRRRMMMT------SGQA-VKYDGAFDCLRKIVA
TPC1_NEOFI      ----GSGDAAAGVIASVLAKTG--------VFPLDLVRKRLQQGPTRTLYVHRNIPEYRGVFSTIAMIVR
ODC1_YEAST      A---AKTSTEKTRNDLIAGAIGGTVGCLLNT-PFDVVKSRIQRS------SGPLR-KYNWSLPSVLLVYR
MCP62_MOUSE     --ITPEACTGPSPYXXXXXXXXXXXXXXXXXXPMDVVKSRIQ-------ADGVYLNKYRGVVDCISQSYQ
KMCP1_XENLA     -------DTVTHFLSSFTCGLAGALA----SNPVDVVRTRMMNQRSIRDASNS---SYKGTLDCLLQTWK
S2539_HUMAN     TSV-GMSFVAGGISGTVAAVL---------TLPFDVVKTQRQVALGAMEAVRVNPLHVDSTWLLLRRIRA
ADT_ORYSJ       SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSMDAFSQILK
TPC1_ASPTN      DALAGMIASVLAKTGV---------------FPLDLVRKRLQQGPTRSRYIHRNIPEYRGVFNTLALILR
TPC1_LODEL      KHVPFIEGICGFVAGATS---------KGITFPLDTLRKRCQIYSEV------YGTKYKSSLRIFMNIVS
TPC1_EMENI      PPGSG--DAAAGIVASVLAKTG--------VFPLDLVRKRLQQGPTRALYVHRNIPEYRGVFNTMGLIFR
KMCP1_XENTR     -------DTVTHFLASFTCGLAGALA----SNPVDVVRTRMMNQRSIRNVSNS---SYKGTLDCLLQTWK
ADT1_WHEAT      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFQQILK
S2542_RAT       FE-------------RMVFGACAGLIGQSASYPLDVVRRRMQTA-------GVTGHQHGSILSTLRSIVR
S2542_MOUSE     FE-------------RMVFGACAGLIGQSASYPLDVVRRRMQTA-------GVTGHQHGSILSTLRSIVR
MCP62_DANRE     PPCCIWL--AGGLAGSISWVTAT---------PSDVVKSRLQ-------ADAMHQRKYKGILHCIMQSYR
COLT_DROME      ASTAGGVAGMAYWI---------------LGMPADVLKSRLQSAPE---GTYK-----HGIRSVFKDLIV
S2542_XENLA     -HAEHSGRTQPYTFERLLFGACAGLFGQSSSYPLDVVRRRMQTA-------GVTGHTYGSIIGTMQEIVA
S2538_NEOFI     ----------------------------------------------------------------------
ADT_CHLRE       XXXXGWGIT----IGA-----------GLASYPIDTIRRRM-----MMTSGSAV--KYNSSFHCFQEIVK
TPC1_ASPOR      XXXXXXXXXXXXKTG---------------VFPLDLVRKRLQQGPTRSKYVHRNIPEYQGVYNTMAMIVR
S2542_XENTR     -HAEHSGRTQPYPFERLLFGACAGLFGQSASYPLDVVRRRMQTAGVTGHAYGSI----IGTMQ--EIVAE
S2538_ASPCL     P-----LKTXXXXXINFVSXXXXXXXXTAITNPFDAVKTRLQLMPG----------KYGNMMRAVRLMIH
S238A_DANRE     -------------VANFSCGVLAGVLASVLTQPADVVKTHIQVSPDV----------FSRTSDVVRYIYK
SAMC_XENTR      ----SWKQAVDSWQSAVCXXXXXXXXXXLTT-PLDVAKTRIMLA---KAGSG---VASGNVLFALHEIWR
S2542_HUMAN     FE-------------RMIFGACAGLIGQSASYPLDVVRRRMQTA-------GVTGYPRASIARTLRTIVR
CMC1_MOUSE      GRVGG--------INLLTAGALAGVPAASLVTPADVIKTRLQVAAR--AG----QTTYSGVVDCFRKILR
S2539_BOVIN     SWLSGLRPKDQTSVGSFVAGGISGMVAATLTLPFDVVKTQRQVALGAVEALRVMPLNTDSTWLLLRRILA
ODC_RAT         SS----KDPTLEFLRKFGIGFVSGTVGSVFNIPFDVAKSRIQGPQPVPG-----EIKYRGCFKTMETVYR
ADT_KLULA       SFLLGWAVT----TGAST-----------ASYPLDTVRRRMMMT------SGQA-VKYDGAFDAFRKIVA
UCP3_BOVIN      ----------------------------------------------------------------------
S2545_MOUSE     VLVAGGFAGIASWI-TAT--------------PFDVIKSRMQM-------DGLKGRKYGGMLDCMASSFR
S2545_HUMAN     VLVAGGFAGIASWVAAT---------------PLDMIKSRMQM-------DGLRRRVYQGMLDCMVSSIR
S2538_ASPFU     ----------------------------------------------------------------------
S2538_ASPFC     ----------------------------------------------------------------------
MFRN_CAEBR      EHKY---DPKSHLIXXXXXXXXXXXV----TTPMDCVKTVLNTQQAAEADPSKARYRYRGISDAVRTIYS
DIF1_CAEEL      G-------------ATLMAGGLAGIANWGVCIPADVLKSRLQTAP---------EGKYPGIRGVLREVLR
UCP3_HUMAN      ----------------------------------------------------------------------
S2542_DANRE     THAEKTGRAHPFPYERLVFGACAGLIGQSASYPLDVVRRRMQTA-------GVTGHTYSTVLGTMREIVA
S2538_MOUSE     LHGTAQLDAALIPLINFSCGIFAGVLASLVTQPADVIKTHMQLSP----------VKFQWIGQAATLIFK
MCFE_DICDI      LPI----------PYQLXXXXXXXXXXXXVTCPLDVIKTRIQVQRSTE------KQIYKGMWDSFKTILK
TPC1_AJECN      ----GTGDAGAGVVASVIAKTG--------VFPLDLVRKRLQQGPTRRRYIHTNIPVYEGVYRTIRAILA
PM47A_CANBO     MHVKSMTEISEDVEKERTDSVQSLPEDGSDEDNLKENSAKSPYAETITKIISKLPSPIVSMFTLGYGMYK
M2OM_DICDI      TH--------------LIXXXXXXXXXXXXXXPLDVIKTRIMNSPKTVTG----ELQYKGTFDCLSKTLR
YM39_YEAST      IEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQQQPPSQSNNGRPAALSNSISLSLRTVYQ
MFRN2_MOUSE     ---RRYNPSSH-----VLXXXXXXXXXXXXTTPLDVCKTLLNTQESL-ALNSNITGHITGMASAFRTVYQ
HDCPB_DANRE     -------------------------------YPLDTVKVRLQ-----------TQTGYSGFWQCVRKTCR
CMC1_PONAB      GHVXXXXXXXXXXXXXXXXXSLVT--------PADVIKTRLQVAAR--AG----QTTYSGVIDCFRKILR
CMC1_HUMAN      GHVXXXXXXXXXXXXXXXXXSLVT--------PADVIKTRLQVAAR--AG----QTTYSGVIDCFRKILR
ADT2_WHEAT      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFQQIPA
TPC1_YARLI      --INAYNETAEKWAQSFXXXXXXXXXXXXXXYPFDLFRTLFAAQ-----GAKNCNVKYTSLFQTFKLIYK
ODC_DICDI       TTEQGVL------VNNFIAGGLAGTFGTMLNTPADVVKSRIQN----QVGAG----KYNWCIPSILTVAR
MFRN2_HUMAN     ---RRYNPSSH-----VLSXXXXXXXXXXXTTPLDVCKTLLNTQESL-ALNSHITGHITGMASAFRTVYQ
MCFA_DICDI      LY-------APSIYGAIS-----GGLTMTILYPLDVVKRRINQLPI-----------YKNFIDAIIKITK
ADT_SCHPO       SFLLGWAVTTGSGVA---------------SYPLDTIRRRMMMT------SGEA-VKYSSSFECGRQILA
ADT2_MAIZE      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFQQILK
TPC1_PHANO      XXXXXXXXXXXXXXXXX--------------YPLDTTRKRLQQGPNRARYVHRNIPTYSGVLMTLQHIWK
S2538_BOVIN     LHRTDQLDAVLVPVVNFSCGIFAGILASLVTQPADVIKTHMQLFP----------MKFRWIGQSVTLIFK
EAAC_ARATH      --------------------------------------------------GQQSAKKAIGFIEAITLIAK
YD1K_SCHPO      SQTPGWK--------LCVFGAGAGYAMWLAAYPFDIVKSKIQ------TDGFLSKATYKNSWQCAKGIYT
UCP5_MOUSE      -------DTITHFVSSFTCGLAGALA----SNPVDVVRTRMMNQRAIV---GHVDL-YKGTLDGILKMWK
CMC2_HUMAN      LLLAG---------------AIAGMPAASLVTPADVIKTRLQVAAR--AG----QTTYSGVIDCFRKILR
MFRN1_DANRE     PHRQYRPET------HXXXXXXXXXXXXXXXXPLDVCKTLLNTQENVALSSAHVSGHLSGMVNALRTVYR
ADT1_ARATH      SFALGWVIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFKQILK
TPC1_YEAS7      AHKKWELATLNHSAGTI-----GGVIAKIITFPLETIRRRMQFMNSKHSRHSSVYGSYKGFARIGLQILK
TAAC_ARATH      ----------------------------------------------------------------------
S2539_MOUSE     SWLSGLRPKDQTSVGSFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAVRVKPPRVDSTWLLLRRIRA
S2538_AJECN     ----------------------------------------------------------------------
UCP5_HUMAN      SGMMGDT-ILTHFVSSFTCGLAGALA----SNPVDVVRTRMMNQRAIV---GHVDL-YKGTVDGILKMWK
S2538_CHAGB     ----------------------------------------------------------------------
ADT4_MOUSE      ----------------------------------------------------------------------
PM47B_CANBO     -------------VDALLLGAFGKLIATIITYPYITLRSRMHSVQSLPEDGNKIISKLPSPIVSMFIIYK
OAC1_YEAST      LH--------------LTASTISGLGVAVVMNPWDVILTRIYNQK------GDL---YKGPIDCLVKTVR
ADT1_SOLTU      SFGLGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSLDAFSQIVK
TPC1_YEAST      AHKKWELATLNHSAGTI-----GGVIAKIITFPLETIRRRMQFMNSKHSRHSSVYGSYKGFARIGLQILK
CMC2_MACFA      MHKDGSVPLA----AEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALS----------VVR
S2538_ASPTN     PLAATSSSSINFISGGLAAGLATTI-----TNPFDAVKTRLQLMPG----------KYGNMMRAVKLMIQ
S2538_ASPNC     XXXXXXINFVSGGLAA--------GLATTITNPFDAVKTRLQLMPG----------RYGNMMRAVRLMVQ
S2538_HUMAN     -------------ITNFSCGIFAGILASLVTQPADVIKTHMQLYP----------LKFQWIGQAVTLIFK
ADT4_MACFA      ----------------------------------------------------------------------
ADT3_YEAST      SFLLGWVVT----TGAST-----------CSYPLDTVRRRMMMT------SGQA-VKYNGAIDCLKKIVA
ADT4_HUMAN      ----------------------------------------------------------------------
ADT3_HUMAN      KNT--------HIVVSWMIAQTVTAVAGVVSYPFDTVRRRM----MMQSGRKGADIMYTGTVDCWRKIFR
UCP2_CYPCA      ----------------------------------------------------------------------
S2535_MOUSE     --------PPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTDTRGKG---LMYRGILDALLQTAR
ADT1_RAT        KNV--------HIIVSWMIAQSVTAVAGLVSYPFDTVRRRMM----MQSGRKGADIMYTGTVDCWRKIAK
ADT1_MOUSE      KNV--------HIIVSWMIAQSVTAVAGLVSYPFDTVRRRMM----MQSGRKGADIMYTGTLDCWRKIAK
ADT1_BOVIN      -HKQFW----RYFXXXXXXXXXXXXTSLCFVYPLDFARTRL----AADVGKGAAQREFTGLGNCITKIFK
YIKC_SCHPO      ----------------------------------------------------------------------
UCPA_DICDI      --VLNFVDDGIY--AYIISSMVAGFIVTFGMNPFDVARTRLY----FQGKGNSHGEIYKGLMDCVYKTVK
SAMC_XENLA      ----SWKQAVDCWQSAVCXXXXXXXXXXVTT-PLDVAKTRIMLA---KAGSG---VANGNVLFALHEIWR
GDC_MOUSE       SSDNPNVLVLKTHI-NLLCGGVAGAIAQTISYPFDVTRRRMQLGAVLPEFEKCLTMRET-----MKYVYG
ARG13_NEUCR     SRER----PLPLWQQAIAGASAGMSYNFLF-FPADTVKSRMQTSPXXXXXXAATMMPKKSFGEEARALWK
ADT_NEUCR       SFALGWCVTTAAGIA---------------SYPLDTIRRRMMMT------SGEA-VKYKSSFDAASQIVA
ADT1_ANOGA      KNTSIFVSWAIAQVVTTA--------SGIISYPFDTVRRRM----MMQSGRAKSEVMYKNTLDCWVKIGK
S2534_DANRE     THTQWFSPLSS--LNTLCAAVMSGVAVSIIMTPFDVISTRLYNQPVDQFKQGRL---YCGFVDCLLKVCA
GDC_BOVIN       SSDNPNVLVLKTHINLLCGGVAGAIAQTI-SYPFDVTRRRMQLGAVLPEFEKCLTMRET-----MKYVYG
UCP3_RAT        ----------------------------------------------------------------------
TXTP_CAEEL      ADERG---NLSPVMRLLCGLGAGLSEAVFAVTPMETVKVKFIH------DQGLAQPKYKGFVHGVGCIVK
TPC1_PICST      ---------KEGICGFIA-----GATSKGITFPLDTIRKRTQMYKILYNSAKRV-----GAFRLLADIVA
S2538_YEAS7     YNPEGGFXXXXXXXXXXXXXXXXXXLATTVTAPFDTIKTRMQLEPS----------KFTNSFNTFTSIVK
S2538_YEAS1     YNPEGGFXXXXXXXXXXXXXXXXXXLATTVTAPFDTIKTRMQLEPS----------KFTNSFNTFTSIVK
ORNT1_MOUSE     --ASGRSKDELGPVPLMLSGGFGGICLWLAVYPVDCIKSRIQVL--------SMTGKQTGLVRTFLSIVK
ADT2_ANOGA      ARGMLPNPKTTPWYVSWAIAQCVTTVAGIVSYPFDTVRRRMM----MQSGRAKSEIVYKGTLHCWATIAK
ADT1_RABIT      -HKQFW----RYFXXXXXXXXXXXXTSLCFVYPLDFARTRL----AADVGKGAAQREFSGLGNCLTKIFK
YQ51_CAEEL      DH--------NPXXXXXXXXXXXXXXXXIFTHPFDVIKTNCQIRI-----GGSIDDMNKSITTVIKDMYH
TPC1_CANAL      GFIAGATSKG-------------------ITFPLDTLRKRCQMCSVVHG------RPYTA-SHIFVTILK
S2538_YEAST     YNPEGGFXXXXXXXXXXXXXXXXXXLATTVTAPFDTIKTRMQLEPS----------KFTNSFNTFTSIVK
ADT2_BOVIN      KN----THIFISWM----IAQSVTAVAGLTSYPFDTVRRRMM----MQSGRKGTDIMYTGTLDCWRKIAR
ADT2_ARATH      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSFDAFSQIVK
YFG5_SCHPO      -------DEKLSTVTTFLVGSVAGIITVYCTQPIDTVKSRMQSL--------SASKEYKNSIHCAYKILT
S2538_RAT       LHGADELDAALMPLVNFSCGVFAGILASLVTQPADVIKTHMQLS----------TVKCQCIGQVATLILK
GDC_HUMAN       SSDNPNVLVLKTHVNLLCGGVAGAIAQTI-SYPFDVTRRRMQLGTVLPEFEKCLTMRDT-----MKYVYG
ADT3_PIG        RNT--------HIVVSWMIAQTVTAVAGVFSYPFDTVRRRMM----MQSGRKGADIMYKGTLDCWRKIFK
ADT3_BOVIN      KNT--------HIVVSWMIAQTVTAVAGVVSYPFDTVRRRM----MMQSGRKGADIMYKGTVDCWRKILK
ADT2_HUMAN      KNT--------HIVISWMIAQTVTAVAGLTSYPFDTVRRRMM----MQSGRKGTDIMYTGTLDCWRKIAR
MCFJ_DICDI      GFLKGRSDSDSDLLFVTTISGAISEALASVIWVPFDVATQ-----SVQIQGSLSKPKYKGGSDVFKKIYG
HDCPA_DANRE     VLLSGGVAGMSGWVGT----------------PMDVIKARLQM------DGVRGQRRYRGLLHCLTVTTR
UCP3_CANFA      CHLISAFGAG--FCATVVAS------------PVDVVKTRYMNSPP---------GQYCSPLDCMLKMVT
UCP2_HUMAN      CHF-----TSAFGAGFCT---------TVIASPVDVVKTRYMNS---------ALGQYSSAGHCALTMLQ
UCP2_CANFA      CHF-----TSAFGAGFCT---------TVIASPVDVVKTRYMNS---------ALGQYSSAGHCALTMLQ
ADT4_BOVIN      ----------------------------------------------------------------------
ADT2_TACAC      KN----THIFISWM----IAQSVTAVAGLTSYPFDTVRRRM----MMQSGRKGSDIMYTGTIDCWKKIAR
UCP2_DANRE      ----------------------------------------------------------------------
ADT1_HUMAN      KNVHIFVS----WM----IAQSVTAVAGLVSYPFDTVRRRMM----MQSGRKGADIMYTGTVDCWRKIAK
UCP4_HUMAN      ----------------------------------------------------------------------
UCP3_MOUSE      CH--------------FVSAFGAGFCATVVASPVDVVKTRYMNAPL---------GRYRSPLHCMLKMVA
UCP2_RAT        CHF-----TSAFGAGFCT---------TVIASPVDVVKTRYMNS---------ALGQYHSAGHCALTMLR
UCP2_MOUSE      CHF-----TSAFGAGFCT---------TVIASPVDVVKTRYMNS---------ALGQYHSAGHCALTMLR
TPC1_NEUCR      -----------YXXXXXXXXXXXXXXXKTGTFPLDLVRKRIQQGPTIPVYDG-------GMVKTVATIVR
S2535_HUMAN     --------PPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTDAQGKG---LMYRGILDALLQTAR
ADT2_PONAB      KNT--------HIVISWMIAQTVTAVAGLTSYPFDTVRRRMM----MQSGRKGTDIMYTGTLDCWRKIAR
S2539_RAT       SQLNGPRQKEQTSVGSFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAMRVKPPRVDSTWLLLRRIQA
S2538_COCIM     ----------------------------------------------------------------------
ORNT1_HUMAN     LMLSGGVGGICLWLAV---------------YPVDCIKSRIQVL--------SMSGKQAGFIRTFINVVK
MCFP_DICDI      GQISG---TYKLIAGGIAGGVAQTV-----AYPFDVVRRRVQ---THGFGDAKAVVNLEGTLRTIAHILK
YETC_SCHPO      NAV---YDPTSH----XXXXXXXXXXXXXXTTPLDVVKTLLRGSSSIPE-----VRKCKGSLDVVRFIYN
UCP2_PONAB      CHF-----TSAFGAGFCT---------TVIASPVDVVKTRYMNS---------ALGQYSSAGHCALTMLQ
S2534_HUMAN     --------------------------------PFDVVSTRLYNQPVDTAGRGQL---YGGLTDCMVKIWR
MCFU_DICDI      -------------------------------FPLDTIKTRLQFQGDFSRGS--IKNRYSGIVNAFKTTIR
ADT_DICDI       -------NPTKFFIGNLLSGGAAGATSLLFVYPLDFARTRL--AADVGTGSAR---QFTGLGNCISSIYK
UCP1_HUMAN      CHIAGFCATA-------------------MSSPVDVVKTRFINSPP---------GQYKSVPNCAMKVFT
TPC1_VANPO      ----------------------------------------------------------------------
TXTP_BOVIN      MNP----------LITGVFGAIAGAASVFGNTPLDVIKTRMQ---------GLEAHKYRNTLDCGLQILR
SAMC_DANRE      ---RRQGGRLDSWQXXXXXXXXXXXXXXXTT-PLDVAKTMLAKAGTSTASG--------NIPMVLCEVWR
ADT2_SOLTU      SFALGWLIT---------------NGAGLASYPIDTVRRRMMMT------SGEA-VKYKSSFDAFNQILK
YAD8_SCHPO      APICS-------ALGTVV--------ATTISTPLDIVKTRYQVATSSKAEYGLQAEKELGILEIAKLLFS
S2538_SCLS1     ----------------------------------------------------------------------
GDC_RAT         SSDNPNVLVLKTHI-NLLCGGVARAIAQTISYPFDVTRRRMQLGAVLPEFEKCLTMRET-----MKYVYG
ADT_CHLKE       ------DERTANFFXXXXXXXXXXXXXXXLSYPFDTVRRRL----MMQSGG---ERQYNGTIDCWRKVAQ
ADT2_MOUSE      ----------------------------------------------------------------------
MFRN_DROME      VHMXXXXXXXXXXXXVTT--------------PLDVIKTLLNTQET-----GLTR----GMIEASRKIYH
MCFY_DICDI      ----------------------------------------------------------------------
M2OM_MOUSE      ----------------------------------------------------------------------
CMC_DICDI       --------------------------------PADVIKTRLQ----VKANAG--EQTYTGIRDCFQKILK
ADT2_RAT        ----------------------------------------------------------------------
YQ73_SCHPO      ----------------------------------------------------------------------
HDMCP_RAT       XXXXXXXXXXXXXXXXXT--------------PMDVIKSRLQ-------ADGQGQQRYRGLLHCVVTSVR
HDMCP_MOUSE     --LCEWLTPAGHXXXXXXXXXXXXXXXXXXXTPMDVIKSRLQ-------ADGQGQHRYRGLLHCVVTSVR
ADT_DROME       ----------------------------------------------------------------------
TXTP_RAT        MNP----------LITXXXXXXXXXXXXXXNTPLDVIKTRMQ---------GLEAHKYRNTLDCGVQILK
TXTP_HUMAN      MNP----------LITGVFGAIAGAASVFGNTPLDVIKTRMQ---------GLEAHKYRNTWDCGLQILK
TPC1_KLULA      ------NHEKEFWSRPVSASSGIIAGFVSKTFPIDTLRRRMRTVHFTKFPAVYHEYRYKSSTAIIYKILR
GHC1_PONAB      ----------------------------------------------------------------------
UCP1_CANFA      CHVAGFCTTV-------------------LSSPVDVVKTRFVNS---------VPEQYTSVPNCAMTMLT
S2538_BOTFB     ----------------------------------------------------------------------
MRS3_YEAST      SN--EYNPLIHCLCGSIS-----GSTCAAITTPLDCIKTQIRGSQTVSL---EIMRKADTFSKAASAIYQ
GHC2_HUMAN      EMLAG---------------CGAGMCQVVVTCPMEMLKIQLQDAGRLSASAPSTSRSYTGSASTHRIAWR
S2538_YARLI     ----------------------------------------------------------------------
MRS4_YEAST      ----------------------------------------------------------------------
M2OM_BOVIN      ----------------------------------------------------------------------
HDMCP_HUMAN     AVLCEWLSPAGHXXXXXXXXXXXXXXXXXXXTPMDVIKSRLQ-------ADGQGQRRYRGLLHCMVTSVR
TPC1_CHAGB      ------------------------------TFPLDLVRKRIQQSPTRGRYVHKIPEYYGGTVGALRTILQ
S2544_HUMAN     ----------------------------------------------------------------------
S2538_PYRTR     ----------------------------------------------------------------------
M2OM_HUMAN      ----------------------------------------------------------------------
GHC1_HUMAN      ----------------------------------------------------------------------
S2544_PONAB     ----------------------------------------------------------------------
MCFV_DICDI      -------------------------------YPLDVLRRRMMIQGI---GGNKVL--YKNGWDATKKILS
UCP2_PIG        CHF-----TSAFGAGFCTTVIAS---------PVDVVKTRMNSAPG----------QYSSAGHCALTMLQ
UCP1_OCHDA      CH--------------LLSALIAGFCTTLLSSPVDVVKTRFINSP---------QGQYTSVPSCAMSMLT
S2538_ASHGO     DESGKLTAPASAMVNGVSAFLSASLATTL-TAPFDTIKTRMQ-----------LQSHPVGFVQTLRHIVC
GHC1_MOUSE      ----------------------------------------------------------------------
YMC1_YEAST      KDIPAWK--------LCIFGALSGTALWLMVYPLDVIKS-VMQTDNLPKFGNSIS-------SVAKTLYA
ORNT2_HUMAN     --VAGMDKQAKSDLQTXXXXXXXXXXXXXXXCPTELVKCRLQTMYEMEMSG-KIAKSHNTIWSVVKGILK
ADT1_YEAST      SFLLGWVIT----MGASTA-----------SYPLDTVRRRMMMT------SGQT-IKYDGALDCLRKIVQ
UCP1_RAT        CHVAGFCTTL-------------------LASPVDVVKTRFINS--LPG-------QYPSVPSCAMTMYT
UCP1_DICGR      CHVAGFCTT-------------------FLASPADVVKTRFINS--LPG-------QYPSVPSCAMTMLT
SAMC_MOUSE      AWRRG--HVVDSWQSAVCXXXXXXXXXXVTT-PLDVAKTRIMLAK---AGSSTA---VGNVLSAMHGVWR
S2544_MOUSE     ----------------------------------------------------------------------
S2538_XENLA     -------------VLNFSCGIVAGILASVATQPADVIKTHMQLANEKYHWTGKVALN----------IYR
ODC_BOVIN       --------------------------------PFDVAKSRIQGPQPVPG-----EIKYKTCFKTMATVYQ
MFRN1_BOVIN     ----------------------------------------------------------------------
M2OM_RAT        ----------------------------------------------------------------------
TPC1_DEBHA      ------LFTISNSTHXXXXXXXXXXXXTFFTYPFDLLRTRL---------AANSEAHFLSMSSTIKSIYE
S2538_LACBS     SYVLPPVTSTQATXXXXXXXXXXXXXXXXXXXPFDVIKTKIQV---------RTEAQYHGFLTTIATIWK
S2535_BOVIN     ------------------------------TNPLEVVKTRMQLQGELRAPG-TYQRHYRNVFHAFITIGK
MCFZ_DICDI      VHLPVWQNSAGAIAGTASTLFNN---------PLDTIKTRMQK-----------QGQNQTTMQVVRGIYQ
CMC1_YEAST      QDQVTLSNLVVLPMGAFSGTVGASV-----VYPINLLRTRLQAQGTYAH-----PYVYNGFKDVLLKTLE
UCP1_PHOSU      -YFSSGKETPPTLVNRISAGLMTGGVAVFIGQPTEVVKVRLQAQSHLHG----IKPRYTGTYNAYRIIAT
UCP1_BOVIN      ----------------------------------------------------------------------
MPCP_CAEEL      ---RAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGG----------------ILK
S2538_VANPO     ------------------------------TAPFDTIKTRMQLEPK----------RYTNVWFTFKSIIK
GHC1_BOVIN      ----------------------------------------------------------------------
DIC_MOUSE       ------DNIFTHFVSSF----IAGGCATFLCQPLDVLKTRLMNS----------KGEYQGVFHCAMETAK
MFN2B_XENLA     ----------------------------------------------------------------------
DIC1_CANGA      ------------------------------THPLDLTKVRLQAAP-IPK---------PTIVQMLRSILK
SAMC_HUMAN      -----WSWRQDHVVDSAVCXXXXXXXXXXVTTPLDVAKTRITLAK---AGSSTAD---GNVLSVLHGVWR
LEU5_YEAST      --------------------------------------------------------KYTGLVEAAKHIWI
GHC2_RAT        ------DGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLSASATPTSRPYTGSTSTHRIAWR
S2538_XENTR     VLNFGCGIVA-------------GILASVATQPADVIKTHIQLSHEKCHWTGQVALN----------IYQ
S2538_SCHPO     ----------------------------------------------------------------------
UCP1_MESAU      CHL-----LSAFVAGFCT---------TFLASPADVVKTRF--INSLPG-------QYPSVPSCAMTMLT
MFN2A_XENLA     ----------------------------------------------------------------------
M2OM_NEUCR      AQLKARTQWSSK-VQTLXXXXXXXXXXXXXXXXXXXVKTRLQKQTRGPDG----KLPYNGMVDCFAKVAK
DIC1_YEAST      -------DASKNYT-HLTASLLAGLVATTVCSPADVMKTRIMN------GSGDHQPALKILADAVR----
SAMC_DROME      TPLTGFDSTP---FSVALCGAVAGGISAGLTTPLDVVKTR------IMXXXXXXXXXXXXXXXILHGIYL
MPCP_CHOFU      ----------------------------------------------------------------------
MCFN_DICDI      --------------------------------PNEAVRIRLVAEPTFAKSP----------VEAFGKIFK
GHC2_MOUSE      ------DGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLASTGSTSTHRRPSATLIARELLR
PET8_ASHGO      ----------------------------------------------------------------------
MCFR_DICDI      IGIY-----------KLISGGVAGGLGQTAAYPLDVVRRRI-QTTGYGDGKGVENLKHSTLKTMF-TIFQ
YE08_SCHPO      ------------------------------SYPFEVCRRKMQ------IGGIRKNKSFLRLKQVVQTTYK
TPC1_CANGA      ------------------------------SYPFDVLRTRF---------AANSQGQLIKLRDEIMAIWS
YG04_SCHPO      ----------------------------------------------------------------------
UCP2_BOVIN      ----------------------------------------------------------------------
UCP1_SUNMU      ------------------------------TFPLDTAKVRLQVQGERPNAPG---VKYKGVLGTIATVAK
UCP1_RABIT      CHIAGFCTTL-------------------LSSPVDVVKTRFINSPP---------GQYASVPNCAMTMFT
UCP1_MOUSE      CHVAGFCTTL-------------------LASPVDVVKTRFINS--LPG-------QYPSVPSCAMSMYT
S2538_ASPOR     S-----LKSSSSSINFVSXXXXXXXXXXXXN-PFDAVKTRLQLMPN----------KYGNMMRAVKLMVH
YMC2_YEAST      ----------------------------------------------------------------------
S2538_NEUCR     ----------------------------------------------------------------------
YB8B_SCHPO      ----------------------------------------------------------------------
S2538_CANGA     GRYTAYTSTAINSTSAILSASMATTV----TAPFDTIKTRMQLEPT----------KFKTFWSTLTTIVT
S2538_MAGGR     ----------------------------------------------------------------------
YFL5_YEAST      ---QARNDKAS----SVITGLATSFTLVAMTQPIDVVKTRMMSQ--------NAKTEYKNTLNCMYRIFV
YFL5_YEAS7      ---QARNDKAS----SVITGLATSFTLVAMTQPIDVVKTRMMSQ--------NAKTEYKNTLNCMYRIFV
TPC1_PICGU      ----------------------------------------------------------------------
MTCH1_MOUSE     ------------------------------------------------------EAKYSGVLSSIGKIFK
MTCH1_HUMAN     ------------------------------------------------------EAKYSGVLSSIGKIFK
MNCP_OXYFA      CKENSYFFFGPHWINRLWXXXXXXXXXXXXSMPFDMIRTRLHTMRPLPNG----QMPYNGMIDCFNKIIK
MCAR1_RAT       -HVSNAPEFATRSVAALLAGTT------------EAILTPLERVQTL-LQDHKHHDKFTNTYQAFRAL-R
YFL5_YEAS6      ---QARNDKAS----SVITGLATSFTLVAMTQPIDVVKTRMMSQ--------NAKTEYKNTLNCMYRIFV
YFL5_YEAS1      ---QARNDKAS----SVITGLATSFTLVAMTQPIDVVKTRMMSQ--------NAKTEYKNTLNCMYRIFV
S238B_DANRE     ----------------------------------------------------------------------
MNCP_OXYTR      ----------------------------------------------------------------------
ORT1_YEAST      ----------------------------------------------------------------------
MCAR2_HUMAN     KHVRA-PEFATHGVAAVLAGTA------------EAIFTPLERVQTL-LQNHKHHDKFTNTYQAFKAL-K
YIKC_SCHPO      ------------------------------TFPADVLRRRF-QVNRIPGIGHN----YKNIKSAIFHIYK
S2534_HUMAN     ----------------------------------------------------------------------
MCFU_DICDI      ----------------------------------------------------------------------
CMC_DICDI       ----------------------------------------------------------------------
YQ73_SCHPO      --------------------------------------------------------KYNGMVKCYSTILC
TPC1_CHAGB      ----------------------------------------------------------------------
MFN2B_XENLA     ----------------------------------------------------------------------
MFN2A_XENLA     ----------------------------------------------------------------------
YE08_SCHPO      ----------------------------------------------------------------------
S2538_NEUCR     --------------------------------PFDAVKTRIQLQPK----------KYRNMVQASRKMLA


                         .         .         .         .         *         .         .:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMILRLCGTTS
YKQ9_SCHPO      EQGIVGLYGGLTAHLLRVVPNACILFGSYEVIMHFIG---
RIM2_YEAST      EEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRL-----
S2536_CHICK     EEGYGSLYRGLTTHLVRQIPNTAIMMSTYEVVVYL-----
S2536_DANRE     EEGYRALYRGLTTHLVRQIPNTAIMMCTYELVVYL-----
S2533_DANRE     EEGYAAFYRGLIPQLIRQIPNTAIVLSTYELIVHLLAEPS
S2536_HUMAN     EEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYL-----
S2533_MOUSE     EEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLG---
S2536_MOUSE     EEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYL-----
S2533_HUMAN     EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYL-----
S2533_BOVIN     EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYL-----
MFTC_HUMAN      KEGVGGFYKGIAPNLIRVTPACCITFVVYENV--------
MFTC_MACFA      KEGIGGFYKGIAPNLIRVTPACCITFVVYENV--------
YIA6_YEAST      QEGLKGFYSGFTTNLVRTIPASAITLVSFE----------
MCFW_DICDI      EEGWRGLYRGMGVNLLRVTPSCVITFTSYEYI--------
MCFB_DICDI      DEGVLGLYNGMIPCYLKVIPAISISFCVYEVM--------
YEA6_YEAST      QEGFAGFYSGFATNLVRTVPAAVVTLVSFE----------
MFTC_MOUSE      KEGIGGFYKGIAPNLIRVTPACCITFVVYENV--------
S2541_HUMAN     QQGWLGLYRGMTPTLLKVLPAGGISYVVYEAMKKTLG---
SCMC3_HUMAN     QEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTS
SCM2A_DANRE     TEGPTGLYRGLTPNFLKVIPAVSISYVVYEHIKSTLGVRS
SFC1_YEAST      EEGFRALYKGITPRVMRVAPGQAVTFTVYEYV--------
SCMC2_XENTR     TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKLTLGVQS
SCMC2_XENLA     TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKLTLGVQS
YBC9_SCHPO      LQGILGFYKGFLPHLLRVVPQTCITFLVYEQV--------
SCMC2_HUMAN     TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
SCMC2_BOVIN     TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
SCMC1_RABIT     KEGLPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVT-
SCMC1_HUMAN     KEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVT-
SCM2B_DANRE     TEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
SCMC1_MOUSE     E-GVSGLYRGITPNFMKVLPAVGISYVVYENMKQTLG---
SCM1B_XENLA     KEGFLGLYRGIGPNFLKVLPAVSISYVVYE----------
S2541_MOUSE     QQGWPGLYRGMTPTLLKVLPAGGISYLVYEAMKKTLG---
SCMC2_MOUSE     TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
MCFG_DICDI      QQGIAGFYKGFTPCFIRSVPANAACFVLYE----------
SCMC3_MOUSE     QEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTS
SCMC1_XENTR     KEGFFGLYRGIAPNFLKVLPAVSISYVVYE----------
SCMC1_BOVIN     KEGLPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVT-
SCM1A_XENLA     KEGFFGLYTGIAPNFLKVLPAVSISYVVYE----------
SCMC2_RAT       TEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
AGC1_YEAST      EESFRSFFKGGGARVLRSSPQFGFTLAAYEL---------
YH66_SCHPO      RGGPKALWKGTLPRCVKVAPSCAIMISSYHL---------
BT1_MAIZE       KEGAGGLYRGLGPSCIKLMPAAGIAFMCYE----------
MCATL_RAT       AEGWQVFTRGLASTLLR-----------------------
CMC3_CAEBR      NEGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLGAT-
CMC3_CAEEL      TEGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLGAT-
MFRN1_RAT       LNGLAGYFKGIQARVIYQMPSTAISWSVYE----------
MCATL_MOUSE     AEGWQVFTRGLASTLLR-----------------------
MCFM_DICDI      NEGIIGFYRGLVPNTLKVIPNTSITLLLYEEI--------
SCMC1_DANRE     KEGFFGLYRGILPNFMKVIPAVSISYVVYE----------
MFRN1_MOUSE     LNGLAGYFKGIQARVIYQMPSTAISWSVYE----------
MCATL_HUMAN     AEGWRVFTRGLASTLLRAFP--------------------
MFRN1_HUMAN     LNGLAGYFKGIQARVIYQMPSTAISWSVYE----------
ODC2_YEAST      EEGFRALYKGFVPKVCRLAPGGSLMLVVF-----------
YBT5_SCHPO      NEGFRGLYKGLSPNLLKVAPSVAISYLVYE----------
MCP62_HUMAN     KEGLKVFFRGITVNAVRGFPMSAAMFLGYELSLQ------
CMC2_CAEEL      NEGVTGFYRGITPNFLKVIPAVSISYVVYEKV--------
S2540_DANRE     ENGVSGLFAGFMPRLIKVAPACAIMISTYE----------
PM34_DICDI      SDGFLGFFKGMPSKMVQTVIGAAFMF--------------
MCFD_DICDI      EEGISVFFRGFSATILRAFPTSAVNFLMYE----------
MCATL_BOVIN     EEGWRVFTRGLASTLLRAFP--------------------
FLX1_YEAST      NDGFVGLYKGLSANLVRAIPSTCITFCVYE----------
MCFS_DICDI      KEGVKGLFRGYTPTIIRSFPANAAMFSVYELVIKLLG---
MCAT_MOUSE      EEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMK------
TPC_MOUSE       EEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCNL-----
MCFI_DICDI      TNGIKGFYKGIGPNLARSIPPAAFMLYIVE----------
S2540_XENTR     ENGFGGLFAGLIPRLIKVAPACAIMISTYE----------
S2541_BOVIN     ----------------------------------------
ODC_HUMAN       EEGILALYKGLLPKIMRLGPGGAVMLLVYE----------
MCFX_DICDI      SEGPKALFKGVLPRVCIISPLFGITLVVYEI---------
MCAT_ARATH      SEGVKGLYKGFGPAMARSVPANAACFLAYEM---------
YID3_SCHPO      SEGWRKYYSGMATNFIRTIPASSVTFLSFEIV--------
TPC1_COCIM      DGGVRGLYRGLTVSLIKAAPASAVTMWTYERVLKI-----
S2543_HUMAN     AQGVLGLWNGLTANLLKIVPYFGIMFSTFEFCKRIC----
CMC_DROME       EEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRL-----
AGC1_ASHGO      EEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNL-----
S2540_XENLA     ENGFGGLFAGLVPRLIKVAPACAIMISTYE----------
S2540_HUMAN     KNGFSGLFSGLIPRLIKIAPACAIMISTYE----------
UCPB_DICDI      SEGISGLYKGFLPNWFRIGPHTIVTFILYEYLRKVSG---
TPC1_SCLS1      NEGYRGLYRGLTVSLFKAAPASAVTMWTYERVLRL-----
S2535_DANRE     KEGMTGLYKGLGASYFRLGP--------------------
OAC1_SCHPO      SEGFFALYKGFGAHLARIAPHTIFCLTFVEQTNKL-----
S2543_MOUSE     TQGVLGLWNGLTANLLKVVPYFGVMFSMFEFCKRI-----
S2540_BOVIN     KNGFSGLFTGLIPRLIKIAPACAVMISTYE----------
S2534_RAT       QEGPLALYKGVGPAYLRLGPHTILSMFFWDELRKL-----
MCFL_DICDI      VDGLKGFWKGFSPCLLRTFPANGATFVAYECVMK------
TPC_HUMAN       KEGALGFFKGLSPSLLKAALSTGFMFFSYE----------
TPC1_MAGGR      TEGFRGLYRGLTVSLIKSAPASAVTMWTYERVLR------
TPC1_BOTFB      NEGYRGLYRGLTVSLFKSAPASAVTMWTYERVL-------
TPC_PONAB       KEGALGFFKGLSPSLLKAALSTGFMFFWYE----------
TPC_BOVIN       EEGAQGCFKGLSPSLLKAALSTGLVFFWYEL---------
PM34_HUMAN      RFGIMGLYKGLEAKLLQTVLTAALMFLVYEKL--------
MFRN_DICDI      EEGMDGYLRGMKPRMVFHSMSSAIVWSVYEYFKFILG---
MCAT_MACFA      EFGIRGIYKGTVVTLMRDVPASGMYFMTYEWV--------
ODC_PONAB       EEGILALYKGLLPKIMRLGPGGAVMLLVYE----------
MCP62_BOVIN     KEGLKVFFRGITVNAVRGFPMSAAMFLGYELSLQ------
KMCP1_RAT       NEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKL-----
KMCP1_MACFA     NEGFFALYKGFWPNWLRLGPWNIILFVTYEQLKKL-----
S2534_MOUSE     QEGPLALYKGLGPAYLRLGPHTILSMFFWDELRKL-----
KMCP1_MOUSE     NEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKL-----
S2540_DICDI     QEGWKGLTKGLVPRVAKVSPACAIMISTFEYI--------
S2538_SHEEP     DYGLRGFFQGSVPRALRRTLVAAMAWTVYEEMMAKMGLKS
S2534_BOVIN     QEGPLALYKGLGPVYLRLGPHTILSMLFWDELRKLAG---
MCFC_DICDI      KEGPIGLYKGIVPSFMKSIPSHSITFIVYE----------
MCAT_RAT        EFGIRGFYKGTALTLMRDVPASGMYFMTYEWLKNL-----
CMC1_CAEEL      ELGFLGLYKGSRACFLRDIPFSAIYFPAY-----------
TPC_MACFA       KEGALGFFKGLSPSLLKAALSTGFMFFWYE----------
S2540_RAT       DRGFSGLFTGLIPRLVKIVPACAIMISSYEL---------
S2540_MOUSE     DKGFSGLFTGLIPRLVKIVPACAIMISSYEL---------
KMCP1_HUMAN     NEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKL-----
TXTP_YEAST      EEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVL-------
CMC2_MOUSE      EEGPKALWKGVAARVFRSSPQFGVTLLTYELLQR------
ADT1_GOSHI      NEGGKSLFKGAGSNILRAIAGAGVLAGYDKLQLIVFG---
UCP3_PIG        ----------------------------------------
TPC1_ASPNC      TQGIRGLYRGLTVSLFKAAPASAVTMWTYETSLRL-----
TPC1_ASPFU      TQGVRGLYRGLTVSLIKAAPASAITMWTYERSLKL-----
MTM1_YEAST      TEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFG---
MCAT_HUMAN      EFGIRGIYKGTVLTLMRDVPASGMYFMTYEWL--------
YP011_YEAST     AEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV--------
S2543_DANRE     NKGVMALWSGLTANMVKIVPYFGLLFSCFEMCKQVC----
PM34_MOUSE      RFGIMGLYKGLEAKLLQTVLTAALMFLVYEKL--------
ODC_SCHPO       EEGFTALYKGFVPKVLRLGPGGGILLVVFNSVI-------
MFRN_CAEEL      QRGLSGFSCGLQARVIFQVPATALSWSVYEL---------
MFRN2_DANRE     LGGLPAYFKGVQARVIYQMPSTAISWSVYE----------
ADT1_MAIZE      KEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG---
ODC_MOUSE       EEGILALYKGLVPKVMRLGPGGGVMLLVYE----------
ADT2_YEAST      AEGVGSLFKGCGANILRGVAGAGVMYDQLQMIL-------
TPC1_NEOFI      TQGVRGLYRGLTVSLIKAAPASAITMWTYERSLKL-----
ODC1_YEAST      EEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVM-------
MCP62_MOUSE     QEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLK------
KMCP1_XENLA     NEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKL-----
S2539_HUMAN     ESGTKGLFAGFLPRIIKAAPSCAIMISTYE----------
ADT_ORYSJ       NEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG---
TPC1_ASPTN      TQGVRGLYRGLTVSLFKAAPASAVTMWTYEETLR------
TPC1_LODEL      REGVLGLYRGYGVSILKTAPTSAISLWTYEYVI-------
TPC1_EMENI      TQGLRGLYRGLTVSLVKAAPASAVTMWTYERALKL-----
KMCP1_XENTR     NEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKL-----
ADT1_WHEAT      KEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG---
S2542_RAT       EEGVRGLYKGLSMNWLKGPIAVGISFTTFDLM--------
S2542_MOUSE     EEGVRGLYKGLSMNWLKGPIAVGISFTTFDLM--------
MCP62_DANRE     TEGIHVFFRGATVNAIRGFPMCATMFLGYELSLQ------
COLT_DROME      KDGPLALYRGVTPIMLRAFPNAACFFGI------------
S2542_XENLA     EEGIRGLYKGLSMNWVKGPVAVGISFTTFDL---------
S2538_NEOFI     ----------------------------------------
ADT_CHLRE       NEGMKSLFKGAGANILR-----------------------
TPC1_ASPOR      TQGMRGLYRGLTVSLFKAAPASAVTMWTYEKSL-------
S2542_XENTR     EGVIRGLYKGLSMNWVKGPVAVGISFTTFDL---------
S2538_ASPCL     EDGVRSLFGGLGLRITRKALSSALAWTVYELILRAEG---
S238A_DANRE     EHGLVGFFRGAVPRSLRRTMMAAMAWTVYEQLMAQMGLKS
SAMC_XENTR      TQGIMGLFAGVIPRMTAISLGGFIFLGAYDKVRTL-----
S2542_HUMAN     EEGVRGLYKGLSMNWVKGPIAVGISFTTFDLM--------
CMC1_MOUSE      EEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR------
S2539_BOVIN     ESGTRGLFAGFLPRIIKAAPSCAIMISTYE----------
ODC_RAT         EEGILALYKGLLPKVMRLGPGGGVMLLVYE----------
ADT_KLULA       AEGIKSLFKGCGANILRGVAGAGVI-SMYDQL--------
UCP3_BOVIN      ----------------------------------------
S2545_MOUSE     QEGIGVFFKGMTLNSARAFPVNAATFLSYEYLLRL-----
S2545_HUMAN     QEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLRWWG---
S2538_ASPFU     ----------------------------------------
S2538_ASPFC     ----------------------------------------
MFRN_CAEBR      QRGMAGFSCGLQARVIFQVPATALSWSVYEL---------
DIF1_CAEEL      EEGPRALFKGFWPVMLRAFPNAACFFGL------------
UCP3_HUMAN      ----------------------------------------
S2542_DANRE     EEGIVGLYKGLSMNWVKGPIAVGISFMTFDL---------
S2538_MOUSE     NHGLRGFFHGSVPXXXXXXXXXXXXWTVYEEMMARMGLKS
MCFE_DICDI      EEGPKAFVKGMGARIWWIAPGNALTIASYEQL--------
TPC1_AJECN      SQGPKGLYRGLTVSLIKAAPASAVTMWTYEHVLGL-----
PM47A_CANBO     EEGVSSFYRGLSVKLLQSILNAAFLFYFKEELLIL-----
M2OM_DICDI      AEGFKAFYKGFNPYFMRLGPQTILTFIFVEQL--------
YM39_YEAST      SEGVLGFFSGVGPRFVWTSVQSSIMLLLYQMTLR------
MFRN2_MOUSE     VGGVTAYFRGVQARVIYQIPSTAIAWSVYE----------
HDCPB_DANRE     NEGLQGFYRGXXXXXXXXXXXXXLVFGTYRNILQ------
CMC1_PONAB      EEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR------
CMC1_HUMAN      EEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR------
ADT2_WHEAT      KEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG---
TPC1_YARLI      TEGPLGFFRGVSSSIISIAPYMGLFFASY-----------
ODC_DICDI       EEGFSALYKGFLPKVLRLGPGGGILLVVNEFVMKL-----
MFRN2_HUMAN     VGGVTAYFRGVQARVIYQIPSTAIAWSVYE----------
MCFA_DICDI      TEGISALYKGIRPAYLKVIPTVSINFLIYEGAITL-----
ADT_SCHPO       KEGARSFFKGAGANILRGVAGAGVL-SIYDQV--------
ADT2_MAIZE      KEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG---
TPC1_PHANO      HEGRRGMYRGLTVSLLKAAPASAVTMWTYE----------
S2538_BOVIN     DYGLRGFFQGSVPXXXXXXXXXXXXWTVYEEMMAKMGLKS
EAAC_ARATH      EEGVKGYWKGNLPQVIRVLPYSAVQLLAYE----------
YD1K_SCHPO      KAGLRGFYRGFVPVLVRAAPANAVTFYVYETV--------
UCP5_MOUSE      HEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRL-----
CMC2_HUMAN      EEGPKALWKGAGARVFRSSPQFGVTLLTYELLQR------
MFRN1_DANRE     LGGVPAFFKGIQARVIYQMPSTAIAWSVYE----------
ADT1_ARATH      NEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFG---
TPC1_YEAS7      QEGVSSLYRGILVALSKTIPTTFVSFWGYE----------
TAAC_ARATH      ----------------------------------------
S2539_MOUSE     ESGTRGLFAGFLPRIIKAAPSCAIMISTYE----------
S2538_AJECN     ----------------------------------------
UCP5_HUMAN      HEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRL-----
S2538_CHAGB     ----------------------------------------
ADT4_MOUSE      ----------------------------------------
PM47B_CANBO     EEGVSSFYRGLSVKLLQSILNAAFLFYFKEELLIL-----
OAC1_YEAST      IEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL-----
ADT1_SOLTU      NEGPKSLFKGAGANILR-----------------------
TPC1_YEAST      QEGVSSLYRGILVALSKTIPTTFVSFWGYE----------
CMC2_MACFA      DLGFFGIYKGAKACFLRDIPFSAIYFPCY-----------
S2538_ASPTN     EDGVRSLFGGLGLRITRKALSSALAWTVYELILR------
S2538_ASPNC     EDGVRSLFGGLGLRITRKALSSALAWTVYELILR------
S2538_HUMAN     DYGLRGFFQGGIPXXXXXXXXXXXXWTVYEEMMAKMGLKS
ADT4_MACFA      ----------------------------------------
ADT3_YEAST      SEGVGSLFKGCGANILRSVAGAGVMYDQLQMIL-------
ADT4_HUMAN      ----------------------------------------
ADT3_HUMAN      DEGGKAFFKGAWSNVLRGMGGAFVL---------------
UCP2_CYPCA      ----------------------------------------
S2535_MOUSE     TEGFFGMYKGIGASYFRLGPHTILSLFFWDQL--------
ADT1_RAT        DEGRKAFFKGAWSNVLRGMGGAFVL---------------
ADT1_MOUSE      DEGANAFFKGAWSNVLRGMGGAFVL---------------
ADT1_BOVIN      SDGLRGLYQGFNVSVQGIIIYRAAYFGVYD----------
YIKC_SCHPO      ----------------------------------------
UCPA_DICDI      KEGFGAVYKGFWAHYLRLGPHTILTLVFWEQFKKL-----
SAMC_XENLA      TQGIMGLFAGVIPRMTMISLGGFIFLGAYDKV--------
GDC_MOUSE       QHGIRGLYRGLSLNYIRCIPSQAVAFTTYELM--------
ARG13_NEUCR     QAGIKGFYRGCGITVLRSAPSSAFIFMVYD----------
ADT_NEUCR       KEGVKSLFKGAGANILRGVAGAGVL---------------
ADT1_ANOGA      QEGSGAFFKGAFSNVLRGTGGALVLV-FYDEVKALLG---
S2534_DANRE     AEGVLGLYKGMTPVFVRLAPHTTLSMLLWDVL--------
GDC_BOVIN       HHGIRGLYRGLSLNYIRCVPSQAVAFTTYELM--------
UCP3_RAT        ----------------------------------------
TXTP_CAEEL      AEGLGGIYKGVTATMAKQGSNQAIRFFVMETL--------
TPC1_PICST      NEGVLGLYKGFGISVLKTSPTSAVSLFVYEYSL-------
S2538_YEAS7     NENVLKLFSGLSMRLARKALSAGIAWGIYEELVK------
S2538_YEAS1     NENVLKLFSGLSMRLARKALSAGIAWGIYEELVK------
ORNT1_MOUSE     NEGITALYSGLKPTMIRAFPANGALFLAYEYSRKL-----
ADT2_ANOGA      QEGTGAFFKGAFSNVLRGTGGAFVLV-LYDEIKKV-----
ADT1_RABIT      SDGLRGLYQGFNVSVQGIIIYRAAYFGVYD----------
YQ51_CAEEL      SRGISAFSSGLVPRLVKVSPSCAIMISFYE----------
TPC1_CANAL      NEGVFGLYKGFGISVLKTAPTSAISLFMYEYSL-------
S2538_YEAST     NENVLKLFSGLSMRLARKAFSAGIAWGIYEELVK------
ADT2_BOVIN      DEGAKAFFKGAWSNVLRGMGGAFVL---------------
ADT2_ARATH      KEGAKSLFKGAGANILR-----------------------
YFG5_SCHPO      QDGLLRFWSGATPRLARLILSGGIVFTVYEKVMEI-----
S2538_RAT       THGLRGFFHGSVPXXXXXXXXXXXXWTVYEEMMAKMGLKS
GDC_HUMAN       HHGIRGLYRGLSLNYIRCIPSQAVAFTTYELM--------
ADT3_PIG        DEGGKAFFKGAWSNVLRGMGGAFVL---------------
ADT3_BOVIN      DEGGKAFFKGAWSNVLRGMGGAFVL---------------
ADT2_HUMAN      DEGGKAFFKGAWSNVLRGMGGAFVL---------------
MCFJ_DICDI      ERGIKGLYKGFGATIIRNVPYSGIWWGTYEI---------
HDCPA_DANRE     TEGLGVFFRSLGINCLRAFPVNMVVFAVYEVSVRV-----
UCP3_CANFA      QEGPTAFYKGFTPSFLRLGTWNVVMFVTYEQLKR------
UCP2_HUMAN      KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR------
UCP2_CANFA      KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR------
ADT4_BOVIN      ----------------------------------------
ADT2_TACAC      DEGSKAFFKGAWSNVLRGMGGAFVL---------------
UCP2_DANRE      ----------------------------------------
ADT1_HUMAN      DEGAKAFFKGAWSNVLRGMGGAFVL---------------
UCP4_HUMAN      ----------------------------------------
UCP3_MOUSE      QEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKR------
UCP2_RAT        KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR------
UCP2_MOUSE      KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR------
TPC1_NEUCR      REGVRGLYRGLTVSLFKAAPASAVTMWTYERALKL-----
S2535_HUMAN     TEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSL-----
ADT2_PONAB      DEGGKAFFKGAWSNVLR-----------------------
S2539_RAT       ESGTRGLFAGFLPRIIKAAPSCAIMISTYE----------
S2538_COCIM     ----------------------------------------
ORNT1_HUMAN     NEGITALYSGLKPTMIRAFPANGALFLAYEYSRKL-----
MCFP_DICDI      EEGILALYKGLSINYVKVIPTASIAFYTYEYL--------
YETC_SCHPO      YGGIPSFFKGIRPRMVVAMPATAVSWAAYE----------
UCP2_PONAB      KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR------
S2534_HUMAN     QEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAG---
MCFU_DICDI      SEGILSLYRGYIPHTLYVLPASAISFVCYEAIVQ------
ADT_DICDI       RDGLIGLYRGFGVSVGGIFVYRAAFFGGYD----------
UCP1_HUMAN      NEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKR------
TPC1_VANPO      ----------------------------------------
TXTP_BOVIN      NEGLKAFYKGTVPRLGRVCLDVAIVFIIYDEVVKL-----
SAMC_DANRE      SRGIPGLFAGSIPRVMFISMGGFIFLGAYEKVRR------
ADT2_SOLTU      NEGPKSLF--------------------------------
YAD8_SCHPO      KHGVKGFTRGLFTRMCYIMPSGMISMSVFE----------
S2538_SCLS1     ----------------------------------------
GDC_RAT         HHGIRGLYRGLSLNYIRCIPSQAVAF--------------
ADT_CHLKE       QEGMKAFFKGAWSNVLRGAGGAFVL---------------
ADT2_MOUSE      ----------------------------------------
MFRN_DROME      MAGPLGFFRGTTARVLYSMPATAICWSTYEFFFYLCG---
MCFY_DICDI      ----------------------------------------
M2OM_MOUSE      ----------------------------------------
CMC_DICDI       EEGPRALFKGALARVFRSSPQFGVTLVSYELL--------
ADT2_RAT        ----------------------------------------
YQ73_SCHPO      ----------------------------------------
HDMCP_RAT       EEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVLRL-----
HDMCP_MOUSE     EEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVLRL-----
ADT_DROME       ----------------------------------------
TXTP_RAT        NEGPKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKL-----
TXTP_HUMAN      KEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKL-----
TPC1_KLULA      QEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDL-----
GHC1_PONAB      ----------------------------------------
UCP1_CANFA      KEGPLAFFKGFVPSFLRLGSWNVIMFVCFEQLKR------
S2538_BOTFB     ----------------------------------------
MRS3_YEAST      VYGWKGFWRGWKPRIVANMPATAISWTAYE----------
GHC2_HUMAN      TQGLAGLYRGLGATLLRDIPFSIIYFPLF-----------
S2538_YARLI     ----------------------------------------
MRS4_YEAST      ----------------------------------------
M2OM_BOVIN      ----------------------------------------
HDMCP_HUMAN     EEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVLRL-----
TPC1_CHAGB      REGLRGLYRGLTVSLLKAAPASAVTMWTYERALK------
S2544_HUMAN     ----------------------------------------
S2538_PYRTR     ----------------------------------------
M2OM_HUMAN      ----------------------------------------
GHC1_HUMAN      ----------------------------------------
S2544_PONAB     ----------------------------------------
MCFV_DICDI      NEGLVAFYHGIIPAYFKVVPTVAISFAVYEI---------
UCP2_PIG        KEGPRAFYKGFTPSFLRLGSWNVVMFVTYEQLKR------
UCP1_OCHDA      KEGPTAFFKGFAPSFLRLASWNVIMFVCFEKLKR------
S2538_ASHGO     EERARTLFDGLSLRLCRKAMSACIAWGIYEELLKL-----
GHC1_MOUSE      ----------------------------------------
YMC1_YEAST      NGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLLG---
ORNT2_HUMAN     KDGPLGFYHGLSSTLLQEVPGYFFFFGGYEL---------
ADT1_YEAST      KEGAYSLFKGCGANIFRGVAAAGVI-SLYDQL--------
UCP1_RAT        KEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQL--------
UCP1_DICGR      KEGPTAFFKGFVPSFLRLASWNVIMFVCFEQL--------
SAMC_MOUSE      SQGLAGLFAGVLPRMAAISMGGFIFLGAYD----------
S2544_MOUSE     ----------------------------------------
S2538_XENLA     TQGLTGFFQGGVPXXXXXXXXXXXXWTVYEQMMEKMGLKS
ODC_BOVIN       EEGILALYKGLLPKIMRLGPGGAVMLLVYE----------
MFRN1_BOVIN     ----------------------------------------
M2OM_RAT        ----------------------------------------
TPC1_DEBHA      MHGIGGFCKGLTPGLLSVASSTGLMFWSYEL---------
S2538_LACBS     QRGITGYFDGASLRMSRKVLSSAIGWAVYEGGLMLMRTST
S2535_BOVIN     VDGLAALQRGLAPALLYQFLMNGIRLGTY-----------
MCFZ_DICDI      ETGVKGYWAGVIPRILRVAPGQAITWAVVELVMGILEPSS
CMC1_YEAST      REGYQGLFKGLVPTLAKVCPAVSISYLCYE----------
UCP1_PHOSU      TESLSTLWKGTTPNLLRNV---------------------
UCP1_BOVIN      ----------------------------------------
MPCP_CAEEL      KLGFAGVWKGLVPRIIMIGTLTALQWFIYDSV--------
S2538_VANPO     NEGILKLFSGLSMRLTRKALSAGIAWGIYEELIKL-----
GHC1_BOVIN      ----------------------------------------
DIC_MOUSE       -LGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFG---
MFN2B_XENLA     ----------------------------------------
DIC1_CANGA      NEGIVGLYAGLSASLLRQCTYTTARFGMYDAL--------
SAMC_HUMAN      SQGLAGLFAGVFPRMAAISLGGFIFLGAYD----------
LEU5_YEAST      NDGVRGFFQGHSATLLRIFPYAAVKFVAYEQI--------
GHC2_RAT        TQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQL-----
S2538_XENTR     NHGLTGFFRGGLPXXXXXXXXXXXXWTVYEQMMEKMGLKS
S2538_SCHPO     ----------------------------------------
UCP1_MESAU      KEGPTAFFKGFVPSFLRLASWNVIMFVCFEQL--------
MFN2A_XENLA     ----------------------------------------
M2OM_NEUCR      QEGVFRFYRGFGTYYVRIAPHAMV----------------
DIC1_YEAST      KEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL--------
SAMC_DROME      ERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILGATS
MPCP_CHOFU      ----------------------------------------
MCFN_DICDI      QEGVLGFYKGLPPILLKQVPYTMAKFAVFE----------
GHC2_MOUSE      TQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQL-----
PET8_ASHGO      ----------------------------------------
MCFR_DICDI      KEGIYALFKGISINYIKVIPTNGVAFLTYETL--------
YE08_SCHPO      EAGMRGFFVGLTIGYIKVIPMVSTSFFVYNHSKALLG---
TPC1_CANGA      HEGLMGFFSGCGSSMINIGLNTAIMFGVYESI--------
YG04_SCHPO      ----------------------------------------
UCP2_BOVIN      ----------------------------------------
UCP1_SUNMU      TEGPLKLYGGLPAGIQRQISFASLRIGLYDTV--------
UCP1_RABIT      KEGPTAFFKGFVPSFLRLGSWNVIMFVCFEKL--------
UCP1_MOUSE      KEGPTAFFKGFVASFLRLGSWNVIMFVCFEQL--------
S2538_ASPOR     EDGVRSXXXXXXXRITRKALSSALAWTVYELILR------
YMC2_YEAST      ----------------------------------------
S2538_NEUCR     ----------------------------------------
YB8B_SCHPO      ----------------------------------------
S2538_CANGA     QEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIK------
S2538_MAGGR     ----------------------------------------
YFL5_YEAST      QEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS
YFL5_YEAS7      QEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS
TPC1_PICGU      ----------------------------------------
MTCH1_MOUSE     EEGLLGFFVGLIPHLL------------------------
MTCH1_HUMAN     EEGLLGFFVGLIPHLL------------------------
MNCP_OXYFA      YENFGSFYAGGEAYFLRL----------------------
MCAR1_RAT       CHGVAEYYRGLVPILFRNGFSNILFFGL------------
YFL5_YEAS6      QEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS
YFL5_YEAS1      QEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS
S238B_DANRE     ----------------------------------------
MNCP_OXYTR      ----------------------------------------
ORT1_YEAST      ----------------------------------------
MCAR2_HUMAN     CHGIGEYYRGLVPILFRNGLSNVLFFGL------------
YIKC_SCHPO      TEGINGFFRGYSSNMLKIIPVMSITWYTYETVSKM-----
S2534_HUMAN     ----------------------------------------
MCFU_DICDI      ----------------------------------------
CMC_DICDI       ----------------------------------------
YQ73_SCHPO      EEGVFGLYSGVCPMLIGSLPATALFFSSYEYTKR------
TPC1_CHAGB      ----------------------------------------
MFN2B_XENLA     ----------------------------------------
MFN2A_XENLA     ----------------------------------------
YE08_SCHPO      ----------------------------------------
S2538_NEUCR     EEGVRSMMDGLALRMSRKAMSSALAWTVYEELIR------