[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00384

[Show Plain Result]


## Summary of Sequence Search
    1::406
   76::156     3e-07  33%  652 aa  CPSF6_DROME RecName: Full=Cleavage and polyadenylation specificity
   82::129     5e-07  42%  551 aa  CPSF6_MOUSE RecName: Full=Cleavage and polyadenylation specificity
   82::129     5e-07  42%  551 aa  CPSF6_HUMAN RecName: Full=Cleavage and polyadenylation specificity
   82::129     5e-07  42%  551 aa  CPSF6_CHICK RecName: Full=Cleavage and polyadenylation specificity
   82::129     5e-07  42%  551 aa  CPSF6_BOVIN RecName: Full=Cleavage and polyadenylation specificity
   28::132     1e-05  31%  344 aa  SQD_DROME RecName: Full=RNA-binding protein squid;AltName:
   82::134     2e-05  36%  462 aa  CPSF7_RAT RecName: Full=Cleavage and polyadenylation specificity
   82::134     2e-05  36%  471 aa  CPSF7_MOUSE RecName: Full=Cleavage and polyadenylation specificity
   82::134     2e-05  36%  471 aa  CPSF7_HUMAN RecName: Full=Cleavage and polyadenylation specificity
   82::129     2e-05  40%  552 aa  CPSF6_PONAB RecName: Full=Cleavage and polyadenylation specificity
  141::209     3e-05  40%  930 aa  RBM10_MOUSE RecName: Full=RNA-binding protein 10;AltName:
  141::209     3e-05  40%  930 aa  RBM10_HUMAN RecName: Full=RNA-binding protein 10;AltName:
   27::123     3e-05  28%  359 aa  ELAV2_PONAB RecName: Full=ELAV-like protein 2;
   27::123     3e-05  28%  360 aa  ELAV2_MOUSE RecName: Full=ELAV-like protein 2;AltName:
   27::123     3e-05  28%  359 aa  ELAV2_HUMAN RecName: Full=ELAV-like protein 2;AltName:
   88::170     6e-05  34%  516 aa  PU60B_DANRE RecName: Full=Poly(U)-binding-splicing factor PUF60-B;
    7::113     6e-05  28%  407 aa  DAZP1_HUMAN RecName: Full=DAZ-associated protein 1;AltName:
    7::113     8e-05  28%  406 aa  DAZP1_MOUSE RecName: Full=DAZ-associated protein 1;AltName:
  136::198     1e-04  37%  564 aa  PUF60_RAT RecName: Full=Poly(U)-binding-splicing factor
  130::192     1e-04  37%  558 aa  PUF60_PONAB RecName: Full=Poly(U)-binding-splicing factor
  136::198     1e-04  37%  564 aa  PUF60_MOUSE RecName: Full=Poly(U)-binding-splicing factor
  131::193     1e-04  37%  559 aa  PUF60_HUMAN RecName: Full=Poly(U)-binding-splicing factor
  102::164     1e-04  37%  530 aa  PUF60_BOVIN RecName: Full=Poly(U)-binding-splicing factor
   27::123     1e-04  28%  359 aa  ELAV2_RAT RecName: Full=ELAV-like protein 2;AltName:
  238::313     2e-04  34%  768 aa  PABP_COCIM RecName: Full=Polyadenylate-binding protein, cytoplasmic
    5::85      2e-04  30%  157 aa  GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic
  165::215     2e-04  35%  474 aa  YHKF_SCHPO RecName: Full=Uncharacterized RNA-binding protein
    2::79      2e-04  33%  105 aa  RBPF_ANASP RecName: Full=Putative RNA-binding protein rbpF;
   40::130     2e-04  29%  380 aa  ELAV4_HUMAN RecName: Full=ELAV-like protein 4;AltName:
   67::132     4e-04  40%  852 aa  RBM10_RAT RecName: Full=RNA-binding protein 10;AltName:
   30::123     4e-04  30%  373 aa  ELAV4_RAT RecName: Full=ELAV-like protein 4;AltName:
   42::135     4e-04  30%  385 aa  ELAV4_MOUSE RecName: Full=ELAV-like protein 4;AltName:
   34::109     5e-04  33%  158 aa  GRP2_ARATH RecName: Full=Glycine-rich RNA-binding protein 2,
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPSF6_DROME     ----------------------------------------------------------------------
CPSF6_MOUSE     ----------------------------------------------------------------------
CPSF6_HUMAN     ----------------------------------------------------------------------
CPSF6_CHICK     ----------------------------------------------------------------------
CPSF6_BOVIN     ----------------------------------------------------------------------
SQD_DROME       ----------------------------------------------------------------------
CPSF7_RAT       ----------------------------------------------------------------------
CPSF7_MOUSE     ----------------------------------------------------------------------
CPSF7_HUMAN     ----------------------------------------------------------------------
CPSF6_PONAB     ----------------------------------------------------------------------
RBM10_MOUSE     ----------------------------------------------------------------------
RBM10_HUMAN     ----------------------------------------------------------------------
ELAV2_PONAB     ----------------------------------------------------------------------
ELAV2_MOUSE     ----------------------------------------------------------------------
ELAV2_HUMAN     ----------------------------------------------------------------------
PU60B_DANRE     ----------------------------------------------------------------------
DAZP1_HUMAN     ----------------------------------------------------------------------
DAZP1_MOUSE     ----------------------------------------------------------------------
PUF60_RAT       ----------------------------------------------------------------------
PUF60_PONAB     ----------------------------------------------------------------------
PUF60_MOUSE     ----------------------------------------------------------------------
PUF60_HUMAN     ----------------------------------------------------------------------
PUF60_BOVIN     ----------------------------------------------------------------------
ELAV2_RAT       ----------------------------------------------------------------------
PABP_COCIM      ----------------------------------------------------------------------
GRPA_MAIZE      ----------------------------------------------------------------------
YHKF_SCHPO      ----------------------------------------------------------------------
RBPF_ANASP      ----------------------------------------------------------------------
ELAV4_HUMAN     ----------------------------------------------------------------------
RBM10_RAT       ----------------------------------------------------------------------
ELAV4_RAT       ----------------------------------------------------------------------
ELAV4_MOUSE     ----------------------------------------------------------------------
GRP2_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxESGQPGKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKD
CPSF6_DROME     --------------------GVYHQSSGSLTPT-MNRRYQLYVGNLTWWTTDQDIANSLRDIGV-SDLQE
CPSF6_MOUSE     ---------------------------------------ALYIGNLTWWTTDEDLTEAVHSLGV-NDILE
CPSF6_HUMAN     ---------------------------------------ALYIGNLTWWTTDEDLTEAVHSLGV-NDILE
CPSF6_CHICK     ---------------------------------------ALYIGNLTWWTTDEDLTEAVHSLGV-NDILE
CPSF6_BOVIN     ---------------------------------------ALYIGNLTWWTTDEDLTEAVHSLGV-NDILE
SQD_DROME       --ENGDAGAAGSTNGSSDNQSAASGQRDDDRK--------LFVGGLSWETTEKELRDHF---GKYGEIES
CPSF7_RAT       --------------------------------------AAVYVGSFSWWTTDQQLIQVIRSIGVY-DVVE
CPSF7_MOUSE     --------------------------------------AAVYVGSFSWWTTDQQLIQVIRSIGVY-DVVE
CPSF7_HUMAN     --------------------------------------AAVYVGSFSWWTTDQQLIQVIRSIGVY-DVVE
CPSF6_PONAB     ---------------------------------------ALYIGNLTRWTTDEDLTEAVHSLGV-NDILE
RBM10_MOUSE     --------------------------------------------------TEDDIRGQLQSHGVQA--RE
RBM10_HUMAN     --------------------------------------------------TEDDIRGQLQSHGVQA--RE
ELAV2_PONAB     --------------------------SPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLF---GSIGEIES
ELAV2_MOUSE     --------------------------SPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLF---GSIGEIES
ELAV2_HUMAN     --------------------------SPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLF---GSIGEIES
PU60B_DANRE     ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
DAZP1_HUMAN     -----------------------------------DEIGKLFVGGLDWSTTQETLRSYFSQYG---EVVD
DAZP1_MOUSE     -----------------------------------DEIGKLFVGGLDWSTTQETLRSYFSQYG---EVVD
PUF60_RAT       ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
PUF60_PONAB     ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
PUF60_MOUSE     ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
PUF60_HUMAN     ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
PUF60_BOVIN     ----------------------------------------VYVGSIYYELGEDTIR---QAFAPFGPIKS
ELAV2_RAT       --------------------------SPVDSGNTEDSKTNLIDNYLPQNMTQEELKSLF---GSIGEIES
PABP_COCIM      ----------------------------------------VYVKNIDQDTTEEEFRDLFEKFG---EITS
GRPA_MAIZE      -----------------------------------DVEYRCFVGGLAWATSNESLE---NAFASYGEILD
YHKF_SCHPO      ----------------------------------------MFIGGLNWETTDDSLRDYFEQFG---EVLD
RBPF_ANASP      ---------------------------------------SIYVGNLSYEVTQEDIS---NVFAEYGSVKR
ELAV4_HUMAN     --------------------------------TTDDSKTNLIVNYLPQNMTQEEFRSLF---GSIGEIES
RBM10_RAT       -----------------------------------------------------EIRGQLQSHGVQA--RE
ELAV4_RAT       ----------------------------TGAATD-DSKTNLIVNYLPQNMTQEEFRSLF---GSIGEIES
ELAV4_MOUSE     ----------------------------TGAATD-DSKTNLIVNYLPQNMTQEEFRSLF---GSIGEIES
GRP2_ARATH      -------------------------------------STKLFIGGLSWGTDDASLR---DAFAHFGDVVD


                         +         .         .         .         .         *         .:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGK
CPSF6_DROME     VKFFENRANGQSKGFSVISLGSESSLRAVLDQL-------------------------------------
CPSF6_MOUSE     IKFFENRANGQSKGFALV----------------------------------------------------
CPSF6_HUMAN     IKFFENRANGQSKGFALV----------------------------------------------------
CPSF6_CHICK     IKFFENRANGQSKGFALV----------------------------------------------------
CPSF6_BOVIN     IKFFENRANGQSKGFALV----------------------------------------------------
SQD_DROME       INVKTDPQTGRSRGFAFIVFTNTEASAADEHIINSKKVDPKKAK--------------------------
CPSF7_RAT       LKFAENRANGQSKGYAEVVVAS------------------------------------------------
CPSF7_MOUSE     LKFAENRANGQSKGYAEVVVAS------------------------------------------------
CPSF7_HUMAN     LKFAENRANGQSKGYAEVVVAS------------------------------------------------
CPSF6_PONAB     IKFFENRANGQSKGFALV----------------------------------------------------
RBM10_MOUSE     VRLMRNKSSGQSRGFAFVEFSHLQDATANQHSLNIL------GQKVSMHYSDP-----------------
RBM10_HUMAN     VRLMRNKSSGQSRGFAFVEFSHLQDATANQHSLNIL------GQKVSMHYSDP-----------------
ELAV2_PONAB     CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
ELAV2_MOUSE     CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
ELAV2_HUMAN     CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
PU60B_DANRE     IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNGRPGSIGQAQP-----------------
DAZP1_HUMAN     CVIMKDKTTNQSRGFGFVKFKDPNCVASRPHTLDGRNIDPKPC-------TPRGMQPERTRPKEGWQKGR
DAZP1_MOUSE     CVIMKDKTTNQSRGFGFVKFKDPNCVASRPHTLDGRNIDPKPC-------TPRGMQPERTRPKEGWQKGR
PUF60_RAT       IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
PUF60_PONAB     IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
PUF60_MOUSE     IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
PUF60_HUMAN     IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
PUF60_BOVIN     IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSV----------------------------------
ELAV2_RAT       CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
PABP_COCIM      ATLARDAESGKSRGFGFVNFTSHDNAAAA---VEALNDKDFKGQKLYVGRAQ------------------
GRPA_MAIZE      SKVITDRETGRSRGFGFVTFSSENSMLDA---IENMNGKELDGRNITVNQAQ------------------
YHKF_SCHPO      CTVMRDSTTGRSRGFGFLTFKNPK----------------------------------------------
RBPF_ANASP      VVLPTDRETGRLRGFAFVEMGSDAEETAA---IEGLDGAEWMGRDLKVNKAKP-----------------
ELAV4_HUMAN     CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
RBM10_RAT       VRLMRNKSSGQSRGFAFVEFSHLQDATANQHSLNIL------GQKVSMHYSDP-----------------
ELAV4_RAT       CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
ELAV4_MOUSE     CKLVRDKITGQSLGYGFVNYIDPKDAEKA---INTLNGLRLQTKTIKVSYARPSSASIR-----------
GRP2_ARATH      AKVIVDRETGRSRGFGFVNFNDEGAATAA---ISEMDGKELNGRHIRVN---------------------


                         .         .         .         +         .         .         .:280
query           DDRSRSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPSF6_DROME     ----------------------------------------------------------------------
CPSF6_MOUSE     ----------------------------------------------------------------------
CPSF6_HUMAN     ----------------------------------------------------------------------
CPSF6_CHICK     ----------------------------------------------------------------------
CPSF6_BOVIN     ----------------------------------------------------------------------
SQD_DROME       ----------------------------------------------------------------------
CPSF7_RAT       ----------------------------------------------------------------------
CPSF7_MOUSE     ----------------------------------------------------------------------
CPSF7_HUMAN     ----------------------------------------------------------------------
CPSF6_PONAB     ----------------------------------------------------------------------
RBM10_MOUSE     ----------------------------------------------------------------------
RBM10_HUMAN     ----------------------------------------------------------------------
ELAV2_PONAB     ----------------------------------------------------------------------
ELAV2_MOUSE     ----------------------------------------------------------------------
ELAV2_HUMAN     ----------------------------------------------------------------------
PU60B_DANRE     ----------------------------------------------------------------------
DAZP1_HUMAN     SDNSKSN---------------------------------------------------------------
DAZP1_MOUSE     SDSSKSN---------------------------------------------------------------
PUF60_RAT       ----------------------------------------------------------------------
PUF60_PONAB     ----------------------------------------------------------------------
PUF60_MOUSE     ----------------------------------------------------------------------
PUF60_HUMAN     ----------------------------------------------------------------------
PUF60_BOVIN     ----------------------------------------------------------------------
ELAV2_RAT       ----------------------------------------------------------------------
PABP_COCIM      ----------------------------------------------------------------------
GRPA_MAIZE      ----------------------------------------------------------------------
YHKF_SCHPO      ----------------------------------------------------------------------
RBPF_ANASP      ----------------------------------------------------------------------
ELAV4_HUMAN     ----------------------------------------------------------------------
RBM10_RAT       ----------------------------------------------------------------------
ELAV4_RAT       ----------------------------------------------------------------------
ELAV4_MOUSE     ----------------------------------------------------------------------
GRP2_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPSF6_DROME     ----------------------------------------------------------------------
CPSF6_MOUSE     ----------------------------------------------------------------------
CPSF6_HUMAN     ----------------------------------------------------------------------
CPSF6_CHICK     ----------------------------------------------------------------------
CPSF6_BOVIN     ----------------------------------------------------------------------
SQD_DROME       ----------------------------------------------------------------------
CPSF7_RAT       ----------------------------------------------------------------------
CPSF7_MOUSE     ----------------------------------------------------------------------
CPSF7_HUMAN     ----------------------------------------------------------------------
CPSF6_PONAB     ----------------------------------------------------------------------
RBM10_MOUSE     ----------------------------------------------------------------------
RBM10_HUMAN     ----------------------------------------------------------------------
ELAV2_PONAB     ----------------------------------------------------------------------
ELAV2_MOUSE     ----------------------------------------------------------------------
ELAV2_HUMAN     ----------------------------------------------------------------------
PU60B_DANRE     ----------------------------------------------------------------------
DAZP1_HUMAN     ----------------------------------------------------------------------
DAZP1_MOUSE     ----------------------------------------------------------------------
PUF60_RAT       ----------------------------------------------------------------------
PUF60_PONAB     ----------------------------------------------------------------------
PUF60_MOUSE     ----------------------------------------------------------------------
PUF60_HUMAN     ----------------------------------------------------------------------
PUF60_BOVIN     ----------------------------------------------------------------------
ELAV2_RAT       ----------------------------------------------------------------------
PABP_COCIM      ----------------------------------------------------------------------
GRPA_MAIZE      ----------------------------------------------------------------------
YHKF_SCHPO      ----------------------------------------------------------------------
RBPF_ANASP      ----------------------------------------------------------------------
ELAV4_HUMAN     ----------------------------------------------------------------------
RBM10_RAT       ----------------------------------------------------------------------
ELAV4_RAT       ----------------------------------------------------------------------
ELAV4_MOUSE     ----------------------------------------------------------------------
GRP2_ARATH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPSF6_DROME     --------------------------------------------------------
CPSF6_MOUSE     --------------------------------------------------------
CPSF6_HUMAN     --------------------------------------------------------
CPSF6_CHICK     --------------------------------------------------------
CPSF6_BOVIN     --------------------------------------------------------
SQD_DROME       --------------------------------------------------------
CPSF7_RAT       --------------------------------------------------------
CPSF7_MOUSE     --------------------------------------------------------
CPSF7_HUMAN     --------------------------------------------------------
CPSF6_PONAB     --------------------------------------------------------
RBM10_MOUSE     --------------------------------------------------------
RBM10_HUMAN     --------------------------------------------------------
ELAV2_PONAB     --------------------------------------------------------
ELAV2_MOUSE     --------------------------------------------------------
ELAV2_HUMAN     --------------------------------------------------------
PU60B_DANRE     --------------------------------------------------------
DAZP1_HUMAN     --------------------------------------------------------
DAZP1_MOUSE     --------------------------------------------------------
PUF60_RAT       --------------------------------------------------------
PUF60_PONAB     --------------------------------------------------------
PUF60_MOUSE     --------------------------------------------------------
PUF60_HUMAN     --------------------------------------------------------
PUF60_BOVIN     --------------------------------------------------------
ELAV2_RAT       --------------------------------------------------------
PABP_COCIM      --------------------------------------------------------
GRPA_MAIZE      --------------------------------------------------------
YHKF_SCHPO      --------------------------------------------------------
RBPF_ANASP      --------------------------------------------------------
ELAV4_HUMAN     --------------------------------------------------------
RBM10_RAT       --------------------------------------------------------
ELAV4_RAT       --------------------------------------------------------
ELAV4_MOUSE     --------------------------------------------------------
GRP2_ARATH      --------------------------------------------------------