[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00411

[Show Plain Result]


## Summary of Sequence Search
    1::1056
    2::273     e-153  53% 1092 aa  SLA2_SCHPO RecName: Full=Endocytosis protein end4;AltName: Full=SLA2
    1::546     4e-81  47%  968 aa  SLA2_YEAST RecName: Full=Protein SLA2;AltName: Full=Transmembrane
   32::290     3e-50  31% 1068 aa  HIP1R_MOUSE RecName: Full=Huntingtin-interacting protein 1-related
   37::299     8e-49  31% 1037 aa  HIP1_HUMAN RecName: Full=Huntingtin-interacting protein 1;       
   37::299     7e-48  31% 1029 aa  HIP1_MOUSE RecName: Full=Huntingtin-interacting protein 1;       
   32::290     4e-43  30% 1068 aa  HIP1R_HUMAN RecName: Full=Huntingtin-interacting protein 1-related
   19::278     5e-35  28%  927 aa  SLAP2_CAEEL RecName: Full=Protein SLA2 homolog;
 2340::2473    9e-19  40% 2542 aa  TLN2_HUMAN RecName: Full=Talin-2;
 2366::2495    3e-18  41% 2541 aa  TLN1_CHICK RecName: Full=Talin-1;
 2251::2375    7e-18  40% 2375 aa  TLN2_MOUSE RecName: Full=Talin-2;
 2367::2496    2e-17  40% 2541 aa  TLN1_MOUSE RecName: Full=Talin-1;
 2267::2430    2e-15  33% 2614 aa  TALB_DICDI RecName: Full=Talin-B;
 2367::2471    2e-15  44% 2541 aa  TLN1_HUMAN RecName: Full=Talin-1;
 2303::2490    4e-15  31% 2493 aa  TALA_DICDI RecName: Full=Talin-A;AltName: Full=Filopodin;
  446::669     5e-08  30% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
  409::611     2e-07  34%  882 aa  MYSP_CAEEL RecName: Full=Paramyosin;AltName: Full=Uncoordinated
  806::1049    3e-07  22% 1298 aa  CGNL1_MOUSE RecName: Full=Cingulin-like protein 1;AltName:
  250::450     6e-07  26%  692 aa  MYSP_DERFA RecName: Full=Paramyosin;AltName: Full=Antigen
  237::530     1e-06  29% 1109 aa  CD158_MOUSE RecName: Full=Coiled-coil domain-containing protein
   14::193     2e-06  30%  666 aa  NDE1_CRYNE RecName: Full=Nuclear distribution protein nudE homolog
  318::561     3e-06  22%  873 aa  MYSP_BOOMI RecName: Full=Paramyosin;
  308::462     3e-06  25%  586 aa  EZRI_RABIT RecName: Full=Ezrin;AltName: Full=p81;AltName:
  293::532     4e-06  25%  638 aa  MYSP_OPIFE RecName: Full=Paramyosin;Flags: Fragment;
  580::864     4e-06  29% 1102 aa  MYSC_CHICK RecName: Full=Myosin heavy chain, cardiac muscle
  281::505     4e-06  24% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
 1469::1674    5e-06  30% 2050 aa  MY18A_MOUSE RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  381::669     6e-06  20%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
  577::807     8e-06  23%  829 aa  ODFP2_HUMAN RecName: Full=Outer dense fiber protein 2;AltName:
  348::569     1e-05  26%  712 aa  TSG10_RAT RecName: Full=Testis-specific gene 10 protein;AltName:
  836::1013    1e-05  27% 1454 aa  CCD18_HUMAN RecName: Full=Coiled-coil domain-containing protein
  542::705     1e-05  28% 1492 aa  LRRX1_DICDI RecName: Full=Putative leucine-rich repeat-containing
 1193::1394    1e-05  20% 1679 aa  GCC2_MOUSE RecName: Full=GRIP and coiled-coil domain-containing
  513::685     2e-05  26% 1091 aa  TMF1_MOUSE RecName: Full=TATA element modulatory factor;       
 1459::1707    2e-05  32% 1939 aa  MYSS_CHICK RecName: Full=Myosin heavy chain, skeletal muscle, adult;
 1448::1709    2e-05  29% 1940 aa  MYH3_CHICK RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
  521::682     3e-05  23%  976 aa  SYCP1_HUMAN RecName: Full=Synaptonemal complex protein 1;       
  301::457     4e-05  30%  601 aa  TSG10_MACFA RecName: Full=Testis-specific gene 10 protein;
  959::1135    4e-05  21% 1149 aa  TACC2_MOUSE RecName: Full=Transforming acidic coiled-coil-containing
  745::966     4e-05  28% 3259 aa  GOGB1_HUMAN RecName: Full=Golgin subfamily B member 1;AltName:
  398::554     7e-05  29%  697 aa  TSG10_MOUSE RecName: Full=Testis-specific gene 10 protein;
  937::1157    7e-05  25% 1966 aa  MYO4_CAEEL RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain B;
  929::1100    7e-05  22% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
 1473::1676    7e-05  29% 2054 aa  MY18A_HUMAN RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  174::435     9e-05  24%  615 aa  NF70_LOLPE RecName: Full=70 kDa neurofilament protein;AltName:
  174::435     9e-05  24%  511 aa  NF60_LOLPE RecName: Full=60 kDa neurofilament protein;AltName:
  461::600     9e-05  24% 1823 aa  LAMA4_HUMAN RecName: Full=Laminin subunit alpha-4;Flags: Precursor;
   82::401     9e-05  22%  583 aa  ICR2_ARATH RecName: Full=Interactor of constitutive active ROPs 2,
  701::944     9e-05  26% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
  170::342     9e-05  23%  680 aa  CACO1_BOVIN RecName: Full=Calcium-binding and coiled-coil
  949::1120    1e-04  25% 1957 aa  SPO15_SCHPO RecName: Full=Sporulation-specific protein 15;
  188::467     1e-04  26%  866 aa  MYSP_SCHJA RecName: Full=Paramyosin;AltName: Full=Antigen Sj97;
   59::177     1e-04  26%  522 aa  CNPD_NITSB RecName: Full=2',3'-cyclic-nucleotide
  398::554     2e-04  29%  698 aa  TSG10_HUMAN RecName: Full=Testis-specific gene 10 protein;AltName:
  605::811     2e-04  21%  822 aa  ODFP2_CHICK RecName: Full=Outer dense fiber protein 2;AltName:
   69::180     2e-04  26%  294 aa  KT222_MOUSE RecName: Full=Keratin-like protein KRT222;AltName:
  169::432     2e-04  22%  478 aa  GAS8_HUMAN RecName: Full=Growth arrest-specific protein 8;       
  340::543     2e-04  27% 1051 aa  APSB_EMENI RecName: Full=Anucleate primary sterigmata protein B;
  388::511     2e-04  26% 1128 aa  SMC6_XENLA RecName: Full=Structural maintenance of chromosomes
  369::616     2e-04  26%  875 aa  MYSP_BLOTA RecName: Full=Paramyosin;AltName: Allergen=Blo t 11;
  413::637     2e-04  29% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   69::180     2e-04  32%  295 aa  KT222_HUMAN RecName: Full=Keratin-like protein KRT222;AltName:
 1448::1624    2e-04  25% 2238 aa  GOGA4_MOUSE RecName: Full=Golgin subfamily A member 4;AltName:
  375::588     2e-04  24% 1468 aa  CE290_BOVIN RecName: Full=Centrosomal protein of 290 kDa;       
  170::342     2e-04  27%  691 aa  CACO1_RAT RecName: Full=Calcium-binding and coiled-coil
  170::342     2e-04  23%  691 aa  CACO1_HUMAN RecName: Full=Calcium-binding and coiled-coil
 1002::1163    3e-04  21% 1415 aa  UACA_CANFA RecName: Full=Uveal autoantigen with coiled-coil domains
  435::631     3e-04  20%  631 aa  TACC3_MOUSE RecName: Full=Transforming acidic
  417::536     3e-04  33%  876 aa  MYSP_SARSC RecName: Full=Paramyosin;
 1482::1655    3e-04  21% 1960 aa  MYH9_MOUSE RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
  142::376     3e-04  25%  575 aa  IFA4_CAEEL RecName: Full=Intermediate filament protein
 9790::9982    3e-04  28% 10746 aa  EBH_STAAR RecName: Full=Extracellular matrix-binding protein
  856::1029    3e-04  26% 1164 aa  CP135_DANRE RecName: Full=Centrosomal protein of 135 kDa;       
  170::342     3e-04  23%  691 aa  CACO1_PONAB RecName: Full=Calcium-binding and coiled-coil
 1068::1272    3e-04  26% 1581 aa  ANR26_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
 2757::2934    4e-04  21% 2948 aa  TACC2_HUMAN RecName: Full=Transforming acidic coiled-coil-containing
  449::688     4e-04  26% 1247 aa  RAD50_ENCCU RecName: Full=DNA repair protein RAD50;       
  341::606     4e-04  26% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  837::1028    4e-04  33% 1455 aa  CCD18_MOUSE RecName: Full=Coiled-coil domain-containing protein 18;
  550::777     4e-04  22%  837 aa  BRE1_CAEEL RecName: Full=E3 ubiquitin-protein ligase bre-1;        
  254::518     5e-04  23% 1312 aa  RAD50_RAT RecName: Full=DNA repair protein RAD50;       
  572::797     5e-04  23%  825 aa  ODFP2_RAT RecName: Full=Outer dense fiber protein 2;AltName:
  568::779     5e-04  23%  830 aa  ODFP2_MOUSE RecName: Full=Outer dense fiber protein 2;AltName:
 1158::1471    5e-04  24% 1962 aa  MYSA_DROME RecName: Full=Myosin heavy chain, muscle;
  937::1196    5e-04  19% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
  887::1103    5e-04  23% 1928 aa  MYO1_YEAST RecName: Full=Myosin-1;AltName: Full=Type II myosin;
 1446::1532    5e-04  32% 1937 aa  MYH8_MOUSE RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
  258::437     5e-04  21%  719 aa  HOOK3_XENLA RecName: Full=Protein Hook homolog 3;
 1521::1762    5e-04  24% 2474 aa  CENPE_MOUSE RecName: Full=Centromere-associated protein E;AltName:
  455::602     5e-04  25%  848 aa  CC110_MOUSE RecName: Full=Coiled-coil domain-containing protein
 1483::1656    6e-04  21% 1961 aa  MYH9_RAT RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
  326::522     6e-04  30%  670 aa  LRC45_HUMAN RecName: Full=Leucine-rich repeat-containing protein
   69::149     6e-04  29%  295 aa  KT222_BOVIN RecName: Full=Keratin-like protein KRT222;AltName:
 1281::1429    6e-04  28% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
 1105::1282    6e-04  19% 1583 aa  GCC2_HUMAN RecName: Full=GRIP and coiled-coil domain-containing
  263::462     8e-04  24%  570 aa  U639_CAEEL RecName: Full=UPF0639 protein F31D4.5;
  339::442     8e-04  31%  624 aa  MOEH_ANOGA RecName: Full=Moesin/ezrin/radixin homolog 1;
  277::369     8e-04  34%  600 aa  LMNB2_HUMAN RecName: Full=Lamin-B2;
  210::315     8e-04  39%  343 aa  LIFO_ACIAD RecName: Full=Lipase chaperone;AltName: Full=Lipase
  269::518     8e-04  23% 1893 aa  CK5P2_HUMAN RecName: Full=CDK5 regulatory subunit-associated
    1::1056

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
SLA2_SCHPO      ----------------QSDASLMTSVRKATSIDETAPKRKHVRSCIIFTWDHHTARPFWTAIKVQPLLAN
SLA2_YEAST      --------------MSRIDSDLQKALKKACSVEETAPKRKHVRACIVYTWDHQSSKAVFTTLKTLPLAND
HIP1R_MOUSE     ----------------------AISISKAINSQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGXXXXXX
HIP1_HUMAN      ------------------ERTQTVSINKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSN
HIP1_MOUSE      ------------------ERTQTVSVNKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSN
HIP1R_HUMAN     ----------------------AISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGXXXXXX
SLAP2_CAEEL     -------------------------VQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKH
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
SLA2_SCHPO      EVQTFKALITIHRVLQEGHKSALVDSQSEKGWLKTCERQYDGESSKGYSDLIRDYVDYLLDKLSFHAQHP
SLA2_YEAST      EVQLFKMLIVLHKIIQEGHPSALAEAIRDRDWIRSL--GRVHSGGSSYSKLIREYVRYLVLKLDFHAHHR
HIP1R_MOUSE     XXXXWKFCHVLHKVLRDGHPNVLHDYQRY----RSNIREIGGHLRDQYGHLVNIYTKLLLTKISFHLKHP
HIP1_HUMAN      AVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNELSDMSR-MWGHLSEGYGQLCSIYLKLLRTKMEYHTKNP
HIP1_MOUSE      AMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNELSDMSR-MWGHLSEGYGQLCSIYLKLLRTRMEYHTKNP
HIP1R_HUMAN     XXXXWKFCHVLHKVLRDGHPNVLHDCQRY----RSNIREIGGHLHDRYGQLVNVYTKLLLTKISFHLKHP
SLAP2_CAEEL     PVLTWKFCHLVHKLLRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYP
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYG
SLA2_SCHPO      EFNGTFEYKEYISLRQVDDPNEGYETVYDMMNLQDHIDEFQKQLFSNFKRSNKNECRIAALVPLVQESYG
SLA2_YEAST      GFNGTFEYEEYVSLVSVSDPDEGYETILDLMSLQDSLDEFSQIIFASIQSRRNTECKISALIPLIAESYG
HIP1R_MOUSE     QFPGLEVTDEVLEKAAGTDVNNIFQLTVEMF---DYMDCELKLSESVFRQMSSGQCRLAPLIQVIQDCSH
HIP1_HUMAN      RFPGNLQMDRQLDEAGESDVNNFFQLTVEMFYLECELNLFQTVFNSSVSVTAAGQCRLAPLIQVILDCSH
HIP1_MOUSE      RFPGNLQMDRQLDEAGESDVNNFFQLTVEMFYLECELNLFQTVFNSSVSVTTAGQCRLAPLIQVILDCSH
HIP1R_HUMAN     QFPGLEVTDEVLEKAAGTDVNNIFQLTVEMF---DYMDCELKLSESVFRQMSSGQCRLAPLIQVIQDCSH
SLAP2_CAEEL     VVPGKLDLNDS-QLKTLEDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNQCMLSPLIIAILDTSK
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDE
SLA2_SCHPO      IYRFLTSMLRALYSTVDAPETLEPLKHRYKSQHHRLRQFYADCSNLRYLTSLISVPRLPHDPPD-LEGDD
SLA2_YEAST      IYKFITSMLRAMHRQLNDAEALQPLKERYELQHARLFEFYADCSSVKYLTTLVTIPKLPVDAPDVLINDV
HIP1R_MOUSE     LYHYTVKLMFKLHSCL-PADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPRLPEGPPNFL----
HIP1_HUMAN      LYDYTVKLLFKLHSCL-PADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFL----
HIP1_MOUSE      LYDYTVKLLFKLHSCL-PADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFL----
HIP1R_HUMAN     LYHYTVKLLFKLHSCL-PADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFL----
SLAP2_CAEEL     FYDYLVKMIFKLHSQV-PPDALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIPTLPSHAPNFLQQSD
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DRPALPKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLA2_SCHPO      NIPDLPKR--------------------------------------------------------------
SLA2_YEAST      D---------------------------------------------------------------------
HIP1R_MOUSE     ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
HIP1_MOUSE      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
SLAP2_CAEEL     ----------------------------------------------------------------------
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGRLAELEQENLNARAQYERDQLLLQQYDKRVKDLEEX
SLA2_SCHPO      ----------------------------------------------RGQLEQSNVLLNQYDARVRTLENE
SLA2_YEAST      ------------------------------------------------QYEKDQALLQQYDQRVQQLESE
HIP1R_MOUSE     ----------------------------------QIENLKREVETLRAELEKIKMEAQRYISQLKELEEQ
HIP1_HUMAN      ----------------------------------------------------------------------
HIP1_MOUSE      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
SLAP2_CAEEL     ----------------------------------------------------------------------
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------RIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGN-
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------RSNSSEQSQAEREKVLKEENEKLQGRIAEL
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ---------------------------------GRIFPVEDETLKSESQ-NKIELLLQQHQDRIEQLISE
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      --------------------------------------------------------LEKAKHRLQNEQED
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     -------------------------------------ETQREKLQRKLQREKDMLLAEAFSLK-QQMEEK
NUF1_YEAST      ---------------------------------GKLASLMAQLTQLESKLNQRDSQLGSREEELKKTNDK
ODFP2_HUMAN     -------------------------------------EMNKEIEAARRQFQSQLADLQQLPDILK-ITEA
TSG10_RAT       --------------------------------------LAHENDNLQEQFAKVKQENQALSKKLNDTHNE
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     --------------------------------------------------ERDQLLSQ-----VKEL---
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------QLADNEDRTADVQRAKKKIEAEVEALKKQIQDLE--
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     -------------------------------------EAQREKLQRKLQREKDMLLAEAFSLK-QQLEEK
NF70_LOLPE      -------------------------------------------------------LIDQLERQQKDLEES
NF60_LOLPE      -------------------------------------------------------LIDQLERQQKDLEES
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------QISQLQEELKKAKEQLSASEAL----KKEAQDQAEE
CLIP1_CHICK     -----------------------------------------ENLKAKLESVEDQHLVEMEDTLNKLQEEI
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ---------------------------------------ELNNAKSRLTSENFELLHQDYEAQILNYSKA
CNPD_NITSB      -------------------------------------QVKEAELELKRDFEKKEELKRDYEERFNELMEK
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------EEITRMRNDFERQVREIEKYDKKMKMLDEL
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------RVSQLEKINLDLKSKLEEVSMLLEQTQKKIADLQKL
MRCKB_HUMAN     ---------------------------------GSLKSIMQSNLTKDEDVQRDSLQMEAYERRIRRLEQ-
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ---------------------------------------EDEVGRLRAEISRDREMLGDYQRRLNDAYSI
CENPE_HUMAN     ----------------------------------------------------DEALLKRYRKEIMDLKKQ
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------RLKEIEH-NLSKIMRLDNE---IKALDSRKKQMEKD
ODFP2_RAT       -------------------------------------EMNKEIEAARRQFQSQLADLQQLPDILK-ITEA
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      -----------------------------------------------AQIELNKKREAELSKLRRDLEEA
MYO3_CAEBR      ---------------------------------GQLEDMQERHEDLTRQKKKTEQELSDTKKHVQDLE--
MYO1_YEAST      --------------------------------------LEEKNQKTVNELENTQDLLNQEKENLRKNESL
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------KMTELENENLALKTKMKTAQSLIQKHEKQLKSLAEE
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     -----------------------------------LATAEQEQLSL-SQRQAKELKLEQQEAAERESK--
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ---------------------------------------------------------QEYEDRLRSMQEE
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     -------------------------------------EKERETEAAQMEHQKER---NSFEERIQALEED


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXXTSKDDQIRALQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEAIDK
SLA2_SCHPO      LSQAGVNLQEQIHQNDDLIESLKNQILTWKNKYEALAKLYTQLRQEHLDLLSKYKQIQLKASSAQEAIDX
SLA2_YEAST      ITTMDSTASKQLANKDEQLTALQDQLDVWERKYESLAKLYSQLRQEHLNLLPRFKKLQLKVNSAQESIXX
HIP1R_MOUSE     RKQKQKALVDNEQLRHEQLKALQRKASATEARYSKLKEKHSELINTHAELLRTAKQLTVTQQSQEEVARV
HIP1_HUMAN      ---------------------IERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQA---
HIP1_MOUSE      ---------------------IERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSVARQA---
HIP1R_HUMAN     ----------------ERSQGLREEAERKASATEAR---YNKLKEKHSELVHVHAELLRKNADTAKQLTV
SLAP2_CAEEL     ----------------------------------------------------------------------
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ------------SNRDKEIKRLNEELERMKSKMADSNRLERQLRQEHEDSTQRLKGLEKQARQEKEELHK
MYSP_CAEEL      -----------------ELEAAQRELRAVNAELQKMKHLYEKAVEQKEALARENKKLHDELHEAKEALAD
CGNL1_MOUSE     ERRAAQLQRQMEDVKGDEAQA-KETLRKCESEVQQLEEALVHARKEEKEATCARRALEKELEQAQRELSQ
MYSP_DERFA      ------------SSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKL---EEVTML
CD158_MOUSE     HEVEITGLTEKASSARSQANSVQSQLEIIQEQARNQNSMYMR---QLSDLESTVSQLRSELRESKRMYDK
NDE1_CRYNE      ----------------------EEEIAHYREKYRQALDMLTDTRAELEEFQQSSKELEDEAANDKQQADL
MYSP_BOOMI      -----------------KISEYEEQLEALLTRCSNLEKQKSRLQSEVEVLIMDLEKATAHAQNLEKRVAQ
EZRI_RABIT      -----------------QAREEKHQKQLERQQLESEKKRREAVEQEKEQMLREKEELMMRLQDYEQKTKK
MYSP_OPIFE      -----------------RITELEDTAERERARASNLEKIKAKLTIEIKDLQNEVDSLSAENAEAKAAENL
MYSC_CHICK      MMIDLEKANSAAASLDKKQRGFDKIINDWKQKYEESQAELEASQKEARSL--STELFKLKNA-YEETLDH
HMW2_MYCGA      -----------------------ESIRRYRSQLEQYLESLKQMRNEHNKKLQNLDNIKNEVEKAKQILQS
MY18A_MOUSE     DLDIAGF-----TQKVVSLEAELQDISSQESKDEALAKVKKQLRDLEAKVKDQEEELDEQAGSIQMLEQA
NUF1_YEAST      LQKDIRIAREETVSKDERIIDLQKKVKQLENDLFVIKKTHSESKTTDNELESKDKLIKILENDLKVAQEK
ODFP2_HUMAN     KLAECQDQLQGYERKNIDLTAI---ISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLK-------VDE
TSG10_RAT       LSDIKQKVQDTNL----EVNKLKNILKSEESTNLEVNKLKNILKSEESENRQIMEQLRKANEDAENWENK
CCD18_HUMAN     -----------------------EKLRKMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSK
LRRX1_DICDI     ------------SSSDELKLKLNQLSDKLQEKDEKLKSLESSIRDEKIDQLQD--NLNEKQDKINELVEN
GCC2_MOUSE      ----------------EEITSLQSSVQHYEEKNTKIKQLLVKTKKELADAKQAETDHLLLQASLKGEL--
TMF1_MOUSE      ----------------------------------------------------------------QLACKE
MYSS_CHICK      ----------------------------WKQKYEETQTELEASQKESRSL--STELFKMKNAY-EESLDH
MYH3_CHICK      ---------------DKKQKNFDKILSEWKQKYEETQAELEASQKESRSL--STELFKMKNA-YEESLDH
SYCP1_HUMAN     ----------------------------------------NKLSLENKELTQETSDMTLELKNQQEDINN
TSG10_MACFA     -------------------------------------KLKNILKSEESENRQMMEQLRKANEDAENWENK
TACC2_MOUSE     -----------------EVIAKEREVSEWRDKYEEMRKIVAEYEKTIAQMIPGTERKILSHQTVQQLVLE
GOGB1_HUMAN     -------------SMVTELRAQVKQLEMNLAEAERQRRLDYESQTAHDNLLEQIHSLSIEAKSKDVKIEV
TSG10_MOUSE     -------------------------------------KLKNILKSEESENRQIMEQLRKANEDAENWENK
MYO4_CAEEL      --MSLRKAESEKQSKDHQIRSLQDEM---QQQDEAIAKLNKEKKQEEINLMEDLQSNKVKAKLEQTLDDL
MYO3_CAEEL      ---------------ESKLSDITGQLEDMQERNEDLARQKKKTDQELSDTKKHVQDLELSLRKAEQEKQS
MY18A_HUMAN     DMDIAGF-----TQKVVSLEAELQDISSQESKDEALAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQA
NF70_LOLPE      RTYHQIDQEQI-ARQNQQLADLEGEISMLRRSIESLAKMNDEMEKMRMDLNNETIN-HLDAENRRQTLEE
NF60_LOLPE      RTYHQIDQEQI-ARQNQQLADLEGEISMLRRSIESLAKMNDEMEKMRMDLNNETIN-HLDAENRRQTLEE
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      TKQQLMEINASEDSRIDELRKLQERDKAWQSELEAMQRQHAMDSAALSSTMNEVQKLKAQLSESEETLSL
CLIP1_CHICK     KVKELDVLQAKCNEQTKLIGSLTQQIRASEEKLLDLAALQKANSEGKLEIQKLSEQLQAAEKQIQNLTEK
CACO1_BOVIN     ---------------------LEGQVTELKSQVQELEKALAAARQEHAELAEQYKGLSRSHGELTEERDI
SPO15_SCHPO     -------------------------------KLTARQEEISNLKEENMSQSQAITSVKSKL---DETLSK
MYSP_SCHJA      KSSLESQVDDLKRSLDDESRNLQAQLTSLQMDYDNLQAKYDEESEEASNLRNQVSKFNLKSKFERELMSK
CNPD_NITSB      EMSLKQMFKDELTLEKQEIKAEREEINRLKNEYEELKKRYQEKYQEVLEALQQQAGLTLEEA-------K
TSG10_HUMAN     -------------------------------------KLKNILKSEESENRQMMEQLRKANEDAENWENK
ODFP2_CHICK     ---------------ETQLAECQDQLQSYEKKNMDLSVMIADLRQRQGDKMEMTRERYQSAQEEKKQLTK
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      DLRRKTELHEVEERKNGQIHTLMQRHE------EAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDH
APSB_EMENI      ----------------DQVSALKLENQAIRQELEELDKAYSEQAEEDIQTLQQERDQAMQVAEERDAAEL
SMC6_XENLA      ---------------------LKEDVQKKRKSYNESEVLYNRHRMELKRLERDAEQLHKRIEELKKSADN
MYSP_BLOTA      QHEYEKLR--------DQKEALAREN---KKLADDLAEAKSQLNDAHRRIHEQEIEIKXXXXXXKEAETL
MRCKB_HUMAN     -------------EKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLEEIERLKNKIADSN-----
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     -----------------------EQVDHWSNKFEWKKKAQSRLAQHQSTIKDLQAQLDVKATDAREKEEQ
CE290_BOVIN     ------------------------------AQQEKFSKTMIQLQNDKLKIMEEMKNSQQEHRSL-----K
CACO1_RAT       ---------------------LEDQVTELRSRVQELEAALATARQEHSELTEQYKGLSRSHGELSEERDI
CACO1_HUMAN     ---------------------LEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHGEITEERDI
UACA_CANFA      -------------------KELKEQLSEQMQKYEEEAKKYKQENDKKKEIFTLQKDLKDKNVLIENSHDM
TACC3_MOUSE     ---------------DAVVNVMQQENLELKSKYEDLNTKYLEMGKSYKSLEEAEKQRELKEIAEQKVLKE
MYSP_SARSC      --------------------------------------------------------------------DQ
MYH9_MOUSE      ------------------------------------------------------------ARALEEAMEQ
IFA4_CAEEL      ---------------EDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISL
EBH_STAAR       ---------------------------------------------------------KLKEIEASNATDQ
CP135_DANRE     ---------------------LKLRVHSYISEVARIESLMAAKEQENRDMLERFRSIHTESEDKELKLQQ
CACO1_PONAB     ---------------------LEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHGEITEERDI
ANR26_MOUSE     ----------------------QGKVSKFMGKQESIEERLAQLQSENTLLRQQLDDAANKAESKDKTIDV
TACC2_HUMAN     -----------------EIITKEREVSEWKDKYEESRREVMEMRKIVAEYEKTIAQMSVSHQTVQQLVLE
RAD50_ENCCU     AERNFAMNQMRGRKREIEGMLNGVNVSELKSKLE---RQKAKLREKESRAKEIEREMSLRKARAIERSKE
CENPE_HUMAN     LEEVSLETRAQAMEKDQLAQLLEEK--------DLLQKVQNEKIENLTRMLVTSSSLTLQ----QELKAK
CCD18_MOUSE     -----------------------EKLRKMEEKYETAIREVDLKRQKIIELTGTARQAKLEMDQYKEELSK
BRE1_CAEEL      --------------KQKQVENLQKEVNRQLSELETLRKTNEMLTNDEECISDELEAIGTAVEEEQERIEK
RAD50_RAT       NSELEQKMEKVFQGTDEQVREKERRLVDCQRELEKLSKEARLLNQERAELLVEQGRLQLQADRHQEHIRA
ODFP2_RAT       KLAECQDQLQGYERKNIDLTAI---ISDLRSRIEHQGDKLELAREKHQASQKENKQLSQK-------VDE
ODFP2_MOUSE     ---------------DKENKMLKDEMN---KEIEAARR---QFQSQLADLQQLPDILKITEAKLAECQDQ
MYSA_DROME      NIQHESTLANLRKKHNDAVAEMAEQVDQL-NKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAK
MYO3_CAEBR      --LTLRKAEQEKQSRDHQIRSLQDEM---ANQDESVAKLNKEKKHQE----ESNRKLNEDLQSEEDKVNH
MYO1_YEAST      ------------------LNRVKTSSETLQKQFDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQETIRE
MYH8_MOUSE      ---------------DKKQRNFDKVLSEWRQKYEETQAELESCQKESRTL--STELFKVKNA-YEESLDH
HOOK3_XENLA     ---------------------LEASKDDYRIRCEELEKEITEFRQQNEDLIDEAQSLKDEMDVLRHSSDK
CENPE_MOUSE     ---------------------LQELQN---KEYECLAKTINETQGSRCEMDHLNQQLEAQKSTLEKVEME
CC110_MOUSE     KSALQSKLSKAEEENKDCLRELKKIVSTYNGQHKMLEEKNSQLSLEKQQMLETIDHLKSKEHKSQSAVLQ
MYH9_RAT        ------------------------------------------------------------ARALEEAMEQ
LRC45_HUMAN     -------LLRDLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQE---MTSMSAELKMRAIQAEERLDM
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      -----------------------------RAIYGKMAQFVSELRQEKKQLLSAQKQVDDKSRLLEQNQRH
GCC2_HUMAN      --------------------SLQSSVQQYEEKNTKIKQLLVKTKKELADSKQATDHLILQASLKGEL---
U639_CAEEL      -------------------------------------KLKDDLQNVKNELKMTNEMKKTLEQEKMSLNSK
MOEH_ANOGA      MERKQANL----SEAQDTIRRLQEQLNQVQAAKEELEQRQNEL-HEMMQRLEETKNME---------ATE
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      --------------KAKQLKALFDQLQDWKANLEQLSKLD--------DLKQLTTSIKKNGGSAQELHDM
CK5P2_HUMAN     LREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKKAREALQKAQTQEFQALSGKEALSE


                         *         .         .         .         .         +         .:560
query           RERLEREMKTKNLELADMIRERDRALHEKDRISGGNXXXXXXXXXXXXXAIERAENAERAKSSEISAMLS
SLA2_SCHPO      XXXXXXXXXXXXXXLADMILERDRARHELETMHRSQRDKQESTERELRLLQEKAASLERNKSSEVSNLLS
SLA2_YEAST      XXXXXXXXXXXXXXMAELVKDRDRARLELER---------------------------------------
HIP1R_MOUSE     KEQLAFQMEQAKRESEMKMEEQSDQL-EKLKXXXXXXXXXXXXXXXXXSRTEQS-------GSELSSRLD
HIP1_HUMAN      QVDLEREKK----ELED--------------------------------SLERISDQGQRKTQEQLEVLE
HIP1_MOUSE      QVDLEREKK----ELADSFA---RTQEQQDVLEN----------LKHELATSRQELQVLHSNLETSAQSA
HIP1R_HUMAN     TQQSQEEVARVKEQLAFQVEQVXXXXXXXXXXXXXXXXXXXRELEAKAGELARAQEAEQSKS-ELSSRLD
SLAP2_CAEEL     ------------------------------------------------------------KLGDIQKQLE
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       QEASER-LKSQTKELKDAHQQRKRALQEFSELN--------ERMAELRSQKQKVSRQLRDKEEEMEVAMQ
MYSP_CAEEL      ANRKLHELDLENARLAGEIRELQTALKEADRRDAENXXXXXXXXXXXXXIIAALADAEARMKSEISRLKK
CGNL1_MOUSE     VSQEQKELLEK---LRDEAEQKEQLRKLKNEMESERWHLDKTIQKLQKEMADIAE-ASRTSSLELQKQLG
MYSP_DERFA      MEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAE----AKSQLNDAHR-RIHEQEIEIK
CD158_MOUSE     IEELEKQLVLANSELTEARTERDQFSQE-----SGNXXXXXXXXXXXXHKREKELSLEKEQNKRLKAMKS
NDE1_CRYNE      REKIKREWRTKHIALSAMQREMDNLRSERDK--------TLVALRDLEMGNDELERNERVAISSLLDLES
MYSP_BOOMI      LEKLNIDLKSKVEELTILLEQSQRELRQKQKLQHEYEKMREQRDALQRENKKLVDDLSEAKSQLADAILH
EZRI_RABIT      AEKELSDQIQRALQLED---ERKRAQEESERLEADRVAALRAKEELERQAADQIKSQE-----QLAAELA
MYSP_OPIFE      ANDLQRRVDELTIEINNLHSQNSQLEAENMRLKS-----QVNDLVDKNAALDRENRQLSDQVKDLKSTLR
MYSC_CHICK      LETLKRENKNLQEEISDLISEGNKNLHEXXXXXXXXXXXXXXXXXXXXXXXXXXXSKTLRFQLELSQLKA
HMW2_MYCGA      KANADQYFALRKIELENSYKKAKNAILEANKAHAKNV---------------QEEQALANKNNKTQRLLN
MY18A_MOUSE     KLRLEMEM------------ERMRQTHSKEMESRD----------------EEVEEARQSCQKKLKQMEV
NUF1_YEAST      YSKMEKELKERNYKISESKLEDEKTLNEKSNLAAENSQLKNKIEDNSTATHHMKENYEKQLES-LRKDIE
ODFP2_HUMAN     LERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARQVEQTKEHALSKERA
TSG10_RAT       ARQLEAENNTLKLELITAEAEGNRLKEKVDALN---------------REVEQHLNAERSYKSQIATLHK
CCD18_HUMAN     MEKLKRDGENKAMHLSDMILDQTKTELEKKT-----------------NAVKELEKLQHSTETELTEALQ
LRRX1_DICDI     NESSSDELQSKLIQLSDQLQEKDEKLLNNQSXXXXXXXXXXXXXXKINELIEN----NQSSSDELNSKLI
GCC2_MOUSE      -EASQQQVEVYKIQLAEMTSEKHK-IHEHLKTSAEQHQRTLSAYQQRVVALQEESRAAKAEQAAVTSEFE
TMF1_MOUSE      RDAAKKEMKTIKEELATRLNSSQTALKEKDEQIQG------LMEEGEKLSKQQLHNSNRAKDKDNENVIA
MYSS_CHICK      LETLKRENKNLQQEIADLIAEGGKAVHELEKVKXXXXXXXXXXXXXXXXXXXXXXGKILRLQLELNQIKS
MYH3_CHICK      LETLKRENKNLQQEISDLIAEGGKAIHELEKVKXXXXXXXXXXXXXXXGKILRVQLELNQVKSDIDRKIA
SYCP1_HUMAN     NKKQEERM----LKQIENLQETETQLRNE---------------------LEYVREELKQKRDEVKCKLD
TSG10_MACFA     ARQSEADNNTLKLELITAEAEGNRLKEKVDSLS---------------REVEQHLNAERSYKSQISTLHK
TACC2_MOUSE     KEQALADLNSVEKSLADLFRRYEKM---KEVLEGFRKNEEVLKKCAQ-------EYLSRVKKEE-----Q
GOGB1_HUMAN     LQNELDDVQLQFSEQSTLIRSLQSQLQNKES--------------------EVLEGAERSKVEELSQALS
TSG10_MOUSE     ARQTEAENNTLKLELITAEAEGNRLKEKVDALN---------------REVEQHLNAERSYKSQIATLHK
MYO4_CAEEL      EDSLEREKRAR----ADLDKQK-RKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLQALVS
MYO3_CAEEL      RDHLQDEMANQDEAVAKLNKEKK---HQEE--SNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENID
MY18A_HUMAN     KLRLEMEM------------ERMRQTHSKEMESRD----------------EEVEEARQSCQKKLKQMEV
NF70_LOLPE      ELEFQKDVHAQELELAQAIRDIQQEYDAKDQMRGDNLKVQEFRTGATKQNMEVTRNKE--ENTKLKSNMT
NF60_LOLPE      ELEFQKDVHAQELELAQAIRDIQQEYDAKDQMRGDNLKVQEFRTGATKQNMEVTRNKE--ENTKLKSNMT
LAMA4_HUMAN     ---------------------------------------------------QRLHNETRTLFPVVLEQLD
ICR2_ARATH      VEKLRGELTEKQLEIANLTLEMLRSDGMKMSEACNSLTTELEQSKSEVRSLEQEEDEARGNANGDSSSVE
CLIP1_CHICK     VSNLTKELQGKEQKLLDL----EKNLSAVNQVKDSXXXXXXXXXXXFTSAVDGAENAQRAMQETINKLNQ
CACO1_BOVIN     LSRQQGDHVARILELEEDIQTISEKVLMKE--------VELDRVRDSVKALTREQEKLLGQLKEVQADKE
SPO15_SCHPO     SSKLEADIEHLKNKVSEVEVERNALLASNERLMDD-----LKNNGENIASLQTEIEKKRAENDDLQSKLS
MYSP_SCHJA      TEEFERKLTMRITELEDVARERLKAVSXXXXXXXXXXXXXDLQSEIESLSLENGELIRRAKSAESLAQLE
CNPD_NITSB      NLILQKAEEESRLEIANIV---------------------------------------------------
TSG10_HUMAN     ARQSEADNNTLKLELITAEAEGNRLKEKVDSLN---------------REVEQHLNAERSYKSQISTLHK
ODFP2_CHICK     AEELERKLETQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVXXXXXXXXXXXX
KT222_MOUSE     --------------------------------------------------IESLHAVERGLENSLQASEQ
GAS8_HUMAN      LEREMAEVSGQNKRLADPLQKAREEMSEMQK-QLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQ
APSB_EMENI      RAEAQEELDALGDELDQKIEECQR-LTEDLRTQDDNLRALQAEMRSASEGIIRLENLQRYKA--VQQELE
SMC6_XENLA      DSESEKMARQKEI---NQIRERMKALHDKDITTNQQIHQFQQAIEKYKEERARIGNEER----NIKQRLE
MYSP_BLOTA      RKQEEAKNQRLTAELAQTRHDYEKRLAQKEE-------EIEALRKQYQIEIERLAEAEAKLKTEVARLKK
MRCKB_HUMAN     --RLERQLE-------DTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQAKELKDA
KT222_HUMAN     --------------------------------------------------IESLHAVERGLENSLHASEQ
GOGA4_MOUSE     KEDLDRQNKKFECLKGEMVRKSKMEKKECD--------------------LETALKTQTARVVELEDCVT
CE290_BOVIN     NKTLEMELKLKGLE--DLISTLKDARGAQKVISWHTKIEELRLQ-------ELKLNRELVKDKELNNIIS
CACO1_RAT       LSQQQGEHVARILELEDDIQTSDKVLMELDRV------------RDMVKALTREQEKLLGQLKEFQADKE
CACO1_HUMAN     LSRQQGDHVARILELEDDIQTISEKVLTKE--------VELDRLRDTVKALTREQEKLLGQLKEVQADKE
UACA_CANFA      ERALNRKAEELNKQLKDLLQKYSEIKTEKEKLVDDN-----ARQTSELLAAQTLLQKQHVPLEQVETLKK
TACC3_MOUSE     RDQLNADLNSMEKSFSDLFKRFEK---RKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAKLR
MYSP_SARSC      RDALARENKKLTDDLAEQLNDAHRRIHEQE------------------IEIKRLEN----EREELSAAYK
MYH9_MOUSE      KAELERLNKQFRTEMEDLMSSKDKSVHELERALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKA
IFA4_CAEEL      MEESIGHLKRENHRMIDSLHHARNAVEQENRIDYQN---------QVQTLLEECDFIRRIHDSEIHDLLA
EBH_STAAR       DKLIA---KNKAEELANSIINNINKATSNQDVSQVQTAGNHAIEQVHANEIPKAKDANKDVDKQVQALID
CP135_DANRE     SEGLNNSIR---LELLSSDTER---RHLRERVS------------LQDREIQEHLNALQAYEAQVSSLAR
CACO1_PONAB     LSRQQGDHVARILELEDDIQTISEKVLTKE--------VELDRLRDTVKALTREQEKLLGQLKEVQADKE
ANR26_MOUSE     LTRFQAESQRHSLRLEDRNQELSECSHLRERLCQYENEKAEREVVVRQLQQELADTLKKQSMSEASLEVS
TACC2_HUMAN     KEQALADLNSVEKSLADLFRRYEKM---KEVLEG---------FRKNEEVLKRCEYLSRVKKEE-----Q
RAD50_ENCCU     NDRIRRELRTKSMELGSMGQRSRMAIFEELGI--------PMLRNGSRCSVERAKEVVRSNEGFFARDDM
CENPE_HUMAN     RKRLGKINKMKNSNYADLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIE----SELNSLRA
CCD18_MOUSE     MEKLKRDGENKSMQLSDMVLDQTKTELEKTTNSVKXXXXXXXXXXXXXXXXMQKREALENELQNAHGELK
BRE1_CAEEL      REQEDRNLKMMNDRMINRLREKLSCLESKAQTDAQIAKMHEFEKKANEELVTKLSESVQFKSAELTRLTN
RAD50_RAT       RDSLIQSLAA-HLELDGFIKNFHELVRERQEREAKTASQLLSDLTDKEALKQRQMDEMRDKKSGLGRMIE
ODFP2_RAT       LERKLEATSTQNVEFLQVIAKREEAIHEKTRECGSLARQLESAIEDARRQVEQTERAAQSKILDLETQLS
ODFP2_MOUSE     LQGYER----KNIDLTAIISDRSRIEHQGDKLEMAREKHQASQKENKQLSLERKLEATSAQNVEFLQVIA
MYSA_DROME      QSKLDETNRTLNIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADE--ESRERAKFRNLEHDLD
MYO3_CAEBR      LEKIRNKLEQQMDELEETIDREKRSIEKSKRKVEGDLKVAQENIDEITKQKQDVENTLKRKEDDLXXXXX
MYO1_YEAST      REATLEKLHSKNNELIKQISDLNCDISKEQ----SSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFND
MYH8_MOUSE      LETLRRENKNLQQEISDLIAEGGKHIHELEKI--------------------------------------
HOOK3_XENLA     VAKLESQVDSYKKKLEDLLRRQVKLLEEKNTMYMQNTV---------------SLEEELRKANAARSQLE
CENPE_MOUSE     NVNLTQRLHETLEEMRSVAKERDELWSMEERLTVERDQLKKSLEETVTKGMEKEEELRVAHVNKLRKMVS
CC110_MOUSE     NENSRMNIEIEAMKTSMLLVQDEREMLEKE----------------------------------------
MYH9_RAT        KAELERLNKQFRTEMEDLMSSKDKSVHESNRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKA
LRC45_HUMAN     EKRRCRQLRIKEVEMTRHLEESEKAMQERVQXXXXXXXXXXXXXXXVKAAAERGQAEEELIKAKSQARLE
KT222_BOVIN     --------------------------------------------------IESLHAVERGLENSLHASEQ
HMW2_MYCPN      LQNLSSETKKKRQSLEHDINKFDQRRHKKLKQKEGELQGILQKLSLKKTQIEQEFSKQREKLDRQRTTLS
GCC2_HUMAN      -EASQQQVEVYKIQLAEITSEKHK-IHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEFE
U639_CAEEL      TEHLQANMESLNIELQEIVREREKVL-----IDNQNLSTDKCQLNNRLMEIETSRNCIMTEKEKIENLLK
MOEH_ANOGA      RAKLEEEIRVKQLEMQKIQEEETKRLHEE-----------------------------------------
LMNB2_HUMAN     ---------------------------------------------------DKAASAAREELKEARMRLE
LIFO_ACIAD      RTNLVGHDATARLEQLDVERSNWKSLDERQTILNSNM-------------------SDTAKQNAISALRS
CK5P2_HUMAN     NHRLRRSIKKITQELSDLQQERERLLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLS


                         .         .         .         *         .         .         .:630
query           KYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLREKDEEIEVYKSGMEQALMELEELKLNQGDVD
SLA2_SCHPO      RYNTEVAHLEDALHSKDRELANLGVELKSTENRYRXXXXXXXXXXXXXXAAVDESLLQLSKLQLDRNDID
SLA2_YEAST      ----------------------------------------------------------------------
HIP1R_MOUSE     TLNAEKEALSGVVRQREAELLAAQS-----------LVREKEEALSQEQQRSSQEKGELRGQLAEKESQE
HIP1_HUMAN      SLKQELATSQRELQVLQGSLETSAQS--EANWAAEFAELEKERDSLV--SGAAHREEELSALRKELQDTQ
HIP1_MOUSE      KWLTQIAELEK---------EQGSLATVAAQREEELSLRDQLESTQIKLAGAQESMCQ------------
HIP1R_HUMAN     TLSAEKDALSGAVRQREADLLAAQSLVRET----EAAXXXXXXXXXXXXXXXXXRLAERESQE--QGLRQ
SLAP2_CAEEL     ASEKSKFDKDEEITALNRKVEEAQREAGRA-----LTKAEGDAAVDEMRTQLVKADIEVEELKRT---ID
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       KIDSMRQDIRKS--EKSRKELEARLEDAVAEASKERKLREHSESFS------KQMERELETLKVKQG---
MYSP_CAEEL      KYQAEIAELEMTVDNLNRANIEAQK-----------TIKKQSEQLKILQASLEDTQRQLQQV--------
CGNL1_MOUSE     EYKRELAEMQTQLKEKCLEVEKARLAASKMQDE----LRLKEEELQDYQRAEEEALTKRQLLEQSLKDLE
MYSP_DERFA      RLENERDELSAAYKEAERKQEEAKNQRAQVRHDYEKRLAQKDEEIEALR---KQYQIEIEQLNMRLAEAE
CD158_MOUSE     ECQGQMERQMAAIQGKNESLEKVSSLTAQLESTKEM-LRKVVEELTAKKMNLESSERTVSDLTASLQEKE
NDE1_CRYNE      KYNRAIEELEQDLAQKDELETETQRLKDE--------LREANEEISILKDQLARAI--------------
MYSP_BOOMI      EYELEIKRLENERDELAAAYKEAETLRKQEEHEYERRLQIKEEEIEALR---KQYQLEVEQLNMRLAEAE
EZRI_RABIT      EYTAKIALLEEARRRKESEVEEWQHRAREAQDDLVKTKEE------------------------------
MYSP_OPIFE      DANRRLTDLE-ALRSQ---LEAERDNLASALHDAEEALREVDQKLNHLKSEMEQRLREKDE----ELETL
MYSC_CHICK      DFERKLAEKDEEMRNQQRTIDSLQSTSEARSRNEAIRLKKKMEEMEIQLSHANRHAAEATKSARGLQTQI
HMW2_MYCGA      KLKEDYDRLKAALNNLQDELKQKHNLLERKKHEQDGIVNEKISELEGYRSDLVDQKLKIEREKENQERRY
MY18A_MOUSE     QLEEEYEDKQKALREKREKLSTLSDQVNQRDFESEKRLR---KDLKRTKALLADAQIMLDHLKNN-----
NUF1_YEAST      EYKESAKDSEDKIEEENSAKVSEKRSKDIKQKDEQISLKLQEDEISSLKSIIDRYKKDFNQLKSEQSNIQ
ODFP2_HUMAN     AQNK-ILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANV-
TSG10_RAT       SLVKMEEELQKVQFEKVSALADL-SSTRELDSSKELLNRQKDQEIEMMENELDSARSEIELLR-------
CCD18_HUMAN     KREVLETELQNALKSTLRQLQELRDVLQKA----QLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMD
LRRX1_DICDI     KLSDELKDKNENVRSLETSIIENQDKLDQLIQSNQVTVNE------------------------------
GCC2_MOUSE      SYKVRVHNVLKQQKNKSVSQVETEGAKQEREH-LEMLIDQLKIKLQDSQNSLQISVSEYQTL---QAEHD
TMF1_MOUSE      KLNRKAKELEEELQH----LRQVLDGKEEVEKQHRENIKKLNSVVERQEKDLGRLQVDMDELEEKSRSTQ
MYSS_CHICK      EIDRKIAEKDEEIRNHLRIVESMQSTLDARSRNEALRLKKKMEEMEIQLSHANRMAAEAQKLKDTQIHLD
MYH3_CHICK      EKDEEIDQLK---RNHLRVVDSMQSTLDARSRNEALRLKKKMEEIEIQLSHANRQAAEAQKNLRNTQGVL
SYCP1_HUMAN     KSEENCNNLRKQVENKNKYIEELQQENK--------ALKKKSKQLNVYEIKVNKLELELESAKQKFGEIT
TSG10_MACFA     SVVKMEEELQKVQFEKVSALADL-SSTRELDSSKELLNRQKDQEIEMMENELDSARSEIELLR-------
TACC2_MOUSE     RYQALKVHAEEKLDRANAEIAQVRGKAQQEQAAYQASLRKEQLRVDALERTLEQKNKEIEEL--------
GOGB1_HUMAN     QKELEITKMDQLLLEKKRDVETLQQ-----------TIEEKDQQVTEISFSMTEKMVQLNEEKFSLGVEI
TSG10_MOUSE     SLVKMEEELQKVQFEKVSALADL-SSTRELDSSKELLNRQKDQEIEMMENELDSARSEIELLR-------
MYO4_CAEEL      KLQRQIKDGQSRISXXXXXXXXXRQSRSKADRAKSDLQRELEE---------------------------
MYO3_CAEEL      REKRSRGDIEKAKRKVEGDLKVAQENIDEQKHDVETTLKRKEEDL-------------------------
MY18A_HUMAN     QLEEEYEDKQKVLREKREKLATLSDQVNRRDFESEKRLR---KDLKRTKALLADAQLMLDHLK-------
NF70_LOLPE      EIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLM----DIK
NF60_LOLPE      EIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLM----DIK
LAMA4_HUMAN     DYNAKLSDLQEALLNHVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADSLTTPRLTLSELD
ICR2_ARATH      ELKEEINVARQEISQLKSAVEVTERRYHEEYIQSTLQIRTAYEQVDEVKSGYAQREAELEELKKTKAERD
CLIP1_CHICK     KEEQLMSSELEQLKSNLTVMETKLKEREEREQQTEAKVKLENDIAEIMKSSGDSSLMKMDELRLKERQLE
CACO1_BOVIN     QSEAELQMAQQENRRLNLELQEAKDRQEEQSAQAQ-RLKDKVAQMKDTLGQVQQRVAELEPLK-------
SPO15_SCHPO     VVSSEYENLLLISSQTNKSLEDKTNQLKYIEKNVQKLLDEKD-----------QRNVELEELTSKYGKLG
MYSP_SCHJA      SENMRLKSLVNDLTDKNNALERENRQMNDQVKELKSSLRDANRRLTDLEALRSQLEAERDNLASALHDAE
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     SVVKMEEELQKVQFEKVSALADL-SSTRELDSSKELLNRQKDQEIEMRENELDSAHSEIELLR-------
ODFP2_CHICK     XXXXKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVD
KT222_MOUSE     HYQMQLQDLESVIGRLERELQEVRRGIERQLREHEMLLNTKEQEIATYRRLLEQEEIRYYGCIQGEKKEE
GAS8_HUMAN      RFTKVQQERDELYRKFTAAIQEVQQKTGFKN----LVLERKLQAL--------SAAVEKKEVQFNEVLAA
APSB_EMENI      QCNEEMESLEKSLYEANSQIESSQNEIAEQDGD-KIKIGDLESELKTYRMSLQSEKDKTKELE-------
SMC6_XENLA      QHKRQLKELHES----------------------------------------------------------
MYSP_BLOTA      KYQAQITELELSLDAANKAKKQALQITGLQAHYDEVQLQQAVDQLGVTQRRCQALTAELEEMRVN-----
MRCKB_HUMAN     HQQRKLALQEFSELNERMAELRAQKQKVSRQ------LRDKEEEMEVATDAMRQEMRRAEKLR-------
KT222_HUMAN     HYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKEQEIATYRH-----LLEKEEIRIQGGKKD
GOGA4_MOUSE     QRKKEVESLNETLKNYNQQRDTEHSGLVQRLQHLEELGEEKDNKVREAEETVLRLREHVSSLEAELGTVK
CE290_BOVIN     EYENTISSLEEEIVQQNKFHEERQMAWDQREVELERQLDVFDRQ----QSEILREAQKFEEATGSMPDPS
CACO1_RAT       QSEAELQTVREENCHLNTELQEAKGRQEEQGAQVQ-RLKDKVAHMKDTLGQTQQKVAELEPLK-------
CACO1_HUMAN     QSEAELQVAQQENHHLNLDLKEAK-SWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLK-------
UACA_CANFA      SLNSTIEHLKEELKNKQKCYEKEQQTVAKL---HQMLENQKNSSV-------------------------
TACC3_MOUSE     LANEEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKMEKI--------
MYSP_SARSC      E--AETLRKQEEAKNQRLTAELAQVR-----HDYEKRLAQKEEEIEALR---KQYQIEIEQLNMRLAEAE
MYH9_MOUSE      QFERDLQGRDEQSEEKKKQLRQVREMEAELEDEREMDLKDLEAHIDTANKNREEAIKQLRKLQAQMKDCM
IFA4_CAEEL      MASRD-TTVENREYFKNELSSAIREIRSEYDHDIESWYKLKVQEIHTQNSRLEQAREEVKRLRTTLGDMG
EBH_STAAR       EIDRNLTDKEQALKDRNQILQQGHN-----DINNAMT----KEEIEQAKAQLGQALQDIKDLESAKQDID
CP135_DANRE     AMSRLEEEVQAARAEKASVLADVRELCVKLDSSKELTVRQKSMELERVTGELEDVRSEMELLKKQLG---
CACO1_PONAB     QSEAELQVAQQENHRLNLDLKEAKSWQKEQSAQAQ-RLKDKVAQMKDTLGQAQQRVAELEPLK-------
ANR26_MOUSE     SRYREARDLKKKLGQLRSQLQEARDQHREAVH-HAEKMEDHLQKLELEKSKFEITIKEIDQLQENLSRVN
TACC2_HUMAN     RYQALKVHAEEKLDRANAEIAQVRGKAQQEQAAHQASLRKEQLRVDALERTLEQKNKEIEEL--------
RAD50_ENCCU     GFGVEMLDL-ESLYDGEEVLQRSGASDGERIYSHECPVLSKEEEVEFLEAGIERAL--------------
CENPE_HUMAN     DYDNLVLDYEQXXXXXXXALERKTKKDQEMQLIHEISLKNLVKHAEVYNQDLENELSSKVELLREKEDQI
CCD18_MOUSE     STLRQLQELRDVLQKAQLSLEEKYTTI----KDLTAELRECKMEIEDKKQEMDQALKERNELKQRAAQV-
BRE1_CAEEL      LMEQHRKNIQEVGMSRDENQIKADRCEGQMKQIQEL-YAAKAREIEDFKFKRQRAEEELETLRIKYERVN
RAD50_RAT       LKTEILTKKQTELRNVRNELQQLEGSSDRLELDQELTKAERELSKAEKNSSIETLKAEILNLQSEKADLD
ODFP2_RAT       RTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKS--------------------
ODFP2_MOUSE     KREEAIHQAQLRLEEKTRAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDAD
MYSA_DROME      NLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETSLNQKCIG
MYO3_CAEBR      XXXRQIKELQARIAXXXXXXXXXRNSRQKADRTRNELQRELEEISERLEQQGGFSAAQLEANKKREAEIA
MYO1_YEAST      KLSSSEEDLDIKLKNCNIAMSRLQSLVTENS-----DLRSKNENFKKEKAALNNQLKESELLKMKE----
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     TYKRQVVELQNRLSEESKKADKLEFEYKRLKEKIDSLQKEKD-RLRSERDSLKETIEELRCVQAQEGQLT
CENPE_MOUSE     DYTDEISHTQGDLKHTN-AVVEAQNQD----------LREKEHQLSQVKADLRETVDQMEQLKLESREIE
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        QFERDLQGRDEQSEEKKKQLRQVREMEAELEDEREMDLKDLEAHIDTANKNREEAIKQLRKLQAQMKDCM
LRC45_HUMAN     EQQR-LAHLEDKLRLLAQARDEAQGA--------------------------------------------
KT222_BOVIN     HYQMQLQDLEAVIEGLEKELQEVRRGIERQLQEHEMLLNTKEQEIATYR-----RLLEKEEIR-------
HMW2_MYCPN      KLHRELKAQNEATAHKNREVLEIEN---------------------------------------------
GCC2_HUMAN      SYKVRVHNVLKQQKNKSMSQAETEGAKQEREH-LEMLIDQLKIKLQDSQNNLQINVSELQTLQ-------
U639_CAEEL      MNEQKTQDLEKERQYYTMKTSELMDHLKEVSEQRDLTESELKEQMEKQLQAAEKALEHLEALKMTGAQM-
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     SLSYQLSGLQKAAEDRIRELEEAM--AGERDKFRKM-LDAKEQEMTEMRDVMQQQLAEYQELL----DVK
LIFO_ACIAD      K---------------------------------------------------------------------
CK5P2_HUMAN     ESNKK-------LHNQEQVIKHLTESTNQKD---VLLQKFNEKDLEVIQQNC--YLMAAEDLEL------


                         .         +         .         .         .         .         *:700
query           KALDTQIDDVLLSSVTKINDIIDSVLQSGVQRVDDALYELDSTMQAGNQNASPPYVLSQIEKXXXXXXXX
SLA2_SCHPO      QAMDTQIDELLKSQLEKLDDIVDSVLATGIQRLDTSLYELDSPMHAGNQYATPEFILSTIENASNNATDF
SLA2_YEAST      ----------------KMNPILDAILESGINTIQESVYNLDSPLSWSGXXXXXXXXXXXXXXXXXNATEF
HIP1R_MOUSE     QGLRQKLLDEQLAVLRSXXXXXXXILQDAVSKLDDPLH-LRCT-------SSPDYLVSRAQAALDSVSGL
HIP1_HUMAN      LKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAG-SADHLLSTVTSISSCIEQL
HIP1_MOUSE      -----QVKDQRKTLLAGIRKAAEREIQEALSQLEEPISCAGSTDHXXXXXXXXXXCLEQLEKNG------
HIP1R_HUMAN     RLLDEQF-----AVLRGXXXXXXGILQDAVSKLDDPLH-LRCT-------SSPDYLVSRAQEALDAVSTL
SLAP2_CAEEL     HLRESHANQLVQSSAEETNKILEVAKESGVG-ITQMFDHCEDALQNATSITYPPHLAQSA----------
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     YELEAK----------------------------------------------------------------
MYSP_DERFA      AKLKTEI---------------------------------------------------------------
CD158_MOUSE     RAI-----EATNAEITKLRSRVDLKLQ-------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      AKLKTEIARIKKKYQAQITELEMSLDAANKQNMD------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      RKSTTRTIEELTVTITEMEVKYKSELSRLKKRYESNIAELELQLDTANK---------------------
MYSC_CHICK      KELQVQLDDLDLKEQLAVSDRRNNLLQS---ELDELRALLDQTERA------------------------
HMW2_MYCGA      KAAEAEIDELFLEANTKLNE--------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      HDLNLQIENKLIESEDELKSLRDS----------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     QAL-------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      TLLERH-NRMLQETVTK-----------------------------------------------------
TMF1_MOUSE      AALDSAYRE--LTDLHKANAAKDSEVQEAALR--------------------------------------
MYSS_CHICK      DALRTQED---LKEQVAMVERRANLLQAEVEELRGALEQTERSRKVAEQ---------------------
MYH3_CHICK      KDTQIHLDDALRSQEDLKEQVAANLLQAEIEELRAALEQTERSRKVAEQ---------------------
SYCP1_HUMAN     DTYQKEIEDKKISEENLLEEV-------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     KTLKEQLNLLSRAEEAKKEQVEDNEVSSGLKQNYDEM---------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      LSLELEI---------------------------------------------------------------
NF60_LOLPE      LSLELEI---------------------------------------------------------------
LAMA4_HUMAN     SGIYAEIDGALQVKLSNLSNLSHDLVQEAIDHAQDLQQE-------------------------------
ICR2_ARATH      -----SLHERLMDKEAKLRILVDEILNSKIKEKEEVYLNLENSL---NQN--------------------
CLIP1_CHICK     Q---------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     EE-NAQIKDELLA---------------------------------------------------------
MYSP_SCHJA      EAL-------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     SAL-------------------------------------------------------------------
KT222_MOUSE     KPTKSKVGFLLPSAI--INEI-------------------------------------------------
GAS8_HUMAN      SNLDP-------AALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHN----------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     KELEAQLDDAV-----------------------------------------------------------
KT222_HUMAN     KKPTTRVGFVLPSAI--INEI-------------------------------------------------
GOGA4_MOUSE     KELE------------------------------------------------------------------
CE290_BOVIN     LPIPNQLEIALRKIKENIRIILET--QATCRSLEEKLREKESALRLAEEN--------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      AKLKTEI---------------------------------------------------------------
MYH9_MOUSE      RELD------------------------------------------------------------------
IFA4_CAEEL      KMADLEGRNLLLKQIEDLNYQMEEDMRSYEQSLND-----------------------------------
EBH_STAAR       KQVQALIDEIILTDKEKLKDRINQILQQGHNGINNAM---------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     KKLQEYIDSQKLENI-------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ESVPAQSGDQVLEEANR-----------------------------------------------------
RAD50_RAT       RNL-------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     RRYQSRLQDL------------------------------------------------------------
MYSA_DROME      QRLSTEVEDLQLNAAEKKQKAFDKIIGEWKLKVDDLAAELDASQK-------------------------
MYO3_CAEBR      KLRREKEEDAL-----------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     SA--------------------------------------------------------------------
CENPE_MOUSE     KELTQQLNENLITLVTKENDIMDEALREERDQLRKSLQQTEA----------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        RDVD------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----TELQEHIMPDVHKLREFFE-----------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     LALDMEIN--------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           XXXXNNFIADGPNSAHSEIIRTVSVFSGSIADVLSNTKGLTRFATDDKKADQLINAARQSAQSTMTFFRA
SLA2_SCHPO      STAFNNYFADGPNADHSEVINGVNLFSTAIYEVANNAKGLSRTTGDDQGSDRFVGLSRDLVNMAKRFLSS
SLA2_YEAST      ATSFNNLIVDGAHGDQTEVIHCVSDFSTSMATLVTNSKAYAVTTLPQEQSDQILTLVKRCAREAQYFFED
HIP1R_MOUSE     EQGHTQYLASSEDA--SALVAALTRFSHLAADTIVNGAATSHLAPTDP-ADRLMDTCRECGA------RA
HIP1_HUMAN      EKSWSQYLACPEDI--SGLLHSITLLAHLTSDAIAHG-ATTCLRAPPEPADSLTEACKQYGRETLAYLAS
HIP1_MOUSE      ----SQYLACPEDI--SELLHSITLLAHLTGDTIIQGSA-TSLRAPPEPADSLTEACRQYGRETLAYLSS
HIP1R_HUMAN     EEGHAQYXXXXXXXXXXXXXXXR--FSHLAADTIINGGATSHLAPTDP-ADRLIDTCRECGA------RA
SLAP2_CAEEL     ---MNNLVNILSNERLDEPLATKNVFAGHXXXXXXXXXXXXXXXXXIESYEGVNDQCKKVLAAAKVAFSD
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LQSFRLQDLEPLQKTDVVINNNHEVALNLQKLSKLVDAFAPKSTKLNGTGDLGDLVDRELSXXXXXXXXX
SLA2_SCHPO      LFSVNTRKMDVNVKTDLVIGENIELQRYLQQLTQYSEKFLNKESELNAPGEIEELVDNQLAETXXXXXXX
SLA2_YEAST      LMSENLNQVGDEEKTDIVINANVDMQEKLQELSLAIEPLSVKSNKTNPHSELVATADKIVK---------
HIP1R_MOUSE     LELVQLQDQTVLRRAQPSL-----MRAPLQGILQLGQDLKPKSLDVRQE-ELGAMVDKEMAATSAAIEDA
HIP1_HUMAN      LE-----EEGSLENADSTAMRNC-----LSKIKAIGEELLPRGLDIKQE-ELGDLVDKEMXXXXXXXXXX
HIP1_MOUSE      LE-----EEGTMENADVTALRNC-----LSRVKTLGEELLPRGLDIKQE-ELGDLVDKEMXXXXXXXXXX
HIP1R_HUMAN     LELMQLQDQQALRHMQASL-----VRTPLQGILQLGQELKPKSLDVRQE-ELGAVVDKEMAATSAAIEDA
SLAP2_CAEEL     DSALSRADKMKLLRQDIQTLNSLMISLPLQTIDKDV---------------VGNELEQEMRRMDDAIRRA
TLN2_HUMAN      ----------------------------------------------------------------------
TLN1_CHICK      ----------------------------------------------------------------------
TLN2_MOUSE      ----------------------------------------------------------------------
TLN1_MOUSE      ----------------------------------------------------------------------
TALB_DICDI      ----------------------------------------------------------------------
TLN1_HUMAN      ----------------------------------------------------------------------
TALA_DICDI      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           XXXXXXXXXXPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
SLA2_SCHPO      XXXXXXXXXKPKDSLSPSELQVHDSLLSASIAITEAIARLIKAATASQAEIVAQGRGSSSRGAFYKKHNR
SLA2_YEAST      ---------------SSEHLRVDKPLLSLALMIIDAVVALVKAAIQCQNEIATTT--SIPLNQFYLKNSR
HIP1R_MOUSE     VRRIEDMMSQARHESSGVKLEVNERILNSCTDLMKAIRLLVMTSTSLQKEIVESGRGAATQQEFYAKNSR
HIP1_HUMAN      XXXXXXMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSR
HIP1_MOUSE      XXXXXXXLSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEIVESGRGTASPKEFYAKNSR
HIP1R_HUMAN     VRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSR
SLAP2_CAEEL     VQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQ
TLN2_HUMAN      -------------------LDFEEQILEXXXXXXXXXXXLVKSASAAQRELVAQGKVGSI-PANAADDGQ
TLN1_CHICK      -----------------------------------------------QRELVAQGKGVIPANAV--DDGQ
TLN2_MOUSE      -------------------LDFEEQILEXXXXXXXXXXXLVKSASAAQRELVAQGKVGSI-PANAADDGQ
TLN1_MOUSE      -----------------------------------------------QRELVAQGKGAIPANAL--DDGQ
TALB_DICDI      ------------------EAGIDESILEAARAITSATGVLVQCATNVQHELVLAGK-VGNKGNMYRRDPT
TLN1_HUMAN      -----------------------------------------------QRELVAQGKGAIPANAL--DDGQ
TALA_DICDI      ------------------------TIVDASSAIAKAVAKLVNSAAVAQSKRREDQIASGS---VYKADPT
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
SLA2_SCHPO      WTEGLISAAKAVARATTTLIETADGVVNGTSSFEHLIVACNGVSAATAQLVAASRVKANFASKVQDHLED
SLA2_YEAST      WTEGLISAAKAVAGATNVLITTASKLITSEDSPEQFIVASKEVAASTIQLVAASRVKTSIHSKAQDKLEH
HIP1R_MOUSE     WTEGLISASKAVGWGATQLVESADKVVLHMGKYEELIVCSHEIAASTAQLVAASKVKANKNSPHLSRLQE
HIP1_HUMAN      WTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQ
HIP1_MOUSE      WTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQ
HIP1R_HUMAN     WTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQE
SLAP2_CAEEL     WTEGLLSAAKAVGVAARVLVESADGVVTGKGKFEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDAL--
TLN2_HUMAN      WSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQA
TLN1_CHICK      WSQGLISAARMVAAATNNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMKRLQA
TLN2_MOUSE      WSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQA
TLN1_MOUSE      WSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQA
TALB_DICDI      WARGLISAAQAVAGSVQGLVHSANSSSQGKVDEEQLVXXXXXXXXXXXRLVTASRAKADXXXXXXXXXXX
TLN1_HUMAN      WSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQA
TALA_DICDI      WSNGLISAAKGVGAATHRLVEAAMKSATGKAEEEELIXXXXXXXXXXXXXXXXXXXKSGDDYQSQSHLST
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHEFKVREMEQQVEILQLENKLSQARQRLGEMR
SLA2_SCHPO      AAKAVTEACKALVRQVESVALKAK--EVQHEDFSSLGVHEYRRKEIEQQVQILKLENDLVAARRRLFDMR
SLA2_YEAST      CSKDVTDACRSLGNHVMGMIEDDHSTSQQQQPLDFTSEHTLKTAEMEQQVEILKLEQSLSNARKRLGEIR
HIP1R_MOUSE     CSRTVNERAANVVASTKS--GQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERVRLGELR
HIP1_HUMAN      ASRGVNQATAGVV--ASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELR
HIP1_MOUSE      ASRGVNQATAAVV--ASTISGKSQIEETDSMDFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELR
HIP1R_HUMAN     CSRTVNERAANVVASTKS--GQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELR
SLAP2_CAEEL     SXXXXXXXXXXXXXXXXXXXGQTTLNDEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALR
TLN2_HUMAN      AGNAVKRASDNLVR--------------------------------------------------------
TLN1_CHICK      AGNAVKRASDNLVKAAQKAAAFQDHDETVVVKEKMVGG--------------------------------
TLN2_MOUSE      AGNAV-----------------------------------------------------------------
TLN1_MOUSE      AGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVG--------------------------------
TALB_DICDI      XXKQVSNATAALVEAAKQV----NEEPEVEFDTTNLSNAQIISKEMD-----------------------
TLN1_HUMAN      AGNAVKRASDNLV---------------------------------------------------------
TALA_DICDI      AARQVASATSDLVAAAKAATIFDXXXXXXXXXXFNFTGS--KVKELEQQMKILKLEKELETARRQMLNSR
MRCKB_RAT       ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
NDE1_CRYNE      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
MYSS_CHICK      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
LAMA4_HUMAN     ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
KT222_MOUSE     ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
KT222_HUMAN     ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TACC3_MOUSE     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RAD50_ENCCU     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
LRC45_HUMAN     ----------------------------------------------------------------------
KT222_BOVIN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
U639_CAEEL      ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
LMNB2_HUMAN     ----------------------------------------------------------------------
LIFO_ACIAD      ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           KISYLx
SLA2_SCHPO      KTSY--
SLA2_YEAST      RHAY--
HIP1R_MOUSE     KQHYV-
HIP1_HUMAN      KKHY--
HIP1_MOUSE      KKHY--
HIP1R_HUMAN     KQHYV-
SLAP2_CAEEL     KQHY--
TLN2_HUMAN      ------
TLN1_CHICK      ------
TLN2_MOUSE      ------
TLN1_MOUSE      ------
TALB_DICDI      ------
TLN1_HUMAN      ------
TALA_DICDI      KQNY--
MRCKB_RAT       ------
MYSP_CAEEL      ------
CGNL1_MOUSE     ------
MYSP_DERFA      ------
CD158_MOUSE     ------
NDE1_CRYNE      ------
MYSP_BOOMI      ------
EZRI_RABIT      ------
MYSP_OPIFE      ------
MYSC_CHICK      ------
HMW2_MYCGA      ------
MY18A_MOUSE     ------
NUF1_YEAST      ------
ODFP2_HUMAN     ------
TSG10_RAT       ------
CCD18_HUMAN     ------
LRRX1_DICDI     ------
GCC2_MOUSE      ------
TMF1_MOUSE      ------
MYSS_CHICK      ------
MYH3_CHICK      ------
SYCP1_HUMAN     ------
TSG10_MACFA     ------
TACC2_MOUSE     ------
GOGB1_HUMAN     ------
TSG10_MOUSE     ------
MYO4_CAEEL      ------
MYO3_CAEEL      ------
MY18A_HUMAN     ------
NF70_LOLPE      ------
NF60_LOLPE      ------
LAMA4_HUMAN     ------
ICR2_ARATH      ------
CLIP1_CHICK     ------
CACO1_BOVIN     ------
SPO15_SCHPO     ------
MYSP_SCHJA      ------
CNPD_NITSB      ------
TSG10_HUMAN     ------
ODFP2_CHICK     ------
KT222_MOUSE     ------
GAS8_HUMAN      ------
APSB_EMENI      ------
SMC6_XENLA      ------
MYSP_BLOTA      ------
MRCKB_HUMAN     ------
KT222_HUMAN     ------
GOGA4_MOUSE     ------
CE290_BOVIN     ------
CACO1_RAT       ------
CACO1_HUMAN     ------
UACA_CANFA      ------
TACC3_MOUSE     ------
MYSP_SARSC      ------
MYH9_MOUSE      ------
IFA4_CAEEL      ------
EBH_STAAR       ------
CP135_DANRE     ------
CACO1_PONAB     ------
ANR26_MOUSE     ------
TACC2_HUMAN     ------
RAD50_ENCCU     ------
CENPE_HUMAN     ------
CCD18_MOUSE     ------
BRE1_CAEEL      ------
RAD50_RAT       ------
ODFP2_RAT       ------
ODFP2_MOUSE     ------
MYSA_DROME      ------
MYO3_CAEBR      ------
MYO1_YEAST      ------
MYH8_MOUSE      ------
HOOK3_XENLA     ------
CENPE_MOUSE     ------
CC110_MOUSE     ------
MYH9_RAT        ------
LRC45_HUMAN     ------
KT222_BOVIN     ------
HMW2_MYCPN      ------
GCC2_HUMAN      ------
U639_CAEEL      ------
MOEH_ANOGA      ------
LMNB2_HUMAN     ------
LIFO_ACIAD      ------
CK5P2_HUMAN     ------