[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00429

[Show Plain Result]


## Summary of Sequence Search
    1::476
  375::471     3e-14  41%  479 aa  YHLD_SCHPO RecName: Full=Uncharacterized protein C800.13;
  432::504     3e-09  36%  518 aa  CENPT_RAT RecName: Full=Centromere protein T;         Short=CENP-T;
  429::501     8e-09  34%  515 aa  CENPT_MOUSE RecName: Full=Centromere protein T;       
  475::545     1e-08  35%  561 aa  CENPT_MACFA RecName: Full=Centromere protein T;       
  475::545     1e-08  35%  561 aa  CENPT_HUMAN RecName: Full=Centromere protein T;       
   28::94      1e-04  40%  103 aa  H4_CANGA RecName: Full=Histone H4;
   28::94      2e-04  40%  103 aa  H4_YEAST RecName: Full=Histone H4;
   30::97      2e-04  35%   98 aa  H41_BLEJA RecName: Full=Histone H4-1;Flags: Fragment;
   28::94      3e-04  36%  103 aa  H4_PHYPO RecName: Full=Histone H4;
   28::94      3e-04  36%  103 aa  H4_ARXAD RecName: Full=Histone H4;
   28::94      3e-04  38%  103 aa  H42_PENFN RecName: Full=Histone H4.2;
   28::94      3e-04  38%  103 aa  H42_EMENI RecName: Full=Histone H4.2;
   28::94      3e-04  38%  103 aa  H41_ASHGO RecName: Full=Histone H4.1;
   28::94      4e-04  38%  103 aa  H4_SCHPO RecName: Full=Histone H4;
   44::110     4e-04  34%  118 aa  H4_ENTHI RecName: Full=Histone H4;
   28::94      5e-04  38%  103 aa  H4_MORAP RecName: Full=Histone H4;
   28::94      6e-04  38%  103 aa  H4_VOLCA RecName: Full=Histone H4;
   28::94      6e-04  38%  103 aa  H4_PYRSA RecName: Full=Histone H4;
   28::94      6e-04  36%  103 aa  H4_NEUCR RecName: Full=Histone H4;
   33::98      6e-04  35%  107 aa  H4_EUPCR RecName: Full=Histone H4;
   28::94      6e-04  36%  103 aa  H4_ASPOR RecName: Full=Histone H4;
   28::94      6e-04  36%  103 aa  H4_ASPFU RecName: Full=Histone H4;
   28::96      6e-04  37%  103 aa  H48_CHICK RecName: Full=Histone H4 type VIII;
   21::88      6e-04  34%   89 aa  H42_BLEJA RecName: Full=Histone H4;Flags: Fragment;
   28::94      6e-04  36%  103 aa  H41_PENFN RecName: Full=Histone H4.1;
   28::94      6e-04  36%  103 aa  H41_EMENI RecName: Full=Histone H4.1;
   28::94      8e-04  38%  103 aa  H4_XENTR RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_XENLA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_XENBO RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_URECA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_TIGCA RecName: Full=Histone H4;
   29::94      8e-04  36%  103 aa  H4_TETTH RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_STYPL RecName: Full=Histone H4;
   30::95      8e-04  36%  104 aa  H4_STYLE RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_RHYAM RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_RAT RecName: Full=Histone H4;Contains:  RecName: Full=Osteogenic
   28::94      8e-04  38%  103 aa  H4_PONAB RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_PLADU RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_PIG RecName: Full=Histone H4;
   30::95      8e-04  36%  104 aa  H4_OXYNO RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_ORENI RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_ONCMY RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_OLILU RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_OIKDI RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYTTR RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYTGA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYTED RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYTCH RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYTCA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MYRRU RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MOUSE RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_MACFA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_HUMAN RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROYA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROTE RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROSI RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROSE RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROOR RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROME RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROMA RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROHY RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DROER RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_DENKL RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_CHLRE RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_CHITH RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_CHICK RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_CHAVR RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_CAIMO RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_BOVIN RecName: Full=Histone H4;AltName: Full=H4.1;
   28::94      8e-04  38%  103 aa  H4_ASEAQ RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_ACRFO RecName: Full=Histone H4;
   28::94      8e-04  38%  103 aa  H4_ACRAS RecName: Full=Histone H4;
   29::94      8e-04  36%  103 aa  H42_TETPY RecName: Full=Histone H4, minor;
   29::94      8e-04  36%  103 aa  H41_TETPY RecName: Full=Histone H4, major;
    1::476

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHLD_SCHPO      ----------------------------------------------------------------------
CENPT_RAT       ----------------------------------------------------------------------
CENPT_MOUSE     ----------------------------------------------------------------------
CENPT_MACFA     ----------------------------------------------------------------------
CENPT_HUMAN     ----------------------------------------------------------------------
H4_CANGA        ----------------------------------------------------------------------
H4_YEAST        ----------------------------------------------------------------------
H41_BLEJA       ----------------------------------------------------------------------
H4_PHYPO        ----------------------------------------------------------------------
H4_ARXAD        ----------------------------------------------------------------------
H42_PENFN       ----------------------------------------------------------------------
H42_EMENI       ----------------------------------------------------------------------
H41_ASHGO       ----------------------------------------------------------------------
H4_SCHPO        ----------------------------------------------------------------------
H4_ENTHI        ----------------------------------------------------------------------
H4_MORAP        ----------------------------------------------------------------------
H4_VOLCA        ----------------------------------------------------------------------
H4_PYRSA        ----------------------------------------------------------------------
H4_NEUCR        ----------------------------------------------------------------------
H4_EUPCR        ----------------------------------------------------------------------
H4_ASPOR        ----------------------------------------------------------------------
H4_ASPFU        ----------------------------------------------------------------------
H48_CHICK       ----------------------------------------------------------------------
H42_BLEJA       ----------------------------------------------------------------------
H41_PENFN       ----------------------------------------------------------------------
H41_EMENI       ----------------------------------------------------------------------
H4_XENTR        ----------------------------------------------------------------------
H4_XENLA        ----------------------------------------------------------------------
H4_XENBO        ----------------------------------------------------------------------
H4_URECA        ----------------------------------------------------------------------
H4_TIGCA        ----------------------------------------------------------------------
H4_TETTH        ----------------------------------------------------------------------
H4_STYPL        ----------------------------------------------------------------------
H4_STYLE        ----------------------------------------------------------------------
H4_RHYAM        ----------------------------------------------------------------------
H4_RAT          ----------------------------------------------------------------------
H4_PONAB        ----------------------------------------------------------------------
H4_PLADU        ----------------------------------------------------------------------
H4_PIG          ----------------------------------------------------------------------
H4_OXYNO        ----------------------------------------------------------------------
H4_ORENI        ----------------------------------------------------------------------
H4_ONCMY        ----------------------------------------------------------------------
H4_OLILU        ----------------------------------------------------------------------
H4_OIKDI        ----------------------------------------------------------------------
H4_MYTTR        ----------------------------------------------------------------------
H4_MYTGA        ----------------------------------------------------------------------
H4_MYTED        ----------------------------------------------------------------------
H4_MYTCH        ----------------------------------------------------------------------
H4_MYTCA        ----------------------------------------------------------------------
H4_MYRRU        ----------------------------------------------------------------------
H4_MOUSE        ----------------------------------------------------------------------
H4_MACFA        ----------------------------------------------------------------------
H4_HUMAN        ----------------------------------------------------------------------
H4_DROYA        ----------------------------------------------------------------------
H4_DROTE        ----------------------------------------------------------------------
H4_DROSI        ----------------------------------------------------------------------
H4_DROSE        ----------------------------------------------------------------------
H4_DROOR        ----------------------------------------------------------------------
H4_DROME        ----------------------------------------------------------------------
H4_DROMA        ----------------------------------------------------------------------
H4_DROHY        ----------------------------------------------------------------------
H4_DROER        ----------------------------------------------------------------------
H4_DENKL        ----------------------------------------------------------------------
H4_CHLRE        ----------------------------------------------------------------------
H4_CHITH        ----------------------------------------------------------------------
H4_CHICK        ----------------------------------------------------------------------
H4_CHAVR        ----------------------------------------------------------------------
H4_CAIMO        ----------------------------------------------------------------------
H4_BOVIN        ----------------------------------------------------------------------
H4_ASEAQ        ----------------------------------------------------------------------
H4_ACRFO        ----------------------------------------------------------------------
H4_ACRAS        ----------------------------------------------------------------------
H42_TETPY       ----------------------------------------------------------------------
H41_TETPY       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHLD_SCHPO      ----------------------------------------------------------------------
CENPT_RAT       ----------------------------------------------------------------------
CENPT_MOUSE     ----------------------------------------------------------------------
CENPT_MACFA     ----------------------------------------------------------------------
CENPT_HUMAN     ----------------------------------------------------------------------
H4_CANGA        ----------------------------------------------------------------------
H4_YEAST        ----------------------------------------------------------------------
H41_BLEJA       ----------------------------------------------------------------------
H4_PHYPO        ----------------------------------------------------------------------
H4_ARXAD        ----------------------------------------------------------------------
H42_PENFN       ----------------------------------------------------------------------
H42_EMENI       ----------------------------------------------------------------------
H41_ASHGO       ----------------------------------------------------------------------
H4_SCHPO        ----------------------------------------------------------------------
H4_ENTHI        ----------------------------------------------------------------------
H4_MORAP        ----------------------------------------------------------------------
H4_VOLCA        ----------------------------------------------------------------------
H4_PYRSA        ----------------------------------------------------------------------
H4_NEUCR        ----------------------------------------------------------------------
H4_EUPCR        ----------------------------------------------------------------------
H4_ASPOR        ----------------------------------------------------------------------
H4_ASPFU        ----------------------------------------------------------------------
H48_CHICK       ----------------------------------------------------------------------
H42_BLEJA       ----------------------------------------------------------------------
H41_PENFN       ----------------------------------------------------------------------
H41_EMENI       ----------------------------------------------------------------------
H4_XENTR        ----------------------------------------------------------------------
H4_XENLA        ----------------------------------------------------------------------
H4_XENBO        ----------------------------------------------------------------------
H4_URECA        ----------------------------------------------------------------------
H4_TIGCA        ----------------------------------------------------------------------
H4_TETTH        ----------------------------------------------------------------------
H4_STYPL        ----------------------------------------------------------------------
H4_STYLE        ----------------------------------------------------------------------
H4_RHYAM        ----------------------------------------------------------------------
H4_RAT          ----------------------------------------------------------------------
H4_PONAB        ----------------------------------------------------------------------
H4_PLADU        ----------------------------------------------------------------------
H4_PIG          ----------------------------------------------------------------------
H4_OXYNO        ----------------------------------------------------------------------
H4_ORENI        ----------------------------------------------------------------------
H4_ONCMY        ----------------------------------------------------------------------
H4_OLILU        ----------------------------------------------------------------------
H4_OIKDI        ----------------------------------------------------------------------
H4_MYTTR        ----------------------------------------------------------------------
H4_MYTGA        ----------------------------------------------------------------------
H4_MYTED        ----------------------------------------------------------------------
H4_MYTCH        ----------------------------------------------------------------------
H4_MYTCA        ----------------------------------------------------------------------
H4_MYRRU        ----------------------------------------------------------------------
H4_MOUSE        ----------------------------------------------------------------------
H4_MACFA        ----------------------------------------------------------------------
H4_HUMAN        ----------------------------------------------------------------------
H4_DROYA        ----------------------------------------------------------------------
H4_DROTE        ----------------------------------------------------------------------
H4_DROSI        ----------------------------------------------------------------------
H4_DROSE        ----------------------------------------------------------------------
H4_DROOR        ----------------------------------------------------------------------
H4_DROME        ----------------------------------------------------------------------
H4_DROMA        ----------------------------------------------------------------------
H4_DROHY        ----------------------------------------------------------------------
H4_DROER        ----------------------------------------------------------------------
H4_DENKL        ----------------------------------------------------------------------
H4_CHLRE        ----------------------------------------------------------------------
H4_CHITH        ----------------------------------------------------------------------
H4_CHICK        ----------------------------------------------------------------------
H4_CHAVR        ----------------------------------------------------------------------
H4_CAIMO        ----------------------------------------------------------------------
H4_BOVIN        ----------------------------------------------------------------------
H4_ASEAQ        ----------------------------------------------------------------------
H4_ACRFO        ----------------------------------------------------------------------
H4_ACRAS        ----------------------------------------------------------------------
H42_TETPY       ----------------------------------------------------------------------
H41_TETPY       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHLD_SCHPO      ----------------------------------------------------------------------
CENPT_RAT       ----------------------------------------------------------------------
CENPT_MOUSE     ----------------------------------------------------------------------
CENPT_MACFA     ----------------------------------------------------------------------
CENPT_HUMAN     ----------------------------------------------------------------------
H4_CANGA        ----------------------------------------------------------------------
H4_YEAST        ----------------------------------------------------------------------
H41_BLEJA       ----------------------------------------------------------------------
H4_PHYPO        ----------------------------------------------------------------------
H4_ARXAD        ----------------------------------------------------------------------
H42_PENFN       ----------------------------------------------------------------------
H42_EMENI       ----------------------------------------------------------------------
H41_ASHGO       ----------------------------------------------------------------------
H4_SCHPO        ----------------------------------------------------------------------
H4_ENTHI        ----------------------------------------------------------------------
H4_MORAP        ----------------------------------------------------------------------
H4_VOLCA        ----------------------------------------------------------------------
H4_PYRSA        ----------------------------------------------------------------------
H4_NEUCR        ----------------------------------------------------------------------
H4_EUPCR        ----------------------------------------------------------------------
H4_ASPOR        ----------------------------------------------------------------------
H4_ASPFU        ----------------------------------------------------------------------
H48_CHICK       ----------------------------------------------------------------------
H42_BLEJA       ----------------------------------------------------------------------
H41_PENFN       ----------------------------------------------------------------------
H41_EMENI       ----------------------------------------------------------------------
H4_XENTR        ----------------------------------------------------------------------
H4_XENLA        ----------------------------------------------------------------------
H4_XENBO        ----------------------------------------------------------------------
H4_URECA        ----------------------------------------------------------------------
H4_TIGCA        ----------------------------------------------------------------------
H4_TETTH        ----------------------------------------------------------------------
H4_STYPL        ----------------------------------------------------------------------
H4_STYLE        ----------------------------------------------------------------------
H4_RHYAM        ----------------------------------------------------------------------
H4_RAT          ----------------------------------------------------------------------
H4_PONAB        ----------------------------------------------------------------------
H4_PLADU        ----------------------------------------------------------------------
H4_PIG          ----------------------------------------------------------------------
H4_OXYNO        ----------------------------------------------------------------------
H4_ORENI        ----------------------------------------------------------------------
H4_ONCMY        ----------------------------------------------------------------------
H4_OLILU        ----------------------------------------------------------------------
H4_OIKDI        ----------------------------------------------------------------------
H4_MYTTR        ----------------------------------------------------------------------
H4_MYTGA        ----------------------------------------------------------------------
H4_MYTED        ----------------------------------------------------------------------
H4_MYTCH        ----------------------------------------------------------------------
H4_MYTCA        ----------------------------------------------------------------------
H4_MYRRU        ----------------------------------------------------------------------
H4_MOUSE        ----------------------------------------------------------------------
H4_MACFA        ----------------------------------------------------------------------
H4_HUMAN        ----------------------------------------------------------------------
H4_DROYA        ----------------------------------------------------------------------
H4_DROTE        ----------------------------------------------------------------------
H4_DROSI        ----------------------------------------------------------------------
H4_DROSE        ----------------------------------------------------------------------
H4_DROOR        ----------------------------------------------------------------------
H4_DROME        ----------------------------------------------------------------------
H4_DROMA        ----------------------------------------------------------------------
H4_DROHY        ----------------------------------------------------------------------
H4_DROER        ----------------------------------------------------------------------
H4_DENKL        ----------------------------------------------------------------------
H4_CHLRE        ----------------------------------------------------------------------
H4_CHITH        ----------------------------------------------------------------------
H4_CHICK        ----------------------------------------------------------------------
H4_CHAVR        ----------------------------------------------------------------------
H4_CAIMO        ----------------------------------------------------------------------
H4_BOVIN        ----------------------------------------------------------------------
H4_ASEAQ        ----------------------------------------------------------------------
H4_ACRFO        ----------------------------------------------------------------------
H4_ACRAS        ----------------------------------------------------------------------
H42_TETPY       ----------------------------------------------------------------------
H41_TETPY       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHLD_SCHPO      ----------------------------------------------------------------------
CENPT_RAT       ----------------------------------------------------------------------
CENPT_MOUSE     ----------------------------------------------------------------------
CENPT_MACFA     ----------------------------------------------------------------------
CENPT_HUMAN     ----------------------------------------------------------------------
H4_CANGA        ----------------------------------------------------------------------
H4_YEAST        ----------------------------------------------------------------------
H41_BLEJA       ----------------------------------------------------------------------
H4_PHYPO        ----------------------------------------------------------------------
H4_ARXAD        ----------------------------------------------------------------------
H42_PENFN       ----------------------------------------------------------------------
H42_EMENI       ----------------------------------------------------------------------
H41_ASHGO       ----------------------------------------------------------------------
H4_SCHPO        ----------------------------------------------------------------------
H4_ENTHI        ----------------------------------------------------------------------
H4_MORAP        ----------------------------------------------------------------------
H4_VOLCA        ----------------------------------------------------------------------
H4_PYRSA        ----------------------------------------------------------------------
H4_NEUCR        ----------------------------------------------------------------------
H4_EUPCR        ----------------------------------------------------------------------
H4_ASPOR        ----------------------------------------------------------------------
H4_ASPFU        ----------------------------------------------------------------------
H48_CHICK       ----------------------------------------------------------------------
H42_BLEJA       ----------------------------------------------------------------------
H41_PENFN       ----------------------------------------------------------------------
H41_EMENI       ----------------------------------------------------------------------
H4_XENTR        ----------------------------------------------------------------------
H4_XENLA        ----------------------------------------------------------------------
H4_XENBO        ----------------------------------------------------------------------
H4_URECA        ----------------------------------------------------------------------
H4_TIGCA        ----------------------------------------------------------------------
H4_TETTH        ----------------------------------------------------------------------
H4_STYPL        ----------------------------------------------------------------------
H4_STYLE        ----------------------------------------------------------------------
H4_RHYAM        ----------------------------------------------------------------------
H4_RAT          ----------------------------------------------------------------------
H4_PONAB        ----------------------------------------------------------------------
H4_PLADU        ----------------------------------------------------------------------
H4_PIG          ----------------------------------------------------------------------
H4_OXYNO        ----------------------------------------------------------------------
H4_ORENI        ----------------------------------------------------------------------
H4_ONCMY        ----------------------------------------------------------------------
H4_OLILU        ----------------------------------------------------------------------
H4_OIKDI        ----------------------------------------------------------------------
H4_MYTTR        ----------------------------------------------------------------------
H4_MYTGA        ----------------------------------------------------------------------
H4_MYTED        ----------------------------------------------------------------------
H4_MYTCH        ----------------------------------------------------------------------
H4_MYTCA        ----------------------------------------------------------------------
H4_MYRRU        ----------------------------------------------------------------------
H4_MOUSE        ----------------------------------------------------------------------
H4_MACFA        ----------------------------------------------------------------------
H4_HUMAN        ----------------------------------------------------------------------
H4_DROYA        ----------------------------------------------------------------------
H4_DROTE        ----------------------------------------------------------------------
H4_DROSI        ----------------------------------------------------------------------
H4_DROSE        ----------------------------------------------------------------------
H4_DROOR        ----------------------------------------------------------------------
H4_DROME        ----------------------------------------------------------------------
H4_DROMA        ----------------------------------------------------------------------
H4_DROHY        ----------------------------------------------------------------------
H4_DROER        ----------------------------------------------------------------------
H4_DENKL        ----------------------------------------------------------------------
H4_CHLRE        ----------------------------------------------------------------------
H4_CHITH        ----------------------------------------------------------------------
H4_CHICK        ----------------------------------------------------------------------
H4_CHAVR        ----------------------------------------------------------------------
H4_CAIMO        ----------------------------------------------------------------------
H4_BOVIN        ----------------------------------------------------------------------
H4_ASEAQ        ----------------------------------------------------------------------
H4_ACRFO        ----------------------------------------------------------------------
H4_ACRAS        ----------------------------------------------------------------------
H42_TETPY       ----------------------------------------------------------------------
H41_TETPY       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHLD_SCHPO      ----------------------------------------------------------------------
CENPT_RAT       ----------------------------------------------------------------------
CENPT_MOUSE     ----------------------------------------------------------------------
CENPT_MACFA     ----------------------------------------------------------------------
CENPT_HUMAN     ----------------------------------------------------------------------
H4_CANGA        ----------------------------------------------------------------------
H4_YEAST        ----------------------------------------------------------------------
H41_BLEJA       ----------------------------------------------------------------------
H4_PHYPO        ----------------------------------------------------------------------
H4_ARXAD        ----------------------------------------------------------------------
H42_PENFN       ----------------------------------------------------------------------
H42_EMENI       ----------------------------------------------------------------------
H41_ASHGO       ----------------------------------------------------------------------
H4_SCHPO        ----------------------------------------------------------------------
H4_ENTHI        ----------------------------------------------------------------------
H4_MORAP        ----------------------------------------------------------------------
H4_VOLCA        ----------------------------------------------------------------------
H4_PYRSA        ----------------------------------------------------------------------
H4_NEUCR        ----------------------------------------------------------------------
H4_EUPCR        ----------------------------------------------------------------------
H4_ASPOR        ----------------------------------------------------------------------
H4_ASPFU        ----------------------------------------------------------------------
H48_CHICK       ----------------------------------------------------------------------
H42_BLEJA       ----------------------------------------------------------------------
H41_PENFN       ----------------------------------------------------------------------
H41_EMENI       ----------------------------------------------------------------------
H4_XENTR        ----------------------------------------------------------------------
H4_XENLA        ----------------------------------------------------------------------
H4_XENBO        ----------------------------------------------------------------------
H4_URECA        ----------------------------------------------------------------------
H4_TIGCA        ----------------------------------------------------------------------
H4_TETTH        ----------------------------------------------------------------------
H4_STYPL        ----------------------------------------------------------------------
H4_STYLE        ----------------------------------------------------------------------
H4_RHYAM        ----------------------------------------------------------------------
H4_RAT          ----------------------------------------------------------------------
H4_PONAB        ----------------------------------------------------------------------
H4_PLADU        ----------------------------------------------------------------------
H4_PIG          ----------------------------------------------------------------------
H4_OXYNO        ----------------------------------------------------------------------
H4_ORENI        ----------------------------------------------------------------------
H4_ONCMY        ----------------------------------------------------------------------
H4_OLILU        ----------------------------------------------------------------------
H4_OIKDI        ----------------------------------------------------------------------
H4_MYTTR        ----------------------------------------------------------------------
H4_MYTGA        ----------------------------------------------------------------------
H4_MYTED        ----------------------------------------------------------------------
H4_MYTCH        ----------------------------------------------------------------------
H4_MYTCA        ----------------------------------------------------------------------
H4_MYRRU        ----------------------------------------------------------------------
H4_MOUSE        ----------------------------------------------------------------------
H4_MACFA        ----------------------------------------------------------------------
H4_HUMAN        ----------------------------------------------------------------------
H4_DROYA        ----------------------------------------------------------------------
H4_DROTE        ----------------------------------------------------------------------
H4_DROSI        ----------------------------------------------------------------------
H4_DROSE        ----------------------------------------------------------------------
H4_DROOR        ----------------------------------------------------------------------
H4_DROME        ----------------------------------------------------------------------
H4_DROMA        ----------------------------------------------------------------------
H4_DROHY        ----------------------------------------------------------------------
H4_DROER        ----------------------------------------------------------------------
H4_DENKL        ----------------------------------------------------------------------
H4_CHLRE        ----------------------------------------------------------------------
H4_CHITH        ----------------------------------------------------------------------
H4_CHICK        ----------------------------------------------------------------------
H4_CHAVR        ----------------------------------------------------------------------
H4_CAIMO        ----------------------------------------------------------------------
H4_BOVIN        ----------------------------------------------------------------------
H4_ASEAQ        ----------------------------------------------------------------------
H4_ACRFO        ----------------------------------------------------------------------
H4_ACRAS        ----------------------------------------------------------------------
H42_TETPY       ----------------------------------------------------------------------
H41_TETPY       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
YHLD_SCHPO      ------------KRRYSKSSTLV--LPETNIRKLANSY------SQKKIAGSVIEELTTASELFFKQIAN
CENPT_RAT       ------------------------------------------------VEKAALEMVEKCLDEYFQRLCN
CENPT_MOUSE     ------------------------------------------------VEKTALEIVEKCLDKYFQHLCN
CENPT_MACFA     ------------------------------------------------MERKALEMVEKCLDKYFQHLCD
CENPT_HUMAN     ------------------------------------------------MERKALEMVEKCLDKYFQHLCD
H4_CANGA        ---------------------------QGITKPAIRRLARRGGVKRISIYEEVRAVLKS----FLESVIR
H4_YEAST        ---------------------------QGITKPAIRRLARRGGVKRISIYEEVRAVLKS----FLESVIR
H41_BLEJA       ---------------------------QGITKPAIRRLARRGGVKRT-LSGLVYDETRNVLKVFLENVVR
H4_PHYPO        ---------------------------QGITKPAIRRLARRGGVKR--ISNTIYEETRGVLKTFLENVIR
H4_ARXAD        ---------------------------QGITKPAIRRLARRGGVKR--ISALIYEETRSVLKTFLESVIR
H42_PENFN       ---------------------------QGITKPAIRRLARRGGVKRAMIYEETRGVLKS----FLESVIR
H42_EMENI       ---------------------------QGITKPAIRRLARRGGVKRAMIYEETRGVLKS----FLESVIR
H41_ASHGO       ---------------------------QGITKPAIRRLARRGGVKRISIYEDVRAVLKS----FLESVIR
H4_SCHPO        ---------------------------QGITKPAIRRLARRGGVKRISVYEETRAVLKL----FLENVIR
H4_ENTHI        ---------------------------KGITKPAIRRLARRGGVKR--INGAVYDETRNVLKQFLEQVIR
H4_MORAP        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRSVLKV----FLENVIR
H4_VOLCA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRTVLKN----FLENVIR
H4_PYRSA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRSVLKV----FLENVIR
H4_NEUCR        ---------------------------QGITKPAIRRLARRGGVKR--ISAMIYEETRGVLKTFLEGVIR
H4_EUPCR        ----------------------------GVTKPAIRRLARRGGVKR--ISSLVYEETRAVLKGFLESVIR
H4_ASPOR        ---------------------------QGITKPAIRRLARRGGVKR--ISAMIYEETRGVLKTFLEGVIR
H4_ASPFU        ---------------------------QGITKPAIRRLARRGGVKR--ISAMIYEETRGVLKTFLEGVIR
H48_CHICK       ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H42_BLEJA       ---------------------------QGITKPAIRRLARRGGVKRT-LSGLVYDETRNVLKVFLESVVR
H41_PENFN       ---------------------------QGITKPAIRRLARRGGVKR--ISAMIYEETRGVLKTFLEGVIR
H41_EMENI       ---------------------------QGITKPAIRRLARRGGVKR--ISAMIYEETRGVLKTFLEGVIR
H4_XENTR        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_XENLA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_XENBO        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_URECA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_TIGCA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_TETTH        ----------------------------GITKPAIRRLARRGGVKR--ISSFIYDDSRQVLKSFLENVVR
H4_STYPL        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_STYLE        ----------------------------GITKPAIRRLARRGGVKR--ISSLIYEETRNVLRSFLENVIR
H4_RHYAM        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_RAT          ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_PONAB        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_PLADU        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_PIG          ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_OXYNO        ----------------------------GITKPAIRRLARRGGVKR--ISSLIYEETRNVLRSFLENVIR
H4_ORENI        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_ONCMY        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_OLILU        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_OIKDI        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYTTR        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYTGA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYTED        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYTCH        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYTCA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MYRRU        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MOUSE        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_MACFA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_HUMAN        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROYA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROTE        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROSI        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROSE        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROOR        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROME        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROMA        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROHY        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DROER        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_DENKL        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_CHLRE        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRTVLKT----FLENVIR
H4_CHITH        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_CHICK        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_CHAVR        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_CAIMO        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_BOVIN        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_ASEAQ        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_ACRFO        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H4_ACRAS        ---------------------------QGITKPAIRRLARRGGVKRISIYEETRGVLKV----FLENVIR
H42_TETPY       ----------------------------GITKPAIRRLARRGGVKR--ISSFIYDDSRQVLKSFLENVVR
H41_TETPY       ----------------------------GITKPAIRRLARRGGVKR--ISSFIYDDSRQVLKSFLENVVR


                         .         .         +         .         .         .         .:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQKYLPKELLQDIxxxxx
YHLD_SCHPO      DLSAFADHAHRKTIDTQDVVLLMKRQRKISEKKSLSSLMQQYLSREI---------
CENPT_RAT       DLEVFAAHAGRKTVKPKDLELLMRRQGLVTDQVSLHVLVERYLPLEYRQQL-----
CENPT_MOUSE     DLEVFASHAGRKIVKPEDLLLLMRRQGLVTDQVSQHVLVERYLPLEYRQQL-----
CENPT_MACFA     DLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQ-------
CENPT_HUMAN     DLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQ-------
H4_CANGA        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_YEAST        DSVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H41_BLEJA       DAVTYTEHARRKTVTALDVVYALKRQ------------------------------
H4_PHYPO        DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_ARXAD        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H42_PENFN       DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H42_EMENI       DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H41_ASHGO       DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_SCHPO        DAVTYTEHAKRKTVTSLDVVYSLKRQ------------------------------
H4_ENTHI        DSVTYTEHAKRRTVTAMDVVYALKRQ------------------------------
H4_MORAP        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_VOLCA        DSVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_PYRSA        DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_NEUCR        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_EUPCR        DSVTYTEHAKRKTVTALDVVYALKRQ------------------------------
H4_ASPOR        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_ASPFU        DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H48_CHICK       DAVTYTEHAKRKTVTAMDVVYALKRQER----------------------------
H42_BLEJA       DAVTYTEHAKRETVTALDVVYALKRQ------------------------------
H41_PENFN       DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H41_EMENI       DAVTYTEHAKRKTVTSLDVVYALKRQ------------------------------
H4_XENTR        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_XENLA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_XENBO        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_URECA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_TIGCA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_TETTH        DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_STYPL        DAVTYTEHAKRKTVTALDVVYALKRQ------------------------------
H4_STYLE        DSVTYTEHAKRKTVTALDVVYALKRQ------------------------------
H4_RHYAM        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_RAT          DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_PONAB        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_PLADU        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_PIG          DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_OXYNO        DSVTYTEHAKRKTVTALDVVYALKRQ------------------------------
H4_ORENI        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_ONCMY        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_OLILU        DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_OIKDI        DAVTYTEHAKRKTVTALDVVYALKRQ------------------------------
H4_MYTTR        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MYTGA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MYTED        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MYTCH        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MYTCA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MYRRU        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MOUSE        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_MACFA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_HUMAN        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROYA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROTE        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROSI        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROSE        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROOR        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROME        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROMA        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROHY        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DROER        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_DENKL        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_CHLRE        DSVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H4_CHITH        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_CHICK        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_CHAVR        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_CAIMO        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_BOVIN        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_ASEAQ        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_ACRFO        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H4_ACRAS        DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
H42_TETPY       DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------
H41_TETPY       DAVTYTEHARRKTVTAMDVVYALKRQ------------------------------