[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00708

[Show Plain Result]


## Summary of Sequence Search
    1::693
   40::74      2e-09  63%  419 aa  YOG2_SCHPO RecName: Full=Uncharacterized transcriptional regulatory
  626::659     5e-08  56% 1862 aa  ATG2_PICPA RecName: Full=Autophagy-related protein 2;AltName:
   35::64      8e-08  63%  497 aa  MOC3_SCHPO RecName: Full=Transcriptional regulatory protein
  151::186     4e-06  47%  790 aa  LYS14_YEAST RecName: Full=Lysine biosynthesis regulatory protein
    5::43      6e-06  44%  594 aa  YGDC_SCHPO RecName: Full=Uncharacterized transcriptional regulatory
   19::69      7e-06  44%  880 aa  ARGR2_YEAST RecName: Full=Arginine metabolism regulation protein
   13::48      2e-05  47%  525 aa  YCUA_SCHPO RecName: Full=Uncharacterized transcriptional regulatory
   49::83      4e-05  49%  696 aa  PRO1_NEUCR RecName: Full=Transcriptional regulatory protein pro-1;
   65::152     8e-05  31% 1060 aa  UAY_EMENI RecName: Full=Positive regulator of purine utilization;
    7::73      1e-04  31%  832 aa  YCZ6_YEAST RecName: Full=Uncharacterized transcriptional regulatory
   29::62      1e-04  56%  892 aa  NIRA_EMENI RecName: Full=Nitrogen assimilation transcription factor
   25::70      1e-04  35%  450 aa  THI2_YEAST RecName: Full=Thiamine biosynthesis regulatory protein;
   56::87      1e-04  44% 1483 aa  HAP1_YEAST RecName: Full=Heme-responsive zinc finger transcription
   40::94      2e-04  42%  825 aa  QUTA_EMENI RecName: Full=Quinic acid utilization activator;
   26::61      3e-04  42%  979 aa  PUT3_YEAST RecName: Full=Proline utilization trans-activator;
   39::80      4e-04  40%  829 aa  SIP4_YEAST RecName: Full=Protein SIP4;
   41::152     5e-04  36%  435 aa  PFA4_EMENI RecName: Full=Palmitoyltransferase pfa4;       
   31::61      7e-04  42%  904 aa  PPR1_YEAST RecName: Full=Pyrimidine pathway regulatory protein 1;
   17::52      9e-04  39%  996 aa  PIP2_YEAST RecName: Full=Peroxisome proliferation transcriptional
    1::693

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxDAPKSKRVRTGCLTCRERHLKCDETLPRCQNCQKSDRLCKRGVRLNFIDTQVAAPPYA
YOG2_SCHPO      -----------------KRTKTGCLTCRKRRIKCDERKPICYNCIKSKRQCE------------------
ATG2_PICPA      -----------------KSTNSGCLTCRKRQVKCDERKPFCLNCEKSEQKC-------------------
MOC3_SCHPO      ----------------------GCLTCRRRRIKCDETKPFCLNCTKTNRECE------------------
LYS14_YEAST     ---------------KRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC-------------------
YGDC_SCHPO      -----------------KKISTACDLCRQRKLRCNGELPKCQNCVVYSETCKYNKR--------------
ARGR2_YEAST     ---------------------TGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGYDIKLRW-SKPMQFDPYG
YCUA_SCHPO      ---------------KKPRSRYGCLICRSMRKKCDEVHPQCGRCLKAGKQC-------------------
PRO1_NEUCR      -----------------RRSRTGCYTCRLRRKKCDEGSPMCTACKHLGLCCE------------------
UAY_EMENI       ---------------------SACNRCRQRKNRCDQRLPRCQACEKADPITKREIPRSYVYFLESRVAYL
YCZ6_YEAST      ---------------KKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYEERTDLSANVAANDSDG
NIRA_EMENI      ------------NAPASKRVSTACIACRRRKSKCDGNLPSCAAC--------------------------
THI2_YEAST      ------------------RTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRLMWLEENI------
HAP1_YEAST      ---------------KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKT-----------------------
QUTA_EMENI      --------------PKRQRVSRACDSCRSKKDKCDGAQPICSTCASLSRPCKRGLPTGYIRT--------
PUT3_YEAST      ---------------RQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAICE------------------
SIP4_YEAST      ----------------SVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLS------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      --------------------RTACKRCRLKKIKCDQEFPSCKRCAKLEVPC-------------------
PIP2_YEAST      ---------------KRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-------------------


                         +         .         .         .         .         *         .:210
query           VPSSHDWQVNFHDESREIASEYLGGYERYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     VP--------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       EKVLMDNGIEYNEADEEEAVKIEAGYEAY-----------------------------------------
YCZ6_YEAST      FNSSH--KLNFEQQ--------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDEEFW
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      -----------------------------------------------------------------EDEVW
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           THRMLYICAKIANYRATMAYQGLDRSSHDPRLNQRCEEWNALRAWCDEWARCAPRSMMPLGYLHPWETNS
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      RINILAICIWICYYRACTVDPGADRASGRQRWCRRCEAYKPPRAHCKTCERCVPK----MDHHCPWTSNS
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KSSFPEVWLIKRSAVVGRLFYHTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      HFTFPHFARFLFYAVVGIAYLET-----------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ----------------------------------------------------------------------
ATG2_PICPA      ----------------------------------------------------------------------
MOC3_SCHPO      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
YGDC_SCHPO      ----------------------------------------------------------------------
ARGR2_YEAST     ----------------------------------------------------------------------
YCUA_SCHPO      ----------------------------------------------------------------------
PRO1_NEUCR      ----------------------------------------------------------------------
UAY_EMENI       ----------------------------------------------------------------------
YCZ6_YEAST      ----------------------------------------------------------------------
NIRA_EMENI      ----------------------------------------------------------------------
THI2_YEAST      ----------------------------------------------------------------------
HAP1_YEAST      ----------------------------------------------------------------------
QUTA_EMENI      ----------------------------------------------------------------------
PUT3_YEAST      ----------------------------------------------------------------------
SIP4_YEAST      ----------------------------------------------------------------------
PFA4_EMENI      ----------------------------------------------------------------------
PPR1_YEAST      ----------------------------------------------------------------------
PIP2_YEAST      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YOG2_SCHPO      ---------------------------------------------------------------
ATG2_PICPA      ---------------------------------------------------------------
MOC3_SCHPO      ---------------------------------------------------------------
LYS14_YEAST     ---------------------------------------------------------------
YGDC_SCHPO      ---------------------------------------------------------------
ARGR2_YEAST     ---------------------------------------------------------------
YCUA_SCHPO      ---------------------------------------------------------------
PRO1_NEUCR      ---------------------------------------------------------------
UAY_EMENI       ---------------------------------------------------------------
YCZ6_YEAST      ---------------------------------------------------------------
NIRA_EMENI      ---------------------------------------------------------------
THI2_YEAST      ---------------------------------------------------------------
HAP1_YEAST      ---------------------------------------------------------------
QUTA_EMENI      ---------------------------------------------------------------
PUT3_YEAST      ---------------------------------------------------------------
SIP4_YEAST      ---------------------------------------------------------------
PFA4_EMENI      ---------------------------------------------------------------
PPR1_YEAST      ---------------------------------------------------------------
PIP2_YEAST      ---------------------------------------------------------------