[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00735

[Show Plain Result]


## Summary of Sequence Search
    1::505
 1508::1555    4e-05  38% 1597 aa  ARHG5_HUMAN RecName: Full=Rho guanine nucleotide exchange factor
  440::524     6e-05  32%  892 aa  SH3R1_MOUSE RecName: Full=Putative E3 ubiquitin-protein ligase
  465::511     8e-05  38%  882 aa  SH3R3_HUMAN RecName: Full=SH3 domain-containing RING finger protein
  488::542     8e-05  41%  574 aa  FUT8_PONAB RecName: Full=Alpha-(1,6)-fucosyltransferase;       
  489::543     8e-05  41%  575 aa  FUT8_PANTR RecName: Full=Alpha-(1,6)-fucosyltransferase;       
  489::543     8e-05  41%  575 aa  FUT8_HUMAN RecName: Full=Alpha-(1,6)-fucosyltransferase;       
  459::505     2e-04  38%  878 aa  SH3R3_MOUSE RecName: Full=SH3 domain-containing RING finger protein
  407::479     2e-04  37%  861 aa  SH3R1_XENTR RecName: Full=Putative E3 ubiquitin-protein ligase
  489::543     3e-04  39%  575 aa  FUT8_CANFA RecName: Full=Alpha-(1,6)-fucosyltransferase;       
   60::107     3e-04  48%  692 aa  CA113_MACFA RecName: Full=SH3 domain-containing protein C1orf113
   60::107     4e-04  48%  640 aa  CA113_HUMAN RecName: Full=SH3 domain-containing protein C1orf113;
  489::543     6e-04  37%  575 aa  FUT8_BOVIN RecName: Full=Alpha-(1,6)-fucosyltransferase;       
  682::715     8e-04  41%  733 aa  VINEX_MOUSE RecName: Full=Vinexin;AltName: Full=Sorbin and SH3
  620::653     8e-04  41%  671 aa  VINEX_HUMAN RecName: Full=Vinexin;AltName: Full=Sorbin and SH3
  386::442     8e-04  37%  826 aa  SH3R1_XENLA RecName: Full=Putative E3 ubiquitin-protein ligase
  443::523     8e-04  30%  894 aa  SH3R1_RAT RecName: Full=Putative E3 ubiquitin-protein ligase
    1::505

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     ----------------------------------------------------------------------
SH3R1_MOUSE     ----------------------------------------------------------------------
SH3R3_HUMAN     ----------------------------------------------------------------------
FUT8_PONAB      ----------------------------------------------------------------------
FUT8_PANTR      ----------------------------------------------------------------------
FUT8_HUMAN      ----------------------------------------------------------------------
SH3R3_MOUSE     ----------------------------------------------------------------------
SH3R1_XENTR     ----------------------------------------------------------------------
FUT8_CANFA      ----------------------------------------------------------------------
CA113_MACFA     ----------------------------------------------------------------------
CA113_HUMAN     ----------------------------------------------------------------------
FUT8_BOVIN      ----------------------------------------------------------------------
VINEX_MOUSE     ----------------------------------------------------------------------
VINEX_HUMAN     ----------------------------------------------------------------------
SH3R1_XENLA     ----------------------------------------------------------------------
SH3R1_RAT       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     ----------------------------------------------------------------------
SH3R1_MOUSE     ----------------------------------------------------------------------
SH3R3_HUMAN     ----------------------------------------------------------------------
FUT8_PONAB      ----------------------------------------------------------------------
FUT8_PANTR      ----------------------------------------------------------------------
FUT8_HUMAN      ----------------------------------------------------------------------
SH3R3_MOUSE     ----------------------------------------------------------------------
SH3R1_XENTR     ----------------------------------------------------------------------
FUT8_CANFA      ----------------------------------------------------------------------
CA113_MACFA     ----------------------------------------------------------------------
CA113_HUMAN     ----------------------------------------------------------------------
FUT8_BOVIN      ----------------------------------------------------------------------
VINEX_MOUSE     ----------------------------------------------------------------------
VINEX_HUMAN     ----------------------------------------------------------------------
SH3R1_XENLA     ----------------------------------------------------------------------
SH3R1_RAT       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     ----------------------------------------------------------------------
SH3R1_MOUSE     ----------------------------------------------------------------------
SH3R3_HUMAN     ----------------------------------------------------------------------
FUT8_PONAB      ----------------------------------------------------------------------
FUT8_PANTR      ----------------------------------------------------------------------
FUT8_HUMAN      ----------------------------------------------------------------------
SH3R3_MOUSE     ----------------------------------------------------------------------
SH3R1_XENTR     ----------------------------------------------------------------------
FUT8_CANFA      ----------------------------------------------------------------------
CA113_MACFA     ----------------------------------------------------------------------
CA113_HUMAN     ----------------------------------------------------------------------
FUT8_BOVIN      ----------------------------------------------------------------------
VINEX_MOUSE     ----------------------------------------------------------------------
VINEX_HUMAN     ----------------------------------------------------------------------
SH3R1_XENLA     ----------------------------------------------------------------------
SH3R1_RAT       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     ----------------------------------------------------------------------
SH3R1_MOUSE     ----------------------------------------------------------------------
SH3R3_HUMAN     ----------------------------------------------------------------------
FUT8_PONAB      ----------------------------------------------------------------------
FUT8_PANTR      ----------------------------------------------------------------------
FUT8_HUMAN      ----------------------------------------------------------------------
SH3R3_MOUSE     ----------------------------------------------------------------------
SH3R1_XENTR     ----------------------------------------------------------------------
FUT8_CANFA      ----------------------------------------------------------------------
CA113_MACFA     ----------------------------------------------------------------------
CA113_HUMAN     ----------------------------------------------------------------------
FUT8_BOVIN      ----------------------------------------------------------------------
VINEX_MOUSE     ----------------------------------------------------------------------
VINEX_HUMAN     ----------------------------------------------------------------------
SH3R1_XENLA     ----------------------------------------------------------------------
SH3R1_RAT       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     ----------------------------------------------------------------------
SH3R1_MOUSE     ----------------------------------------------------------------------
SH3R3_HUMAN     ----------------------------------------------------------------------
FUT8_PONAB      ----------------------------------------------------------------------
FUT8_PANTR      ----------------------------------------------------------------------
FUT8_HUMAN      ----------------------------------------------------------------------
SH3R3_MOUSE     ----------------------------------------------------------------------
SH3R1_XENTR     ----------------------------------------------------------------------
FUT8_CANFA      ----------------------------------------------------------------------
CA113_MACFA     ----------------------------------------------------------------------
CA113_HUMAN     ----------------------------------------------------------------------
FUT8_BOVIN      ----------------------------------------------------------------------
VINEX_MOUSE     ----------------------------------------------------------------------
VINEX_HUMAN     ----------------------------------------------------------------------
SH3R1_XENLA     ----------------------------------------------------------------------
SH3R1_RAT       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxTSPKSGSGAQFSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD
ARHG5_HUMAN     ------------------------------------------ECYNSPQVQCLRAYKPRENDELALEKAD
SH3R1_MOUSE     --------------------------GSSEQIAHLRP-----QTRPSVYVAI-YPYTPRKEDELELRKGE
SH3R3_HUMAN     ---------------------------------------------PLNVYLALYAYKPQKSDELELHKGE
FUT8_PONAB      ------------------------------------NFHSLDDIYAHNQIAI-YAHQPRTADEIPMEPGD
FUT8_PANTR      ------------------------------------NFHSLDDIYAHNQIAI-YAHQPRTADEIPMEPGD
FUT8_HUMAN      ------------------------------------NFHSLDDIYAHNQIAI-YAHQPRTADEIPMEPGD
SH3R3_MOUSE     ---------------------------------------------PLNVYLALYAYKPQKNDELELRKGE
SH3R1_XENTR     -------TSTSSGAAA---AVQRSISGPAEQVTHLRT-----STRPSVFVAI-YPYIPRKEDELELRKGE
FUT8_CANFA      ------------------------------------NFHSLDDIYAHNQIAI-YPHQPRTADEIPMEPGD
CA113_MACFA     --------------------------------------YLQTVSHP-EAYRVLFDYQPEAPDELTLRRGD
CA113_HUMAN     --------------------------------------YLQTVSHP-EVYRVLFDYQPEAPDELALRRGD
FUT8_BOVIN      ------------------------------------NFHSLDDIYAHNQIAI-YPHEPRTADEIPMEPGD
VINEX_MOUSE     ----------------------------------------------------MYQYRPQNEDELELREGD
VINEX_HUMAN     ----------------------------------------------------MYQYRPQNEDELELREGD
SH3R1_XENLA     --------------------------GPVEQVPHLRT-----SARPSVFIAI-YPYIPRKEDELELRKGE
SH3R1_RAT       ----------------------------TEQIAHLRP-----QTRPSVYVAI-YPYTPRKEDELELRKGE


                         .         .         +         .         .         .         .:490
query           MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGVSNGTDRRGSxxxxxxxxxxxxxxxxxxxxxxxx
ARHG5_HUMAN     VVMVTQQSSDGWLEGVRLSD--------------------------------------------------
SH3R1_MOUSE     MFLVFERCQDGWYKGTSMHTSIGVFPGNYVAPVTRAVTNASQAKVS------------------------
SH3R3_HUMAN     MYRVLEKCQDGWFKGASLRTGV------------------------------------------------
FUT8_PONAB      IIGVAGNHWDGYSKGV------------------------------------------------------
FUT8_PANTR      IIGVAGNHWDGYSKGV------------------------------------------------------
FUT8_HUMAN      IIGVAGNHWDGYSKGV------------------------------------------------------
SH3R3_MOUSE     MYRVLEKCQDGWFKGASLKTGV------------------------------------------------
SH3R1_XENTR     MFLVFERCQDGWFKGTSMH---------------------------------------------------
FUT8_CANFA      IIGVAGNHWDGYSKGV------------------------------------------------------
CA113_MACFA     VVKVLSTEDKGWWEG-------------------------------------------------------
CA113_HUMAN     VVKVLSTEDKGWWEG-------------------------------------------------------
FUT8_BOVIN      IIGVAGNHWDGYSKGV------------------------------------------------------
VINEX_MOUSE     RVDVMQQCDDGWFVGV------------------------------------------------------
VINEX_HUMAN     RVDVMQQCDDGWFVGV------------------------------------------------------
SH3R1_XENLA     MFLVFERCQDGWFKGTSMH---------------------------------------------------
SH3R1_RAT       MFLVFERCQDGWYKGTSMHTSIGVFPGNYVAPVTRAVTNASQAK--------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxx
ARHG5_HUMAN     ---------------
SH3R1_MOUSE     ---------------
SH3R3_HUMAN     ---------------
FUT8_PONAB      ---------------
FUT8_PANTR      ---------------
FUT8_HUMAN      ---------------
SH3R3_MOUSE     ---------------
SH3R1_XENTR     ---------------
FUT8_CANFA      ---------------
CA113_MACFA     ---------------
CA113_HUMAN     ---------------
FUT8_BOVIN      ---------------
VINEX_MOUSE     ---------------
VINEX_HUMAN     ---------------
SH3R1_XENLA     ---------------
SH3R1_RAT       ---------------