[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00742

[Show Plain Result]


## Summary of Sequence Search
    1::241
   66::217     7e-36  56%  231 aa  PDX3_SCHPO RecName: Full=Probable pyridoxamine 5'-phosphate
   65::228     9e-36  53%  228 aa  PDX3_YEAST RecName: Full=Pyridoxamine 5'-phosphate oxidase;        
   55::214     7e-35  51%  214 aa  PDXH_CYAP7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     2e-34  57%  211 aa  PDXH_MARAV RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::213     8e-34  56%  213 aa  PDXH_BURXL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::217     1e-33  53%  217 aa  PDXH_PSYIN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::213     2e-33  56%  213 aa  PDXH_BURPP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   96::222     2e-33  56%  222 aa  PDXH_SACEN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURPS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURP6 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURP1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURP0 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURMS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURMA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURM9 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-33  57%  214 aa  PDXH_BURM7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     4e-33  52%  215 aa  PDXH_PSEPG RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     5e-33  55%  214 aa  PDXH_BURTA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     9e-33  55%  214 aa  PDXH_BURVG RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   70::216     2e-32  53%  267 aa  PDXH_FRASC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     3e-32  52%  215 aa  PDXH_PSEPW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     3e-32  54%  214 aa  PDXH_BURS3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     3e-32  55%  214 aa  PDXH_BURCJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     3e-32  56%  214 aa  PDXH_BURCH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     3e-32  56%  214 aa  PDXH_BURCA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     3e-32  56%  214 aa  PDXH_BURCC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::212     5e-32  53%  212 aa  PDXH_RALPJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     5e-32  51%  215 aa  PDXH_PSEPK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     5e-32  51%  215 aa  PDXH_PSEP1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     5e-32  51%  214 aa  PDXH_NOSP7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::213     5e-32  50%  213 aa  PDXH_CYAP4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     5e-32  56%  214 aa  PDXH_BURM1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::212     5e-32  53%  212 aa  PDXH1_RALSO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     8e-32  53%  215 aa  PDXH_PSEPF RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     8e-32  55%  215 aa  PDXH_PSEMY RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     1e-31  54%  214 aa  PDXH_BURCM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     1e-31  54%  214 aa  PDXH_BURA4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     1e-31  49%  214 aa  PDXH_ANAVT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     1e-31  49%  214 aa  PDXH_MICAN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-31  54%  212 aa  PDXH_CUPTR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     2e-31  49%  214 aa  PDXH_ANASP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     3e-31  50%  215 aa  PDXH_PSE14 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   82::241     4e-31  50%  241 aa  PDXH_FRAAA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::221     5e-31  51%  221 aa  PDXH_SALAI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     1e-30  55%  212 aa  PDXH_RALEH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     1e-30  50%  215 aa  PDXH_PSEE4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   66::224     2e-30  48%  224 aa  PDXH_STRAW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     2e-30  48%  215 aa  PDXH_PSESM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::214     3e-30  48%  214 aa  PDXH_SYNY3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::215     4e-30  51%  215 aa  PDXH_SALRD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     6e-30  49%  215 aa  PDXH_PSEU2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     7e-30  53%  212 aa  PDXH_RALEJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::210     7e-30  54%  210 aa  PDXH_BORA1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   73::227     1e-29  51%  227 aa  PNPO_DICDI RecName: Full=Pyridoxine-5'-phosphate oxidase;       
   59::206     3e-29  51%  215 aa  PDXH_PSEAE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::206     3e-29  51%  215 aa  PDXH_PSEAB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     8e-29  51%  212 aa  PDXH_BURP8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     1e-28  54%  210 aa  PDXH_BORPD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::201     2e-28  51%  215 aa  PDXH_PSEFS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   66::219     2e-28  49%  219 aa  PDXH_ACAM1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::215     4e-28  48%  215 aa  PDXH_PSEF5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  104::225     9e-28  54%  225 aa  PDXH_NOCFA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::217     1e-27  50%  217 aa  PDXH_RUBXD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::201     1e-27  50%  215 aa  PDXH_PSEU5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::212     2e-27  49%  212 aa  PDXH_CYAP8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   74::234     2e-27  45%  234 aa  PDXH_STRCO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::200     2e-27  51%  220 aa  PDXH_RHOFD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     2e-27  53%  210 aa  PDXH_BORPE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     2e-27  53%  210 aa  PDXH_BORPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     2e-27  53%  210 aa  PDXH_BORBR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::223     3e-27  45%  223 aa  PDXH_RHOBA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     3e-27  51%  212 aa  PDXH_RALME RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  107::213     3e-27  52%  224 aa  PDXH_MYCTU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  107::213     3e-27  52%  224 aa  PDXH_MYCTA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  101::219     3e-27  51%  230 aa  PDXH_MYCS2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  107::213     3e-27  52%  224 aa  PDXH_MYCBT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  107::213     3e-27  52%  224 aa  PDXH_MYCBP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  107::213     3e-27  52%  224 aa  PDXH_MYCBO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::214     1e-26  49%  214 aa  PDXH_CYAA5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::190     1e-26  51%  195 aa  PDXH_MAGSA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::201     1e-26  49%  215 aa  PDXH_AZOVD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::209     1e-26  49%  209 aa  PDXH_ACTPJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   61::201     2e-26  52%  216 aa  PDXH_POLSJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::212     4e-26  46%  212 aa  PDXH_RUTMC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::200     5e-26  47%  209 aa  PDXH_MYCSJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   47::192     5e-26  48%  206 aa  PDXH_AGRT5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::211     6e-26  48%  220 aa  PDXH_MYCSS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::211     6e-26  48%  220 aa  PDXH_MYCSK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     6e-26  53%  218 aa  PDXH_ENTS8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   61::218     8e-26  50%  218 aa  PDXH_ESCF3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     8e-26  53%  218 aa  PDXH_ERWT9 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   69::211     1e-25  48%  222 aa  PDXH_MYCVP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::213     1e-25  49%  213 aa  PDXH_METPP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::209     1e-25  48%  209 aa  PDXH_ACTP2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   70::210     1e-25  55%  225 aa  PDXH_ACIAC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   44::188     2e-25  51%  200 aa  PDXH_SPHWW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   46::192     2e-25  48%  206 aa  PDXH_RHIME RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::200     2e-25  50%  215 aa  PDXH_POLNA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::209     2e-25  48%  209 aa  PDXH_ACTP7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_SHIFL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_SHIF8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_SHIDS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_SHIBS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-25  47%  212 aa  PDXH_LEPBP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-25  47%  212 aa  PDXH_LEPBA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOSM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOLU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOLI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOLC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOHS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECODH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECOBW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECO7I RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     2e-25  50%  218 aa  PDXH_ECO27 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::200     2e-25  46%  208 aa  PDXH_BRUSU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::195     2e-25  46%  203 aa  PDXH_BRUSI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::200     2e-25  46%  208 aa  PDXH_BRUME RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::195     2e-25  46%  203 aa  PDXH_BRUMB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::195     2e-25  46%  203 aa  PDXH_BRUC2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::200     2e-25  46%  208 aa  PDXH_BRUAB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::200     2e-25  46%  208 aa  PDXH_BRUA2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::195     2e-25  46%  203 aa  PDXH_BRUA1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     2e-25  49%  211 aa  PDXH_AERS4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   63::217     2e-25  52%  217 aa  PDXH_ACISJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   46::192     3e-25  48%  206 aa  PDXH_RHISN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   65::208     3e-25  48%  219 aa  PDXH_MYCLE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   42::200     3e-25  47%  200 aa  PDXH_GLUOX RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     3e-25  51%  218 aa  PDXH_ECO24 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::192     3e-25  47%  196 aa  PDXH_BDEBA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_SHISS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_SHIB3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   65::207     4e-25  46%  218 aa  PDXH_MYCGI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECOUT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECOSE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECOL6 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECOL5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECOK1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECO8A RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECO81 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECO55 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     4e-25  51%  218 aa  PDXH_ECO45 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::200     4e-25  46%  208 aa  PDXH_BRUO2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::204     5e-25  47%  216 aa  PDXH_SPHAL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     5e-25  47%  210 aa  PDXH_HAEIN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     5e-25  47%  210 aa  PDXH_HAEI8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   71::227     5e-25  52%  227 aa  PDXH_ERWCT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     5e-25  50%  218 aa  PDXH_ECO5E RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     5e-25  50%  218 aa  PDXH_ECO57 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   61::200     5e-25  47%  217 aa  PDXH_COLP3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   50::199     7e-25  46%  209 aa  PDXH_MESSB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     7e-25  50%  218 aa  PDXH_KLEP7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   38::188     7e-25  48%  196 aa  PDXH_ALHEH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::192     7e-25  46%  206 aa  PDXH_AGRRK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     7e-25  49%  211 aa  PDXH_AERHH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::204     9e-25  50%  212 aa  PDXH_VEREI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   65::209     9e-25  46%  220 aa  PDXH_MYCPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::196     9e-25  46%  207 aa  PDXH_MYCA1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   61::218     9e-25  51%  218 aa  PDXH_CITK8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     1e-24  46%  211 aa  PDXH_TERTT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALTY RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALTI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALSV RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALPK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALPC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALPB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALNS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALHS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALG2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALEP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALDC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALCH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::218     1e-24  50%  218 aa  PDXH_SALA4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::198     1e-24  46%  212 aa  PDXH_DICNV RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::211     2e-24  49%  211 aa  PDXH_VIBVY RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::211     2e-24  49%  211 aa  PDXH_VIBVU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     2e-24  49%  211 aa  PDXH_POLSQ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::203     2e-24  45%  203 aa  PDXH_OCHA4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::215     2e-24  46%  215 aa  PDXH_CHRSD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::192     2e-24  46%  206 aa  PDXH_RHIEC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     3e-24  51%  217 aa  PDXH_PROMH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::196     3e-24  51%  214 aa  PDXH_LEPBL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::196     3e-24  51%  214 aa  PDXH_LEPBJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   67::218     3e-24  51%  218 aa  PDXH_ENT38 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::215     3e-24  45%  215 aa  PDXH_CYTH3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::218     3e-24  46%  218 aa  PDXH_SHELP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     5e-24  48%  212 aa  PDXH_SHESR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::198     5e-24  44%  206 aa  PDXH_RHIL3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::199     6e-24  47%  211 aa  PDXH_THEEB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::201     8e-24  45%  215 aa  PDXH_PSEA7 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::202     8e-24  49%  211 aa  PDXH_LEPCP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   41::196     8e-24  46%  196 aa  PDXH_COXBU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   90::261     1e-23  45%  261 aa  PNPO_BOVIN RecName: Full=Pyridoxine-5'-phosphate oxidase;       
   48::192     1e-23  46%  205 aa  PDXH_RHILO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::215     1e-23  43%  215 aa  PDXH_BARBK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::221     1e-23  45%  221 aa  PDXH_THEFY RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     1e-23  49%  212 aa  PDXH_SHEAM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   38::187     1e-23  50%  201 aa  PDXH_RHORT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::192     1e-23  46%  206 aa  PDXH_RHIE6 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::202     1e-23  46%  212 aa  PDXH_AZOC5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::212     1e-23  46%  212 aa  PDXH_ARCB4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     2e-23  48%  211 aa  PDXH_VIBPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  47%  212 aa  PDXH_SHESM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  47%  212 aa  PDXH_SHEB9 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  47%  212 aa  PDXH_SHEB8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  47%  212 aa  PDXH_SHEB5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  47%  212 aa  PDXH_SHEB2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     2e-23  49%  217 aa  PDXH_SERP5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     2e-23  48%  212 aa  PDXH_SACD2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   64::224     2e-23  48%  224 aa  PDXH_ACIC1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   47::192     2e-23  43%  207 aa  PDXH_BARQU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   50::191     2e-23  45%  206 aa  PDXH_ANAPZ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     3e-23  47%  212 aa  PDXH_SHESA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::192     3e-23  44%  206 aa  PDXH_RHILW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::222     3e-23  44%  222 aa  PDXH_PROMM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::222     3e-23  44%  222 aa  PDXH_PROM3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     4e-23  47%  211 aa  PDXH_VIBFM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     4e-23  47%  211 aa  PDXH_VIBF1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   63::208     4e-23  49%  222 aa  PDXH_MARMM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     4e-23  47%  217 aa  PDXH_EDWI9 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::212     5e-23  44%  212 aa  PDXH_ALTMD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::213     5e-23  44%  213 aa  PDXH2_THICR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     7e-23  46%  212 aa  PDXH_SHESW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     7e-23  46%  212 aa  PDXH_SHEON RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   49::208     7e-23  46%  208 aa  PDXH_PARL1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   66::213     7e-23  45%  222 aa  PDXH_CAUCR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   66::213     7e-23  45%  222 aa  PDXH_CAUCN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   90::261     9e-23  44%  261 aa  PNPO_HUMAN RecName: Full=Pyridoxine-5'-phosphate oxidase;       
   39::184     9e-23  49%  199 aa  PDXH_XANAC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::216     9e-23  47%  216 aa  PDXH_SODGM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     1e-22  47%  211 aa  PDXH_VIBHB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::198     1e-22  46%  213 aa  PDXH_CHRVO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERPS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERPN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERPG RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERPE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  49%  217 aa  PDXH_YERP3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     1e-22  48%  217 aa  PDXH_YERE8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     1e-22  46%  211 aa  PDXH_PHOPR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::184     2e-22  48%  199 aa  PDXH_XANC5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   46::187     2e-22  47%  201 aa  PDXH_HALHL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   53::213     2e-22  46%  213 aa  PDXH_XANP2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::184     2e-22  48%  199 aa  PDXH_XANOR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::184     2e-22  48%  199 aa  PDXH_XANOM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::184     2e-22  48%  199 aa  PDXH_XANCP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   39::184     2e-22  48%  199 aa  PDXH_XANC8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::213     2e-22  46%  213 aa  PDXH_SHEWM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::212     2e-22  45%  212 aa  PDXH_SHEDO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   90::261     3e-22  43%  261 aa  PNPO_MOUSE RecName: Full=Pyridoxine-5'-phosphate oxidase;       
   54::212     3e-22  47%  212 aa  PDXH_PSEHT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     4e-22  46%  212 aa  PDXH_SHEPC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   40::186     4e-22  44%  194 aa  PDXH_EHRRW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   40::186     4e-22  44%  194 aa  PDXH_EHRRG RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     4e-22  47%  211 aa  PDXH_ALISL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     6e-22  46%  211 aa  PDXH_VIBSL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::184     6e-22  44%  199 aa  PDXH_EHRCR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::205     6e-22  47%  218 aa  PDXH_ANAMM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   90::261     9e-22  42%  261 aa  PNPO_RAT RecName: Full=Pyridoxine-5'-phosphate oxidase;       
   56::213     9e-22  42%  213 aa  PDXH_PSEA6 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   47::207     9e-22  42%  207 aa  PDXH_BARHE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   47::192     9e-22  43%  206 aa  PDXH_AGRVS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   46::192     1e-21  47%  206 aa  PDXH_SINMW RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     1e-21  45%  212 aa  PDXH_SHEFN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::213     1e-21  43%  214 aa  PDXH_FLAJ1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   90::223     2e-21  44%  223 aa  PDXH_RHOSR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   62::216     2e-21  43%  216 aa  PDXH_WOLPM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   53::195     2e-21  38%  208 aa  PDXH_PELUB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::209     3e-21  45%  209 aa  PDXH_HAEDU RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::201     4e-21  46%  214 aa  PDXH_LEPIN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::201     4e-21  46%  214 aa  PDXH_LEPIC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::207     5e-21  41%  212 aa  PDXH_SHEPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::223     5e-21  45%  223 aa  PDXH_KINRD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::216     5e-21  44%  216 aa  PDXH1_THICR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::213     8e-21  45%  213 aa  PDXH_SHESH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   53::201     8e-21  43%  213 aa  PDXH2_RALSO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::214     1e-20  43%  214 aa  PDXH_DEIRA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   87::214     1e-20  46%  214 aa  PDXH_DEIDV RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::202     1e-20  42%  216 aa  PDXH_BRASB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   70::175     1e-20  45%  192 aa  PDXH_ZYMMO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::212     1e-20  42%  212 aa  PDXH_SHEHH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   86::215     3e-20  41%  215 aa  PDXH_PSYWF RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   50::205     3e-20  46%  213 aa  PDXH_GRABC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     3e-20  47%  218 aa  PDXH_DEIGD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   88::204     4e-20  47%  213 aa  PDXH_NOCSJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   91::216     5e-20  40%  216 aa  PDXH_WIGBR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   57::214     5e-20  41%  214 aa  PDXH_FLAPJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::200     7e-20  43%  212 aa  PDXH_ACICJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   42::183     9e-20  42%  197 aa  PDXH_EHRCJ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::213     9e-20  45%  213 aa  PDXH_BACTN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::198     1e-19  39%  212 aa  PDXH_RHOPT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::198     1e-19  39%  212 aa  PDXH_RHOPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   45::186     1e-19  44%  198 aa  PDXH_ANADE RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::198     2e-19  40%  212 aa  PDXH_RHOPS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::213     2e-19  40%  213 aa  PDXH_RHOP5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   44::206     2e-19  44%  206 aa  PDXH_JANSC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   53::199     2e-19  39%  213 aa  PDXH_BRAJA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   42::200     3e-19  42%  200 aa  PDXH_RHOS4 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::198     3e-19  41%  212 aa  PDXH_RHOP2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   95::253     3e-19  45%  253 aa  PDXH_CAEEL RecName: Full=Putative pyridoxamine 5'-phosphate
   48::193     3e-19  45%  208 aa  PDXH_XYLFT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   42::200     3e-19  42%  200 aa  PDXH_RHOS1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::201     3e-19  39%  216 aa  PDXH_PSYA2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::206     3e-19  44%  215 aa  PDXH_PSEA8 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   63::214     4e-19  42%  214 aa  PDXH_GRAFK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::196     6e-19  41%  210 aa  PDXH_ACTSZ RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   48::193     8e-19  45%  208 aa  PDXH_XYLFA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     8e-19  42%  211 aa  PDXH_HERAR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     8e-19  43%  218 aa  PDXH_ACIBS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::201     1e-18  41%  216 aa  PDXH_PSYCK RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::199     1e-18  43%  214 aa  PDXH_PORGI RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   53::199     2e-18  42%  213 aa  PDXH_RHOPB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::199     2e-18  43%  214 aa  PDXH_PORG3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   91::216     2e-18  43%  216 aa  PDXH_BLOPB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   76::220     2e-18  43%  235 aa  PDXH_BACFR RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   76::220     2e-18  43%  235 aa  PDXH_BACFN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     2e-18  45%  218 aa  PDXH_ACIBY RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     2e-18  45%  218 aa  PDXH_ACIBT RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     2e-18  45%  218 aa  PDXH_ACIBC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::218     2e-18  45%  218 aa  PDXH_ACIB5 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   91::218     2e-18  43%  218 aa  PDXH_ACIAD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::199     3e-18  41%  213 aa  PDXH_NITWN RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   50::191     4e-18  41%  212 aa  PDXH_ERYLH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   58::202     4e-18  39%  216 aa  PDXH_BRASO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     5e-18  41%  211 aa  PDXH_MANSM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   89::215     5e-18  44%  215 aa  PDXH_LEGPH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   89::215     5e-18  44%  215 aa  PDXH_LEGPC RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   89::215     5e-18  44%  215 aa  PDXH_LEGPA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   52::209     5e-18  39%  209 aa  PDXH_ALCBS RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   89::215     6e-18  44%  215 aa  PDXH_LEGPL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   50::206     1e-17  39%  206 aa  PDXH_MYXXD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   64::220     1e-17  39%  220 aa  PDXH_MYXXA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   56::212     1e-17  43%  212 aa  PDXH_HAHCH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     5e-17  40%  211 aa  PDXH_VIBCM RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     5e-17  40%  211 aa  PDXH_VIBCH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   78::220     7e-17  42%  220 aa  PDXH_PARDP RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::211     9e-17  40%  211 aa  PDXH_VIBC3 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   46::189     1e-16  40%  203 aa  PDXH_NOVAD RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::212     1e-16  42%  212 aa  PDXH_IDILO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   51::209     3e-16  43%  209 aa  PDXH_SILPO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     3e-16  38%  210 aa  PDXH_NEIMF RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     3e-16  38%  210 aa  PDXH_NEIMA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     3e-16  39%  210 aa  PDXH_NEIG2 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     3e-16  39%  210 aa  PDXH_NEIG1 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     5e-16  38%  210 aa  PDXH_NEIMB RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::210     5e-16  38%  210 aa  PDXH_NEIM0 RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   74::201     8e-16  39%  201 aa  PDXH_ROSDO RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   54::211     1e-15  40%  211 aa  PDXH_JANMA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::212     1e-15  39%  212 aa  PDXH_VESOH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   43::201     5e-15  38%  201 aa  PDXH_SILST RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   55::199     5e-15  39%  213 aa  PDXH_NITHX RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   60::217     7e-15  42%  217 aa  PDXH_PHOLL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
  152::206     1e-13  49%  219 aa  PDXH_HYPNA RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   59::216     3e-13  39%  216 aa  PDXH_BAUCH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   89::214     6e-13  34%  214 aa  PDXH_BLOFL RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate
   68::222     7e-07  32%  222 aa  PHZG_PSEFL RecName: Full=Phenazine biosynthesis protein phzG;      
   68::222     3e-06  31%  222 aa  PHZD_PSECL RecName: Full=Phenazine biosynthesis protein phzD;      
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNXXXXXXXXXXXXSVIPDDGQGKL
PDX3_SCHPO      LPSGRVSSRLVLLKELDHRGFIIFTNLGSKKAKD-----------------------------------L
PDX3_YEAST      LPSGRVSSRILLFKELDHRGFTIYSNWGT----------SRKAHDIAT----------------------
PDXH_CYAP7      -PDGKPSARMVLLKDFDERGFVFYTNYDSAKGQ-----------------------------------QL
PDXH_MARAV      ---GMPDLRTVLLKYFDSQGFVFYTNYGSRKAQ-----------------------------------EL
PDXH_BURXL      -PRGRPSARIVLIKGVDERGFVFFTNYESRKGR-----------------------------------EL
PDXH_PSYIN      -PEGRPSSRMVLLKEVDSKGFVFFTNYDSRKAHD-----------------------------------L
PDXH_BURPP      ---GRPSARIVLIKGVDERGFVFFTNYESRKGR-----------------------------------EL
PDXH_SACEN      ---------------------------------------------------------------------L
PDXH_BURPS      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURP6      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURP1      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURP0      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURMS      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURMA      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURM9      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURM7      --SGRPSARIVLIKGADERGFVFFTNYESRKGR-----------------------------------EL
PDXH_PSEPG      ---GRPHCRVLLLKGLDEQGFTFFTNYESAKGQ-----------------------------------QL
PDXH_BURTA      --AGRPSARIVLIKGVDERGFVFFTNYESRKGR-----------------------------------EL
PDXH_BURVG      ---GRPSARILLIKAVDERGFVFFTNYESRKGHD-----------------------------------L
PDXH_FRASC      ---GRPSARTVLLKGFDQRGFVIYTNYASRKGREA----TE-----------------------------
PDXH_PSEPW      ---GRPHCRVLLLKGLDDRGFTFFTNYDSAKGQ-----------------------------------QL
PDXH_BURS3      ---GRPSARIVLIKGVDERGFVFFTNYESRKGRD-----------------------------------L
PDXH_BURCJ      ---GRPSARIVLIKGVDERGFVFFTNYESRKGHD-----------------------------------L
PDXH_BURCH      ---GRPSARIVLIKGVDERGFVFFTNYESRKGHD-----------------------------------L
PDXH_BURCA      ---GRPSARIVLIKGVDERGFVFFTNYESRKGHD-----------------------------------L
PDXH_BURCC      ---GRPSARIVLIKGVDERGFVFFTNYESRKGHD-----------------------------------L
PDXH_RALPJ      -PHGQPSARIVLLKNLDERGFTFFTNYASHKGE-----------------------------------EL
PDXH_PSEPK      ---GRPHCRVLLLKGLDEQGFTFFTNYDSAKGQ-----------------------------------QL
PDXH_PSEP1      ---GRPHCRVLLLKGLDEQGFTFFTNYDSAKGQ-----------------------------------QL
PDXH_NOSP7      -PDGKPSARMVLLKDFDERGFAFFTNYNSRKGQ-----------------------------------EL
PDXH_CYAP4      ---GKPAARIVLLKEVDDRGFTFFTNYKSRKGE-----------------------------------EL
PDXH_BURM1      ---GRPSARIVLVKGVDERGFVFFTNYESRKGRD-----------------------------------L
PDXH1_RALSO     -PQGQPSARIVLLKNLDERGFTFFTNYCSHKGE-----------------------------------EL
PDXH_PSEPF      ---GRPHCRILLLKGLDEQGFTFFTNYESAKGQ-----------------------------------HL
PDXH_PSEMY      ---GRPHCRVLLLKGLDERGFTFFSNYESAKGR-----------------------------------QL
PDXH_BURCM      --NGRPSARIVLIKGVDERGFVFFTNYESRKGRD-----------------------------------L
PDXH_BURA4      --NGRPSARIVLIKGVDERGFVFFTNYESRKGRD-----------------------------------L
PDXH_ANAVT      -PDGQPSARMVLLKDFDERGFVFFTNYNSRKGQ-----------------------------------EL
PDXH_MICAN      -PEGKPRARMVLLKDFDPRGFVLFTNYHSAKGQ-----------------------------------EL
PDXH_CUPTR      ---GQPSARIVLLKGIDDRGFTFFTNYESRKGLD-----------------------------------L
PDXH_ANASP      -PDGQPSARMVLLKDFDEQGFVFFTNYNSRKGQ-----------------------------------EL
PDXH_PSE14      ---GRPHCRVLLLKGLDTQGFTFFTNYESAKGQ-----------------------------------QL
PDXH_FRAAA      ---GRPSARTVLLKGFDHRGFVIYTNYTSRKGR-----------------------------------ES
PDXH_SALAI      --AGRPSARTVLLKGYDPDGFVLFTNYGSHKGT-----------------------------------EL
PDXH_RALEH      ---GQPSARIVLLKGIDDRGFTFFTNYESRKGLD-----------------------------------L
PDXH_PSEE4      ---GRPHCRVLLLKALDGRGFTFFTNYESAKGQ-----------------------------------HI
PDXH_STRAW      ---GRPSSRTVLMKQYDEQGFVFYTNYDSRKARD-----------------------------------L
PDXH_PSESM      ---GRPHCRVLLLKGLDAQGFTFFTNYESAKGR-----------------------------------QL
PDXH_SYNY3      ---GHPVGRMVLLKGLDERGFVFYTNYDSAKGQ-----------------------------------QL
PDXH_SALRD      ---GTPSARIVLLKGLDDRGFHFYTNYESRKGTD-----------------------------------L
PDXH_PSEU2      ---GRPHCRVLLLKGLDTQGFTFFTNYESAKGQ-----------------------------------QL
PDXH_RALEJ      ---GQPSARIVLLKGMDEKGFTFFTNYESRKGLD-----------------------------------M
PDXH_BORA1      --SGQPSARIVLIKAFDARGFTFFTNYTSRKGED-----------------------------------L
PNPO_DICDI      ------SARVVLLKHFDHQGFVFYTNYNSRKSK-----------------------------------EL
PDXH_PSEAE      ---GYPHCRILLLKGLDERGFTFFTNYESAKGR-----------------------------------QL
PDXH_PSEAB      ---GYPHCRILLLKGLDERGFTFFTNYESAKGR-----------------------------------QL
PDXH_BURP8      ---GRPSARIVLIKGVDERGFVFFTNYESRKGQ-----------------------------------EL
PDXH_BORPD      ---GQPSARIVLIKGYDSRGFAFYTNYESRKGHD-----------------------------------L
PDXH_PSEFS      ---GRPHCRILLLKGLDAQGFTFFTNYQSAKGQ-----------------------------------QL
PDXH_ACAM1      ------SARMVLLKGFDQQGFIFYTNYLSRKGQD-----------------------------------L
PDXH_PSEF5      ---GRPHCRILLLKGLDEQGFTFFTNYESAKGQ-----------------------------------QL
PDXH_NOCFA      ----------------------------------------------------------------------
PDXH_RUBXD      -PDGRPSARTVLLKGFDERGFVFYTNYGGRKSR-----------------------------------EI
PDXH_PSEU5      ---GRPHCRILLLKALDDRGFTFFTNYDSAKGQ-----------------------------------QL
PDXH_CYAP8      ---GEPSLRTVLLKYFDNQGFVFFTNYESNKAK-----------------------------------QI
PDXH_STRCO      -PEGRPSSRTVLLKHFDEQGFVFYTNYDSRKAR-----------------------------------EL
PDXH_RHOFD      ----RPSTRVVLIKGYDERGITWFTNYDSRKGQ-----------------------------------EL
PDXH_BORPE      ---GQPSARIVLIKGYDDAGFVFFTNYESRKGLD-----------------------------------L
PDXH_BORPA      ---GQPSARIVLIKGYDDAGFVFFTNYESRKGLD-----------------------------------L
PDXH_BORBR      ---GQPSARIVLIKGYDDAGFVFFTNYESRKGLD-----------------------------------L
PDXH_RHOBA      --SGDITSRIVLLKGVEEKKFLFYTNYDSTKGS-----------------------------------QM
PDXH_RALME      ---GQPSARIVLLKGMDADGFTFFTNYESRKG-----------VD------------------------L
PDXH_MYCTU      ----------------------------------------------------------------------
PDXH_MYCTA      ----------------------------------------------------------------------
PDXH_MYCS2      ---------------------------------------------------------------DSAKGEL
PDXH_MYCBT      ----------------------------------------------------------------------
PDXH_MYCBP      ----------------------------------------------------------------------
PDXH_MYCBO      ----------------------------------------------------------------------
PDXH_CYAA5      ---GEPSIRTVLLKYFDEKGFVFFTNYESRKAQ-----------------------------------QI
PDXH_MAGSA      ---GRPSVRMVLLKGADQDGFVFFTNLESRKGQ-----------------------------------EL
PDXH_AZOVD      --NGRPHCRVLLLKGVDERGFTFFSNYESAKGQ-----------------------------------QL
PDXH_ACTPJ      ---GKPTSRIVLLKEVNPNGFVFFTNYQSRKGQA-----------------------------------I
PDXH_POLSJ      ----RPSTRVVLVKGYDARGIVWFTNYNSRKGL-----------------------------------EL
PDXH_RUTMC      -----ISIRVVLLKYFDRHGFVFFTNYNSKKSK-----------------------------------QL
PDXH_MYCSJ      --AGRPVTRTVLCKSVDDTGITFFTNYGSAKGED-----------------------------------L
PDXH_AGRT5      --NGLPNVRMVLLKGVDDRGFVFYTNFESQKGQ-----------------------------------EI
PDXH_MYCSS      ---GRPVTRTVLCKSVDDTGITFFTNYGSAKGED-----------------------------------L
PDXH_MYCSK      ---GRPVTRTVLCKSVDDTGITFFTNYGSAKGED-----------------------------------L
PDXH_ENTS8      ---GQPYQRIVLLKHFDERGMVFYTNLGSRKAH-----------------------------------HL
PDXH_ESCF3      --NGQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ERWT9      ---GQPYQRIVLLKHFDRRGMVFYTNLGSRKAQ-----------------------------------QL
PDXH_MYCVP      ---GRPVTRTVLCKSVDASGVSFYTNYDSEKGR-----------------------------------QL
PDXH_METPP      ---GRPSTRVVLIKGCDARGIVWYTNYESRKGR-----------------------------------EL
PDXH_ACTP2      ---GKPTSRIVLLKEVNPNGFVFFTNYQSRKGQA-----------------------------------I
PDXH_ACIAC      ----RPSTRVVLIKGYDERGIVWYTNYGSRKGR-----------------------------------QL
PDXH_SPHWW      ---GQPSVRMVLLKGHDARGFVFYTNYESR--KATQLL--ETGR--------------------------
PDXH_RHIME      -PDGMPNVRMVLLKGFDERGFVLYTNFESQKGR-----------------------------------EM
PDXH_POLNA      ----RPSTRVVLIKGFDAQGIVWYTNYASRKGL-----------------------------------EL
PDXH_ACTP7      ---GKPTSRIVLLKEVNPNGFVFFTNYQSRKGQA-----------------------------------I
PDXH_SHIFL      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_SHIF8      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_SHIDS      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_SHIBS      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_LEPBP      ---GKPSVRIVLLKGLIRNEFQFFTNYSSHKGKD-----------------------------------I
PDXH_LEPBA      ---GKPSVRIVLLKGLIRNEFQFFTNYSSHKGKD-----------------------------------I
PDXH_ECOSM      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOLU      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOLI      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOLC      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOHS      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECODH      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOBW      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO7I      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO27      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_BRUSU      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUSI      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUME      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUMB      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUC2      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUAB      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUA2      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_BRUA1      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_AERS4      ---GQPWQRTVLLKHYDAQGMVFYTNMGSRKAH-----------------------------------QL
PDXH_ACISJ      ----RPSTRVVLIKGYDAQGIVWYTNYDSRKGR-----------------------------------QI
PDXH_RHISN      -PDGLPNVRMVLLKGFDEHGFVFYTNFESQKGQ-----------------------------------EL
PDXH_MYCLE      --NGRPVSRSVLCKGADEAGIIFFTNYDSDKG-------------------------------DD----L
PDXH_GLUOX      -PDGRPSVRMLLLKGVDERGFVFYTNLESRKGR-----------------------------------EL
PDXH_ECO24      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_BDEBA      ---GVPSVRIVYLKEVSQGGFVFYGNYNSHKGKD-----------------------------------I
PDXH_SHISS      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_SHIB3      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_MYCGI      ---GRPVTRTVLCKSVDESGISFYTNYDSDKG-----------------------------------AQL
PDXH_ECOUT      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOSE      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOL6      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOL5      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECOK1      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO8A      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO81      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO55      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO45      --------RIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_BRUO2      -PDGLPNVRMVLLKDFDETGFVFYTNYESK--KGQEILSAEK----------------------------
PDXH_SPHAL      -PDGRPSLRMVLLKGHGPDGFVFYTNLDSRKG-----------------------------------GEL
PDXH_HAEIN      ---GRPNSRMVLLKEVNEQGFVFFTNYLSRKG-----------------------------------GCI
PDXH_HAEI8      ---GRPNSRMVLLKEVNEQGFVFFTNYLSRKG-----------------------------------GCI
PDXH_ERWCT      ---GQPYQRIVLLKHYDEKGMVFYTNMGSRKAH-----------------------------------HL
PDXH_ECO5E      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_ECO57      ---GQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------QI
PDXH_COLP3      ---GQPSSRMVLLKDYDKEGFVFFTNYESRKSH-----------------------------------EL
PDXH_MESSB      -PEGMPNVRMVLLKGFDEQGFVFYTNFESAKGQ-----------------------------------EI
PDXH_KLEP7      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_ALHEH      --SGWPQVRTVLLKGYDERGFAFYTNRHSRKGQA-----------------------------------L
PDXH_AGRRK      ---GLPNVRMVLLKGFDSQGFVFYTNFESQKGQ-----------------------------------EI
PDXH_AERHH      ---GQPWQRTVLLKHYDAEGMVFYTNMGSRKAH-----------------------------------QL
PDXH_VEREI      ----RPSTRIVLIKGYDERGIVWFTNYDSRKGR-----------------------------------QI
PDXH_MYCPA      -PDGRPASRTVLCKSLDETGITFFTNYDSAKA-------------------------------DD----L
PDXH_MYCA1      -PDGRPASRTVLCKSLDETGITFFTNYDSAKA-------------------------------DD----L
PDXH_CITK8      --NGQPYQRIVLLKHYDEKGMVFYTNLGSRKAH-----------------------------------HL
PDXH_TERTT      --SGQPSQRIVLLKHLDQRGFVFFTNYRSHKAED-----------------------------------I
PDXH_SALTY      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALTI      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALSV      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALPK      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALPC      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALPB      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALPA      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALNS      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALHS      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALG2      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALEP      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALDC      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALCH      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_SALA4      ---GQPYQRIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------QI
PDXH_DICNV      ---GQPSQRSVLLKLFDEEGFVFYTNYSSQKAE-----------------------------------EI
PDXH_VIBVY      --------RIVLLKNVDKDGFVFYTNLGSRKAQ-----------------------------------HL
PDXH_VIBVU      --------RIVLLKNVDKDGFVFYTNLGSRKAQ-----------------------------------HL
PDXH_POLSQ      --AGNPSARIVLLKGADQNGFTFFTNYESQKGQD------------------------LAVRPQ------
PDXH_OCHA4      -PDGLPNVRMVLLKDFDEQGFVFYTNYESTKGK--EILSAEK----------------------------
PDXH_CHRSD      ---GLPHARVVLLKQLDDKGLVFFTNYQSHKGS-----------------------------------EL
PDXH_RHIEC      ---GLPNVRMVLLKGFDDDGFVFYTNFESQKGR-----------------------------------EI
PDXH_PROMH      --NGQPYQRIVLLKHFDEKGLVFYTNLGSRKAS-----------------------------------HL
PDXH_LEPBL      ---GKPNARIVLLKEILEDSFVFYTNYESKKGR-----------------------------------EL
PDXH_LEPBJ      ---GKPNARIVLLKEILEDSFVFYTNYESKKGR-----------------------------------EL
PDXH_ENT38      --------RIVLLKHYDEKGLVFYTNLGSRKAH-----------------------------------HL
PDXH_CYTH3      --AGKPASRIVLLKGIEHGSFVFYTNYKSHKGSD-----------------------------------I
PDXH_SHELP      ---GQPFQRIVLLKRFDDNGFVFFTNLASRKAE-----------------------------------QI
PDXH_SHESR      ---GQPYQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_RHIL3      ---GLPNVRMVLLKGFDDDGFVFYTNFESQKGR-----------------------------------EI
PDXH_THEEB      ---GMPAARLVLLKEVDDRGFVFFTNYRSRKGR-----------------------------------EL
PDXH_PSEA7      ---GHPHCRILLLKGLDERGFTFFTNYESAKGR-----------------------------------QL
PDXH_LEPCP      ---GRPSTRVVLIKGYDSRGIVWYTNYKSRKGQ-----------------------------------EL
PDXH_COXBU      ---GKPSARNVLYKGISKGGFLIFTNYHSRKAH-----------------------------------EL
PNPO_BOVIN      ---GKPSARMVLLKGFGKDGFRFFTNFESRKGK-----------------------------------EL
PDXH_RHILO      ---GMPDVRMVLLKGFDEGGFVFYTNFESAKGQ-----------------------------------EI
PDXH_BARBK      --TGLPNVRIVLLKNFNSTGFVFYTNYESCKGQ-----------------------------------EI
PDXH_THEFY      -PDGAPSARTVLLKGYDRRGLRFFTNYRSRKGVA-----------------------------------L
PDXH_SHEAM      ---GQPYQRIVLLKRFDEQGFVFFTNLGSRKAT-----------------------------------QL
PDXH_RHORT      -PEGRPSLRMVLLKGVAEGGFIFYTNLESRKG-----------------------------------GEL
PDXH_RHIE6      ---GLPNVRMVLLKGFDDDGFVFYTNFESQKGR-----------------------------------EI
PDXH_AZOC5      -PDGLPDARMVLLKGLDDRGFVFYTNTESAKGR-----------------------------------EL
PDXH_ARCB4      ------SIRTVLLKIFDEKGFVFFTNYKSTKAN-----------------------------------QI
PDXH_VIBPA      --NGMPFQRIVLLKNVDKDGFVFYTNLGSRKAQ-----------------------------------HL
PDXH_SHESM      ---GQPYQRIVLLKRFDDSGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SHEB9      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SHEB8      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SHEB5      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SHEB2      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SERP5      --NGQPYQRIVLLKHFDDKGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_SACD2      ---GFPSQRIVLLKKLDEQGFVFFTNYGSRKAQ-----------------------------------EI
PDXH_ACIC1      ---GRPSSRHVLLKSVDD-GFVFFTNYRSRKGRD-----------------------------------L
PDXH_BARQU      --TGLPNVRMVLLKDFSSRGFVFYTNYESCKGQ-----------------------------------EI
PDXH_ANAPZ      ----RPSARVVLLKRYSDAGFEFYTNLESRKAR-----------------------------------EI
PDXH_SHESA      ---GQPYQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_RHILW      ---GLPNVRMVLLKGFDDNGFVFYTNFESQKGR-----------------------------------EI
PDXH_PROMM      ----RPSSRTVLLKAFDKRGFVFFTNYGSRKAED-----------------------------------I
PDXH_PROM3      ----RPSSRTVLLKAFDKRGFVFFTNYGSRKAQD-----------------------------------I
PDXH_VIBFM      --NGQPFQRIVLLKHFDKTGFVFYTNLGSRKAQ-----------------------------------QL
PDXH_VIBF1      --NGQPFQRIVLLKHFDKTGFVFYTNLGSRKAQ-----------------------------------QL
PDXH_MARMM      --SGLPDVRMVLLKDVDADGFVFYTNLES--GKGGQ---------------------------------L
PDXH_EDWI9      --SGQPHQRIVLLKHYDAQGMVFYTNLGSNKAQ-----------------------------------QL
PDXH_ALTMD      --TGQPSQRIVLLKDVSDKGFVFFTNLGSRKAQ-----------------------------------EL
PDXH2_THICR     ------STRTVLLKQFSDDGFVFFTNYRSQKAKD-----------------------------------I
PDXH_SHESW      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_SHEON      ---GQPFQRIVLLKRFDDSGFVFFTNLGSRKAL-----------------------------------QI
PDXH_PARL1      --SGFPDVRMVLLKEADARGFVFYTNLESAKGL-----------------------------------EL
PDXH_CAUCR      ---GMPDSRMVLLKDFDARGFVFYTNTQSAKGQ-----------------------------------EL
PDXH_CAUCN      ---GMPDSRMVLLKDFDARGFVFYTNTQSAKGQ-----------------------------------EL
PNPO_HUMAN      ---GKPSARMLLLKGFGKDGFRFFTNFESRKGK-----------------------------------EL
PDXH_XANAC      ---GRPSARTVLLKAFDARGFVFYTHLDSAKGRD-----------------------------------L
PDXH_SODGM      --NGQPYQRLVLLKHFDRQGMVFYTNLGSRKA-----------------------------------AHL
PDXH_VIBHB      --NGMPFQRIVLLKSVDKDGFVFYTNLGSRKAQ-----------------------------------QL
PDXH_CHRVO      ---GRPSSRIVLLKGVEDGQLLFYTNYQSRKGQA-----------------------------------L
PDXH_YERPS      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERPN      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERPG      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERPE      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERPA      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERP3      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_YERE8      --NGQPYQRIVLLKHYDDQGLVFYTNLGSRKAQ-----------------------------------QL
PDXH_PHOPR      --SGQPFQRIVLLKHFDRDGFIFYTNLGSRKAL-----------------------------------HL
PDXH_XANC5      ---GRPSARTVLLKAFDARGFVFYTHLDSAKGRD-----------------------------------L
PDXH_HALHL      ---GWPAARTVLLKQLDEQGAVFYTNRASRKGQ-----------------------------------QL
PDXH_XANP2      -PDGLPDARMVLLKGLDARGFVFFTNTESAKGR-----------------------------------EL
PDXH_XANOR      ---GRPSARTVLLKAFDARGFVFYSHLDSAKGRD-----------------------------------L
PDXH_XANOM      ---GRPSARTVLLKAFDARGFVFYSHLDSAKGRD-----------------------------------L
PDXH_XANCP      ---GRPSARTVLLKAFDARGFVFYTHLDSAKGRD-----------------------------------L
PDXH_XANC8      ---GRPSARTVLLKAFDARGFVFYTHLDSAKGRD-----------------------------------L
PDXH_SHEWM      --SGQPFQRIVLLKRFSEEGFVFFTNLESRKSQ-----------------------------------QI
PDXH_SHEDO      --NGQPFQRIVLLKRFDDTGFVFFTNLESRKAK-----------------------------------QI
PNPO_MOUSE      ---GKPSARMLLLKGFGKDGFRFFTNYESRKGK-----------------------------------EL
PDXH_PSEHT      --TGQPSQRIVLLKHLDNDGFVFFTNTGSRKAQ-----------------------------------EL
PDXH_SHEPC      ---GQPFQRIVLLKRFDDTGFVFFTNLGSRKAQ-----------------------------------QI
PDXH_EHRRW      ------SARVVLLKQHSDEGFVFFTNMNSRKGK-----------------------------------EI
PDXH_EHRRG      ------SARVVLLKQHSDEGFVFFTNMNSRKGK-----------------------------------EI
PDXH_ALISL      ---GQPFQRIVLLKHFDSTGFVFYTNLASRKAQ-----------------------------------HL
PDXH_VIBSL      --NGQPFQRIVLLKNVDKDGFVFYTNLGSRKAH-----------------------------------QL
PDXH_EHRCR      ------SARVVLLKKYSDQGFVFFTNMNSRKGK-----------------------------------EM
PDXH_ANAMM      ----RPSARVVLLKKYGEAGFEFVTNFNSRKGR-----------------------------------EI
PNPO_RAT        ---GKPSARMLLLKGFGKDGFRFFTNYESRKGK-----------------------------------EL
PDXH_PSEA6      ---GQPSQRIVLLKDVMDGCFVFYTNLGSRKAQD-----------------------------------L
PDXH_BARHE      --TGFPNVRMVLLKDFSPQGFVFYTNYESPKGQ-----------------------------------EI
PDXH_AGRVS      --SGLPNVRMVLLKDFDQNGFVFYTNFESQKGT-----------------------------------EI
PDXH_SINMW      -PDGMPNARMVLLKGFDERGFVFYTNFESQ--KGQEILAT------------------------------
PDXH_SHEFN      ---GQPFQRIVLLKKFDDNGFVFFTNLESRKAK-----------------------------------QI
PDXH_FLAJ1      ---GFPKSRVVLLKKFSEEGFIFYTNYNSEKGKA-----------------------------------I
PDXH_RHOSR      ---------------------------------------------------------------DSDKGRL
PDXH_WOLPM      ------SARVVLLKEYSKEGFVFFTNVNSKKGK-----------------------------------EL
PDXH_PELUB      ------SIRMVLLKDFNKDGFVFYTNLNSQKGN-----------------------------------EL
PDXH_HAEDU      ---GKPTSRIVLLKEVDQQGFIFFTNYQSCKGWA-----------------------------------I
PDXH_LEPIN      ---GKPDARIVLLKGILKESFLFYTNYESRKGT-----------------------------------EL
PDXH_LEPIC      ---GKPDARIVLLKGILKESFLFYTNYESRKGT-----------------------------------EL
PDXH_SHEPA      --NGQPFQRIVLLKRFDNHGFVFFTNLESRKAQ-----------------------------------HI
PDXH_KINRD      -----VSARTVLLKAVDGRGFVFYTNQRSRKALA---------------------------IAHDPR---
PDXH1_THICR     ---GQPHSRIVLLKTFNSDGFIFYTHYDS----------------------------------DKGQ-QI
PDXH_SHESH      ---GQPFQRIVLLKRFDKGGFVFFTNLESRKSQ-----------------------------------QI
PDXH2_RALSO     -PDGLPNVRMVLLKGFDREGFVFYTNTESQKGV-----------------------------------EL
PDXH_DEIRA      ---GRPSVRTVLLRGADERGLTFYTNYESHKGHD-----------------------------------L
PDXH_DEIDV      ---------------------------------------------------------------------L
PDXH_BRASB      --SGLPDVRMVLMKGYDEDGFVFYSHKASQKGQ-----------------------------------EL
PDXH_ZYMMO      ----------------------------------------------------------------------
PDXH_SHEHH      --NGQPFQRIVLLKRFGDDGFVFFTNLESRKAQ-----------------------------------HI
PDXH_PSYWF      ---------------------------------------------------------------------I
PDXH_GRABC      -PSGVPSARIVLLRSVDERGFVFFTNTESRKGV-----------------------------------EI
PDXH_DEIGD      --SGRPSVRTVLLRGADERGLTFYTNYESHKGHD-----------------------------------L
PDXH_NOCSJ      --------------------------------------------------------------------EL
PDXH_WIGBR      ---------------------------------------------------------------------I
PDXH_FLAPJ      ---GFPKARVVLLKQFTYEGFIFYTNYDSEKGRA-----------------------------------I
PDXH_ACICJ      -PDGRPSARIVLLKSWDEAGFVFYTNLESRKSL-----------------------------------EI
PDXH_EHRCJ      ------SARVVLLKKHSDQGFIFFTNINSRKGK-----------------------------------EI
PDXH_BACTN      -PEGRPSTRTVLLKGLHDGKFIFYTNYESRKGR-----------------------------------QL
PDXH_RHOPT      -PDGLPDVRMVLMKGYDEHGFVFYSHIASQKGR-----------------------------------EL
PDXH_RHOPA      -PDGLPDVRMVLMKGYDEHGFVFYSHIASQKGR-----------------------------------EL
PDXH_ANADE      ------SVRMVLVKSADARGFAFFTNRESRKARD-----------------------------------L
PDXH_RHOPS      -PDGLPDVRMVLMKGYDTDGFVFYSHIASQKGR-----------------------------------EL
PDXH_RHOP5      ---GLPDVRMVLMKDYDATGFVFYSHLASQKGQ-----------------------------------EL
PDXH_JANSC      ---GLPNARMVLLKEIESHG----------AGQGGFVFYTNYG-------------------SAKGQEIA
PDXH_BRAJA      -PDGLPDVRMVLMKGFDTEGFVFYSHIASQKGR-----------------------------------EL
PDXH_RHOS4      --AGLPNVRMVLLKEIEAEAFVFYTNYGSQKAV-----------------------------------EI
PDXH_RHOP2      ---GLPDVRMVLMKGYDADGFVFYSHIASQKGR-----------------------------------EL
PDXH_CAEEL      ----RPSSRMVLLKAYTPTGFSFYTNYTSRKGN-----------------------------------QL
PDXH_XYLFT      ---GHPSVRTVLLKKFDARGFVFYSHLDSPKGRD-----------------------------------L
PDXH_RHOS1      --AGLPNVRMVLLKEIEAEAFVFYTNYGSQKAV-----------------------------------EI
PDXH_PSYA2      ------SVRIVLLREITDKGIVFYTNYESAKGQD-----------------------------------I
PDXH_PSEA8      ---GYPHCRILLLKGLDERGFTFFTNYESAKGR-----------------------------------QL
PDXH_GRAFK      --------RVVLLKSFDPDGLYFYTNYDSVKGRD-----------------------------------L
PDXH_ACTSZ      --NGKPTSRVVLLKEVNAQGFVFFTNYLSRKGKSXXXXXXXXXXXX------------------------
PDXH_XYLFA      ---GHPSVRTVLLKKFDARGFVFYSHIDSPKGRD-----------------------------------L
PDXH_HERAR      --NGRPSSRIVLIKDFDQRGFTWFTNYDSRKGR-----------------------------------EL
PDXH_ACIBS      --SGRPHVRTVLLRGATEAGYDFYTNYDS-----------QKGID------------------------L
PDXH_PSYCK      ------SVRIVLLREITDKGIVFYTNYESAKG----------------------------------QDIA
PDXH_PORGI      -PDGHPSTRTVLLKEFMNNEFIFYSNYESRKGQ-----------------------------------QM
PDXH_RHOPB      -PDGLPDVRMVLMKGYDSHGFVFYSHIASQKGR-----------------------------------EL
PDXH_PORG3      -PDGHPSTRTVLLKEFLNNEFIFYSNYESRKGQ-----------------------------------QM
PDXH_BLOPB      ---------------------------------------------------------------------L
PDXH_BACFR      -PEGQPSTRTVLLKDLHDGKFIFYTNYESRKGT-----------------------------------HL
PDXH_BACFN      -PEGQPSTRTVLLKDLHDGKFIFYTNYESRKGT-----------------------------------HL
PDXH_ACIBY      --SGRPHVRTVLLRGATEAGYDFYTNYDS-----------QKGID------------------------L
PDXH_ACIBT      --SGRPHVRTVLLRGATEAGYDFYTNYDS-----------QKGID------------------------L
PDXH_ACIBC      --SGRPHVRTVLLRGATEAGYDFYTNYDS-----------QKGID------------------------L
PDXH_ACIB5      --SGRPHVRTVLLRGATEAGYDFYTNYDS-----------QKGID------------------------L
PDXH_ACIAD      ---------------------------------------------------------------------L
PDXH_NITWN      ---GLPDLRMVLMKGFDARGFVFYSHIASAKGR-----------------------------------EL
PDXH_ERYLH      -PDGAPSVRMVLLKDHGPQGFTFYTNAESRKGE-----------------------------------EI
PDXH_BRASO      ---GLPDVRMVLMKGYDADGFVFYSHKASQKGQ-----------------------------------EL
PDXH_MANSM      --NGKPSSRVVLLKEVNERGLVFFTNYHSHKGRD-----------------------------------L
PDXH_LEGPH      --------------------------------------------------------------------QI
PDXH_LEGPC      --------------------------------------------------------------------QI
PDXH_LEGPA      --------------------------------------------------------------------QI
PDXH_ALCBS      --NGQPSSRVVLLKGIENQGFTFFTHYDSRKGE-----------------------------------EI
PDXH_LEGPL      --------------------------------------------------------------------QI
PDXH_MYXXD      ---GRPSARVVLLKDFDARGFVFYTNHESRKGR-----------------------------------EA
PDXH_MYXXA      ---GRPSARVVLLKDFDARGFVFYTNHESRKGR-----------------------------------EA
PDXH_HAHCH      ---GVPSQRIVLLKNLDPSGFVFYTNLGSRKAQN-----------------------------------I
PDXH_VIBCM      ---GQPFQRIVLLKNVDDAGFVFYTNLGSRKAQ-----------------------------------HI
PDXH_VIBCH      ---GQPFQRIVLLKNVDDAGFVFYTNLGSRKAQ-----------------------------------HI
PDXH_PARDP      --------------------------------------------------------------------EI
PDXH_VIBC3      ---GQPFQRIVLLKNVDDVGFVFYTNLGSRKAQ-----------------------------------HI
PDXH_NOVAD      ---GVPSVRMVLLKGHGPDGFVFYTNLQSRKG-----------------------------------GEL
PDXH_IDILO      ------SQRIVLLKGYDHTGFRFYTNKNSHKGQD-----------------------------------I
PDXH_SILPO      --SGLPNVRMVLLKEIEPAAFVFYTNYESA-----------------------------KAIELEQAGK-
PDXH_NEIMF      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_NEIMA      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_NEIG2      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_NEIG1      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_NEIMB      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_NEIM0      ---GRPNSRMVLLKEVNSEGFVFFTNYHSRKGRS-----------------------------------L
PDXH_ROSDO      --------------------------------------------------------------------EL
PDXH_JANMA      --NGRPSSRILLIKDFDQRGFTWFTNYESRKGQ-----------------------------------EL
PDXH_VESOH      --NNEIGIRTVLLKYFDMYGFVFFTNYNSKKSK-----------------------------------EL
PDXH_SILST      --SGMPNSRMVLLKEIEDAAFVFYTNYESAKAQEIEASGT------------------------------
PDXH_NITHX      ---GLPDVRMVLMKGYDTQGFVFYSHIASAKGR-----------------------------------EL
PDXH_PHOLL      --NGQPYQRIVLLKHFDSNSLIFYTNLGSRKAK-----------------------------------HL
PDXH_HYPNA      ----------------------------------------------------------------------
PDXH_BAUCH      --TGQPYQRLVLLKHFDAKGMVFYTNLGSRKAQ-----------------------------------HL
PDXH_BLOFL      ---------------------------------------------------------------------I
PHZG_PSEFL      ---GRPSTRIVVISEISDAGVVFSTHAGSQKGR-----------------------------------EL
PHZD_PSECL      ---GRPSTRIVVISEISDTGVLFSTHAGSQKGR-----------------------------------EL


                         .         .         *         .         .         .         .:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
PDX3_SCHPO      KSNPYASLSFWWEPLQRQVRVEGIIERLSREETEEYFKTRPRNSRIGAWASPQSEVI-------------
PDX3_YEAST      --NPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVI-------------
PDXH_CYAP7      AQTPWAALVFWWDALERQVRIEGTVEKVSQEESDAYFASRPWESRLGAWVSDQSRVI-------------
PDXH_MARAV      QENPRAALLFPWIGLNRQVRIQGAVEKVSKAESLRYFSSRPRGSQIGAWVSEQSQVITS-----------
PDXH_BURXL      AANPYASLLFYWIELERQVRVEGRIVKTSAEESDGYFASRPLGSRIGAWASNQSQVI-------------
PDXH_PSYIN      EANPFAALLFHWNILQRQVRIEGRVERISTAQSNAYFQSRGRGSRIGAWASHQSQEL-------------
PDXH_BURPP      AANPYASLLFYWIELERQVRVEGRIVKTSAEESDAYFASRPLGSRIGAWASNQSQLI-------------
PDXH_SACEN      KVTRFAAATFPWLAMQRQVNVRGTVEKVSQEETAEYWAERPRGSQLGAWASPQSRVV-------------
PDXH_BURPS      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURP6      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURP1      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURP0      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURMS      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURMA      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURM9      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURM7      AHNPNAALLFYWIELERQVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_PSEPG      QANPFAAMTFFWPALERQVRIEGRVEKVSAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_BURTA      AHNPNAALLFYWIELERQVRIEGRIEKTTEEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURVG      AANPHAALLFYWIELERQVRIEGRIEKTSTDESDRYFASRPLGSRIGAWASEQSTVI-------------
PDXH_FRASC      --NPFGSLVFPWYALERQVVVIGSIERVSRAETERYFQSRPHGSQLGAWASHQSTII-------------
PDXH_PSEPW      QANPYAAMTFFWPALERQVRIEGRVEKVTPQESDDYYQVRPLGSRLGAWASPQSRVIAS-----------
PDXH_BURS3      AAHPQAALLFYWIELERQVRIEGRIEKTSAEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURCJ      AVHPQAALLFYWIELERQVRIEGRIEKTSAEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURCH      AVHPQAALLFYWIELERQVRIEGRIEKTSAEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURCA      AVHPQAALLFYWIELERQVRIEGRIEKTSAEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURCC      AVHPQAALLFYWIELERQVRIEGRIEKTSAEESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_RALPJ      AANPRAALLFHWIGLERQVRVQGIVEKVSEAESDAYYHSRPLGSRLGAWASEQSS---------------
PDXH_PSEPK      QANPFAAMTFFWPALERQVRIEGRVQKVTAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_PSEP1      QANPFAAMTFFWPALERQVRIEGRVQKVTAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_NOSP7      AENPLAALVFWWAELERQVRICGYVEKVSETESDQYFDTRPPNSRLGAWVSNQSEVI-------------
PDXH_CYAP4      AHDPWAALVFWWAELERQVRIEGSVSQVSAADSDRYFSSRPWGSRLGAWASEQSKAI-------------
PDXH_BURM1      AAHPYAALLFYWIELERQVRIEGRVEKTSAEESDRYFASRPVGSRIGAWASEQSTVI-------------
PDXH1_RALSO     AANPHAALLFHWIGLERQVRVQGVVEKVSEAESDAYYHSRPLGSRLGAWASEQSS---------------
PDXH_PSEPF      AANPFAAMTFFWPTLERQVRIEGRVVKVTPEESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_PSEMY      AARPYAAMTFFWPSLERQVRIEGRVERVTPAESDGYFQVRPLGSRIGAWASPQSRVI-----RD------
PDXH_BURCM      AAHPYAALLFYWIELERQVRIEGRIEKTSTDESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_BURA4      AAHPYAALLFYWIELERQVRIEGRIEKTSTDESDRYFASRPLGSRIGAWASEQSAVI-------------
PDXH_ANAVT      AENPQAALVFWWAELERQVRISGRVEKVSESESDYYFYSRPANSRLGAWVSNQSEIIAS-----------
PDXH_MICAN      IANPNAALVFWWGELQRQIRIEGTVEKISEEESDNYFFVRPWESRLGAWASNQSEVI-------------
PDXH_CUPTR      AANPRAALLFHWVQLERQVRVEGRVEKVSDDESDAYFATRPLGSRVGAWASAQSR---------------
PDXH_ANASP      AENPQAALVFWWAELERQVRISGRVEKVSESESDYYFYSRPANSRLGAWVSNQSEIIAS-----------
PDXH_PSE14      AARPFAAMTFFWPTLERQVRIEGRVEKVSAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_FRAAA      AENPFGSLVFPWYTLERQVVAIGAVERVSRTETEQYFASRPRGSQLGAWASHQSQII-------------
PDXH_SALAI      AANPYASLVFPWFMLQRQVVVTGRVDRLDRAETEAYFASRPRGSQLGAWASEQSRVL-------------
PDXH_RALEH      AANPRAALLFHWVQLERQVRVEGRVEKVSDDESDAYFATRPLGSRVGAWASAQSR---------------
PDXH_PSEE4      AANPFAAMTFFWPALERQVRIEGRVEKVTAKESDDYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_STRAW      AANPYVSLLFPWHPMARQVVVTGLARRTGRDETAAYFRTRPHGSQLGAWASAQSSVIFS-----------
PDXH_PSESM      AAHPFAAMTFFWPALERQVRIEGRVEKVSAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_SYNY3      TAHPWAGLVFWWAALERQVRVDGQVEKIDPAESDAYFQSRPRGSQLGAWASPQSRIV-------------
PDXH_SALRD      SQNPHAALVFLWKPLERQVRIEGTVERLPAEESTEYFHRRPRGAQMGAWASPQSRVV-------------
PDXH_PSEU2      AARPFAAMTFFWPTLERQVRIEGRVEKVSAQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_RALEJ      AANPRAALLFHWVQLERQVRVEGRVEKVADDESDAYYASRPLGSRLGAWASEQSR---------------
PDXH_BORA1      LANPRAALLFFWQALERQVRIEGVVERVSADESDAYFHSRPVGSRIGAWASEQSQPI-------------
PNPO_DICDI      SENPFASMTFLW--TQKQVRIEGSVEKVDRLESEKYFKSRPRSSQIGAWVSE------------------
PDXH_PSEAE      AANPRAAMTFFWPALERQVRIEGSVEKVTPEESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_PSEAB      AANPRAAMTFFWPALERQVRIEGSVEKVTPEESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_BURP8      AQNPHASLLFYWIELERQVRIEGTVVKTSPEESDAYFASRPVGSRIGAWASEQSKV-----------IES
PDXH_BORPD      LANPRAALLFFWQPLERQVRIEGRVEQVSAEESDAYFHSRPLGSRIGAWASRQSQPV-------------
PDXH_PSEFS      AARPFAAMTFFWPTLERQVRIEGRVVKVTPEESDAYYQVRPLGSRLGAWASPQSQVI-----RD------
PDXH_ACAM1      AQRPWAALVFWWAELERQVRIEGKVVKVSDSETKAYFESRPRGSQLGAWASDQSQVIGD-----------
PDXH_PSEF5      AARPFAAMTFFWPTLERQVRIEGRVVKVTPQESDAYYQVRPLGSRLGAWASPQSRVI-------------
PDXH_NOCFA      ----YAAATFVWPVLGRQVHLRGPVERTSAEQTAVYWRSRPRDSQLGAWASQQSRPI-------------
PDXH_RUBXD      EANPRVALLFYWGELERQVRVEGTAGRTSEEESDAYFATRPRGSQLGAWASRQS----------------
PDXH_PSEU5      DASPYAAMTFFWPTLERQVRIEGRVEKVTAEESDAYFQVRPLGSRLGAWASPQSQVI-----RDXXXXXX
PDXH_CYAP8      EENPYVALLFLWLPLERQVKIRGKAAKISTAESFRYFTTRPRGSQLGAWCSEQSSVISS-----------
PDXH_STRCO      DANPHVSLLFPWHPMXXXXXXXXXXXXXXXDETAAYFRTRPHGSQLGAWASVQSSVVAD-----------
PDXH_RHOFD      AGNPYAALQFHWVELERVVRIEGIVEKVSEEESDSYFHSRPLDSRIGAWASPQSQVI-------------
PDXH_BORPE      DANPRASLLFFWQPLERQVRIEGVIEKVSAAESDEYFHSRPLGSRLGAWASRQSQPITRDE---------
PDXH_BORPA      DANPRASLLFFWQPLERQVRIEGVIEKVSAAESDEYFHSRPLGSRLGAWASRQSQPITRDE---------
PDXH_BORBR      DANPRASLLFFWQPLERQVRIEGVIEKVSAAESDEYFHSRPLGSRLGAWASRQSQPITRDE---------
PDXH_RHOBA      RANPRVSLCLFWPHCQRQVRIQGTVDKVSREMSETYFHSRPRDSQLGAHVSQQSSVI-------------
PDXH_RALME      LANPRAALLFHWVQLERQIRVEGIVEKVEDAESDAYYASRPLGSRLGAWASEQSR---------------
PDXH_MYCTU      ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
PDXH_MYCTA      ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
PDXH_MYCS2      AVNAYASATFPWYQLGRQVHVRGAVTKVSAEETAEYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_MYCBT      ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
PDXH_MYCBP      ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
PDXH_MYCBO      ----YASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGS-----------
PDXH_CYAA5      EENPHVALLFLWLPLERQVKIQGTATKVSTAESLNYFTSRPRGSQLGAWCSAQSSVISS-----------
PDXH_MAGSA      AANPHAALCLHWKSLRRQIRVEGSITRVSDEEADAYFATRARASQIGAWASIQSRPL-------------
PDXH_AZOVD      RARPFAAMTFFWPTLERQVRIEGEVEKVSSQESDAYFQVRPLGSRLGAWASPQSRVI-----RD------
PDXH_ACTPJ      EQNPYAALTFFWAELERSVRIEGRIEKISAEESDRYFASRPYTSRVGAWASNQSQVL-------------
PDXH_POLSJ      AGNPYAALQFHWVELERVVRIEGVVEKVSAEESDAYFNSRPLDSRIGAWASPQSEVIAS-----------
PDXH_RUTMC      QINPNVALLFPWLALERQIKISGYVKKVNTFESLKYFSSRPKASQLGAWASQQSSNLSS-----------
PDXH_MYCSJ      ASTPYASATFPWFALGRQVHVRGPVTKVSAEETADYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_AGRT5      LGQKKAAMCFHWKSLRRQVRLRGEVEIVSDEEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_MYCSS      ASTPYASATFPWFALGRQVHVRGPVTKVSAEETADYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_MYCSK      ASTPYASATFPWFALGRQVHVRGPVTKVSAEETADYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_ENTS8      ENNPRISLLFPWHMLERQVMVTGKAERLSTLEVVKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ESCF3      ESNPRVSLLFPWHTLERQVMVTGKAERLSTLEVVKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ERWT9      EKNPRISLLFPWHMLERQVMVLGSVERLSTLEVLKYFHSRPRDSQLGAWVSKQS----------------
PDXH_MYCVP      AAAPYASATFPWYLVGRQVHVHGAVTKVSAEETADYWSKRPRGSQLGAWASQQSLPIAS-----------
PDXH_METPP      AAHPFAALQFHWVDLERVVRIEGRVEKVSDTESDAYYRSRPLDSRLGAWASPQSQVIAS-----------
PDXH_ACTP2      EQNPYVALTFFWAELERSVRIEGRIEKISAEQSDNYFASRPYTSRVGAWASNQSQVLSSKS--ELVAKAA
PDXH_ACIAC      AGNPFAALQFHWVELERVVRIEGRVEKVSDAESDAYFASRPLDSRIGAWASPQSEVI-------------
PDXH_SPHWW      -----AALLFHWKSLRRQVRIEGPVSKVSPEEGDAYFATRHRDSQIGAWASDQSRPL-------------
PDXH_RHIME      LATRKAALCFHWKSLRRQVRLRGPVEIVSDEEADEYFMSRPRGSRIGAWASKQSRPL-------------
PDXH_POLNA      AGNPYAALQFHWVELERVVRIEGVVEKVSDEESDAYFHSRPLDSRIGAWASPQSEVI-------------
PDXH_ACTP7      EQNPYVALTFFWAELERSVRIEGRIEKISAEQSDNYFAGRPYTSRVGAWASNQSQVLSSKS--ELVAKAA
PDXH_SHIFL      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_SHIF8      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_SHIDS      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_SHIBS      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_LEPBP      EQNRNVALTFFWPKMERQIRIEGTVTKIPKEESEAYFKIRPRESQLGALTSNQSSVVVSREE--------
PDXH_LEPBA      EQNRNVALTFFWPKMERQIRIEGTVTKIPKEESEAYFKIRPRESQLGALTSNQSSVVVSREE--------
PDXH_ECOSM      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOLU      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOLI      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOLC      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOHS      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECODH      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOBW      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO7I      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO27      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_BRUSU      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUSI      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUME      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUMB      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUC2      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUAB      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUA2      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_BRUA1      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_AERS4      EGNPRISLLFPWHTLDRQVHVTGRVEKMSTFEVMKYFHSRPKDSQIAAWVSKQSTRI-------------
PDXH_ACISJ      AGNPYAALQFHWVELERVVRIEGVVEKVSEAESDAYFHSRPLDSRIGAWASPQSQVIPS---RGMLVANA
PDXH_RHISN      LSTRKAAMCFHWKSLRRQVRLRGPVEIVTAEEADEYFRSRPRGSRIGAWASKQSRPL-------------
PDXH_MYCLE      AATPYASVTFPWYQLGRQVHIRGPVSTVDPQVSEDYWSKRPRGSQLGAWASHQSRPIAS-----------
PDXH_GLUOX      LANPHVALLFHWKSLRRQIRIEGPVEAVSAAEADAYFASRSRMSRLGAIASDQSRPL-------------
PDXH_ECO24      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_BDEBA      ETNPIVCLNFHWPAIWQQIRITGKAEKISAAESDAYFATRARLSQIGAWASHQSETIPALD---------
PDXH_SHISS      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_SHIB3      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_MYCGI      AARPYASATFPWYLLGRQVHVRGRVTKVSAEETADYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_ECOUT      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOSE      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOL6      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOL5      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECOK1      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO8A      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO81      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO55      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ECO45      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQS----------------
PDXH_BRUO2      -----AAMCFHWKSLRRQVRVRGPVEKVSDAEANAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_SPHAL      AANPHVALLFHWKSLRRQIRIEGSVAPVDNATADAYFATRSRDSQIGAWASDQSRPL-------------
PDXH_HAEIN      EHNPYVALTFFWPELERQVRIEGKAVKIPAEQSDKYFATRPYTSRIGAWASEQSAVI-------------
PDXH_HAEI8      ERNPYVALTFFWPELERQVRIEGKAVKIPAEQSDKYFATRPYTSRIGAWASEQSAVI-------------
PDXH_ERWCT      ENNPRISLLFPWHVLERQVMVLGRVEKLPALEVLKYFHSRPKDSQIGAWVSKQS----------------
PDXH_ECO5E      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGSWVSKQS----------------
PDXH_ECO57      ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGSWVSKQS----------------
PDXH_COLP3      AENNKVALLFHWNVLQRQIRIEGTVEKVSIQESADYFHSRDRGSQVGAWASKQSQKL-------------
PDXH_MESSB      LSSMKAAMCFHWKSLRRQVRVRGPVEKVTDEEANAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_KLEP7      ENNPQVSLLFPWHMLERQVMVIGKAERLSTLEVVKYFHSRPRDSQIGAWVSKQS----------------
PDXH_ALHEH      AENPRAAVCFHWAPLAEQVVIEGVVTPVAEAEADAYWAGRPRESQIGGWASHQSRGL-------------
PDXH_AGRRK      LSQKKAAMCFHWKSLRRQVRLRGLVEVVSDKEADEYYKTRARGSRIGAWASKQSRPL-------------
PDXH_AERHH      EGNPRISLLFPWHTLDRQVHVTGRVEKMSTFEVMKYFHSRPKDSQIAAWVSQQSTRI-------------
PDXH_VEREI      AGNPCAALQFHWVELERVVRIEGLVQKVSDQESDAYFDSRPLDSRIGAWASPQSQVI-------------
PDXH_MYCPA      AATPYAAVTFPWYQLGRQVHLRGPVSKVTAQVTEDYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_MYCA1      AATPYAAVTFPWYQLGRQVHLRGPVSKVTAQVTEDYWSKRPRGSQLGAWASQQSRPIAS-----------
PDXH_CITK8      ENNPRISLLFPWHMLERQVMVTGKAERLSTLEVVKYFHSRPRDSQIGAWVSKQS----------------
PDXH_TERTT      AGNPCVSLHFPWHFMERQVKVQGEAVKISTAETLKYFLTRPRESQLAAWASEQSQRI-------------
PDXH_SALTY      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALTI      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALSV      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALPK      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALPC      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALPB      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALPA      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALNS      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALHS      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALG2      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALEP      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALDC      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALCH      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_SALA4      EHNPRISLLFPWHMLERQVMVTGKAERLSTLEVVRYFHSRPRDSQIGAWVSKQS----------------
PDXH_DICNV      EKNAQVSMSFPWYALQRQIHVYGRAEKIPREQSLAYFLTRPQGSQIGAWASPQSKII-------------
PDXH_VIBVY      EHNSKISLHFPWHPLERQVHITGVAEKLTAMENMKYFTSRPKESQLAAMASRQS----------------
PDXH_VIBVU      EHNSKISLHFPWHPLERQVHITGVAEKLTAMENMKYFTSRPKESQLAAMASRQS----------------
PDXH_POLSQ      -----AALLFHWHELERQVRIKGLVERVSATESDEYFHSRPPASRIGAWASPQSA--------------A
PDXH_OCHA4      -----AAMCFHWKTLRRQVRVRGAVEKVSDAEADAYYASRPRGSRIGAWASKQSRPL-------------
PDXH_CHRSD      TNVPYAALVFWWPTLQRQIRIEGRVEKASAEVSDAYFANRPRDSQLGAWISQQSV---------------
PDXH_RHIEC      LGQKKAAMCFHWKSLRRQVRLRGPVEIVSDAEADAYFKTRARGSRIGAWASKQSRPL-------------
PDXH_PROMH      EHNQRVSLLFPWYPLERQVCFLGKAEKLSAFEVVKYFHSRPKDSQIAAWASKQS----------------
PDXH_LEPBL      EENPRACLVFFWSELERQVRIEGGVKKVSREESNVYFHSRPRGSQIGAVVSPQSY---------------
PDXH_LEPBJ      EENPRACLVFFWSELERQVRIEGGVKKVSREESNVYFHSRPRGSQIGAVVSPQSY---------------
PDXH_ENT38      ENNPRISLLFPWHMLERQVMVTGKAERLSTLEVLKYFHSRPRDSQIGAWVSKQS----------------
PDXH_CYTH3      THNSFGALNFFWPELERQVRIEGKITKVSPEDSDTYFNSRPYQSKIGAWVSDQSK---------------
PDXH_SHELP      AHNNKVSLLFPWHALERQVAVTGVAEQLSTTEVLKYFVTRPKESQIAAWVSKQSSKI-------------
PDXH_SHESR      AANNKVSLHFPWHSIERQVSILGEAQPLSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_RHIL3      LGQKKAAMCFHWKSLRRQVRLRGPVEIVTDAEADAYFKTRARGSRIGAWASRQSRPL-------------
PDXH_THEEB      AAHPKAALVFWWAELERQVRIEGNVEQISAAESDAYFQSRPLGSRWGAWASQQSEVL-------------
PDXH_PSEA7      AANPRAAMTFFWPALERQVRIEGEIEKVTAQESDAYYQVRPLGSRLGAWASPQSRVIXXXXXXXXXXXXX
PDXH_LEPCP      AGNPFAALQFHWVTQERVVRIEGRVEKTSAEESDAYYDSRPLDSRLGAWASPQS-----------QPIGS
PDXH_COXBU      DENPQAAWVFYWPKTYKQVRGEGRVERLTQEESEAYFETRSYESQIAAWVSEQS----------------
PNPO_BOVIN      DSNPFASLVFYWEPLHRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVI-------------
PDXH_RHILO      LGSMKAAMCFHWKSLRRQVRIRGPVEIVSDAEADAYYATRPRGSRIGAWASKQSRPL-------------
PDXH_BARBK      LKSMKASLVFHWKSLRRQIRIRGLVEQVSPEEADAYFQSRPYGSQIGAWASKQSQLL-------------
PDXH_THEFY      AREPRACVVFPWHAIRRQVIVYGFAERLSDEENDAYFAQRPHGSQLGAWASEY-----------------
PDXH_SHEAM      KHNAHISLLFPWHPLERQVAVTGIAEPLSTAEVLKYFVTRPKDSQIAAWVSAQSSKL-------------
PDXH_RHORT      LANPHAALCFHWKSLRRQVRVEGPVVAVSDAEADAYFASRHRDSRIGAWASMQSRPL-------------
PDXH_RHIE6      LGQRKAAMCFHWKSLRRQVRLRGPVEIVSDAEADAYFKTRARGSRIGAWASKQSRPL-------------
PDXH_AZOC5      TAHPKAALVFHWKSLRRQVRVRGPVERVTDAEADAYFATRPRLSQIGAWASQQSRPL-------------
PDXH_ARCB4      KENPKAAALFPWLDLERQVKIEGDIQKISTTESLKYFLSRPKGSQIGAWVSHQSQVISS-----------
PDXH_VIBPA      EHNSNISLHFPWHPLERQVHITGVAEKLTAMENMKYFTSRPKDSQLAAIASKQS----------------
PDXH_SHESM      AANNKVSLHFPWHPIERQVSILGEAQPLSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SHEB9      AANNKVSLHFPWHPLERQVSVLGEAQALSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SHEB8      AANNKVSLHFPWHPLERQVSVLGEAQALSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SHEB5      AANNKVSLHFPWHPLERQVSVLGEAQALSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SHEB2      AANNKVSLHFPWHPLERQVSVLGEAQALSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SERP5      ANNPHISLLFPWHMLDRQVIFLGKAERLSTFEVMKYFASRPKDSQIGAWVSQQS----------------
PDXH_SACD2      AEQSHVSLHFPWHMMERQVSVGGVASKISYAETLKYFVSRPKDSQIAAWASAQSKPISS-----------
PDXH_ACIC1      SENPSASLCFPWFAIGRQVVVLGXXXXXXXXXXXXYFASRPRDSQCGAWSSEQSSVVPS-----------
PDXH_BARQU      LKSMKASLVFHWKSLRRQIRIRGIVEKVSTQEADVYFQSRPRGSRIGAWASKQSQPL-------------
PDXH_ANAPZ      ALNPCVSLVFDWRPIYKQVRVEGIAEFMDASESDAYFASRSRESQIGAWCSRQSMIL-------------
PDXH_SHESA      ATNNKVSLHFPWHPIERQVSILGEAQPLSTAEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_RHILW      LGQKKAAMCFHWKSLRRQVRLRGPVEIVTDAEADAYFKTRARGSRIGAWASKQSRPL-------------
PDXH_PROMM      SAHPNVSLLFPWYDLERQVAIMGPAERISRAESQAYFSSRPFGSRLGVWXXXXXXXXXXXXX--------
PDXH_PROM3      SAHPNVSLLFPWYDLERQVAIMGPAERISRAESQAYFSSRPFGSRLGVWXXXXXXXXXXXXX--------
PDXH_VIBFM      EQHSKISLHFPWHPLERQVHITGTAEKLTALENMKYFTSRPKESQIAAWASKQS----------------
PDXH_VIBF1      EQHSKISLHFPWHPLERQVHITGTAEKLTALENMKYFTSRPKESQIAAWASKQS----------------
PDXH_MARMM      ADNPQAALCFHWKSLRRQVRVRGAVEPVSAGEADAYFASRARDSRIGAWASKQSRPL-------------
PDXH_EDWI9      EENPRISLHFPWHMLDRQVSITGTAHRLTALEVMKYFHSRPKDSQIAAWVSHQSARIST-----------
PDXH_ALTMD      SVNPKVSCHFPWFFMERQVRVCGSVEKLSVSENAAYFFSRPKDSQLAAYASKQSKPIGS-----------
PDXH2_THICR     QHNPKVALHFNWLELERQVKIQGVAAKISLKDSMRYFATRPKGSQIGAWVSHQSEVISS-----------
PDXH_SHESW      AANNKVSLHFPWHPLERQVSVLGEAQALSTTEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_SHEON      AANNKVSLHFPWHPIERQVSILGEAQPLSTAEVLKYFMTRPKESQIAAWVSQQSSKL-------------
PDXH_PARL1      KENSRAALCFHWKSLRRQVRVRGDVIPVSKEEADAYFATRARDSQIGAWASKQSRPL-------------
PDXH_CAUCR      NAHPKAALLFHWKSLRRQVRIRGTVEPVTEAEADAYFASRARHSQIGAWASDQSQPL-------------
PDXH_CAUCN      NAHPKAALLFHWKSLRRQVRIRGTVEPVTEAEADAYFASRARHSQIGAWASDQSQPL-------------
PNPO_HUMAN      DSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVI-------------
PDXH_XANAC      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASRQSQALGSREEFDAA----
PDXH_SODGM      AHNPRISLHFPWHVLERQVLVLGRAERLSVIEVMKYFHSRPRDSQIGAWVSRQSSRISS-----------
PDXH_VIBHB      GHNSNISLHFPWHPLERQVHITGVAEKLTPMENMKYFTSRPKESQLAAIASKQS----------------
PDXH_CHRVO      EANPYVALNFFWPELERQVRIEGKAARVAPEVSDAYFASRPYTSRLGAWASEQSREIAS-----------
PDXH_YERPS      AENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERPN      AENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERPG      AENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERPE      AENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERPA      AENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERP3      AENPHISLLFPWHMLDRQVVFLGKAERLSTLEVLKYFHSRPKDSQIGAWVSQQS----------------
PDXH_YERE8      AQNPHISLLFPWHMLDRQVIFLGTTERLSTLEVLKYFSSRPKDSQIGAWVSQQS----------------
PDXH_PHOPR      SHNSKISLHFPWHAIERQVHITGEVEKLSSLEVMKYFTSRPKESQIAAWASKQSNRI-------------
PDXH_XANC5      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASRQSQTLGSREEFDA-----
PDXH_HALHL      ADNPRAALCLHFQPLYEQVEIRGVVAAVSASEADRYWAQRERLSQLGAWASHQSEPLAS-----------
PDXH_XANP2      AQTPKAALVFHWKSLRRQVRVRGPVEQVTADEADAYFATRPRLSQIGAWASSQSRPL-------------
PDXH_XANOR      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASLQSQTLGS-----------
PDXH_XANOM      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASLQSQTLGS-----------
PDXH_XANCP      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASLQSQTLGSREE--------
PDXH_XANC8      QTHPQAALLFLWRSLREQVRIEGGVQLVSADESDAYFASRPRMSQIGAWASLQSQTLGSREE--------
PDXH_SHEWM      AHNAKVSLLFPWHSLERQVAITGEAEALSTADVMKYFITRPKESQIAAWVSQQSSKI-------------
PDXH_SHEDO      AINKQISLLFPWHPLERQVAVLGEAEPLSMMEVAKYFISRPKDSQIAAWVSKQSSKITA-----------
PNPO_MOUSE      DSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPKSSQIGAVVSRQSSVI-------------
PDXH_PSEHT      KGNNKISLHFPWHPMERQVIVYGEAKPLPTSAVAKYFLSRPKESQLAAWASAQSRPVSS-----------
PDXH_SHEPC      AANNKVSLHFPWHPLERQVSVLGEAQALSTTEVLKYFMTRPKDSQIAAWVSQQSSKL-------------
PDXH_EHRRW      SENPFVSLVFDWRQISKQVRIEGKIETLSPEDSDRYYATRSRGSQISACCSKQSNIL-------------
PDXH_EHRRG      SENPFVSLVFDWRQISKQVRIEGKIETLSPEDSDRYYATRSRGSQISACCSKQSNIL-------------
PDXH_ALISL      EDNSKISLHFPWHPLERQVHITGTAEKLTALENMKYFTSRPKESQIAAWASKQS----------------
PDXH_VIBSL      EHNSKISLHFPWHPLERQVHITGTAEKLTAMENMKYFSSRPKESQLAAIASKQS----------------
PDXH_EHRCR      AENPSVALVFDWSRISKQVRIEGRIKMLPCNDADEYYASRPRGSQIGAWCSKQSSVL-------------
PDXH_ANAMM      ADNPQVALVFDWRHIGRQVRVEGLATLMDASESDAYHASRSRESKISAWCSQQSAVL-------------
PNPO_RAT        DSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPKSSQIGAVVSRQSSVI-------------
PDXH_PSEA6      LTNSKISLHFPWHILERQVLVRGSASLLPRQDVQHYFSSRPLSSQLAAWTSKQSQPI-------------
PDXH_BARHE      LKSMKASLVFHWKSLRRQVRIRGIVEKVTPQEADAYFQSRPRDSRIGAWASKQSQPL-------------
PDXH_AGRVS      LSQKKAAMCFHWKSLRRQVRLRGEVEVVSDAEADAYYQTRPIGSRIGAWASKQSRPL-------------
PDXH_SINMW      ---RKAAMCFHWKSLRRQVRLRGXXXXXXXXXXXXYFVSRPRGSRIGAWASKQSRPL-------------
PDXH_SHEFN      ATNSKISLLFPWHPLERQVAVLGEAEPLSMLDVAKYFMSRPKDSQIAAWVSKQSSKI-------------
PDXH_FLAJ1      EANPNVCLSFFWQEAERQVIIKGIAQKTSEIISDNYFDSRPDGSKLGAIVSHQSEVIPS-----------
PDXH_RHOSR      EAVPYASVTFTWVPVARQITVRGPVERVSAEVTDEYWHSRPRGSRLGAWASEQSKPIGS-----------
PDXH_WOLPM      TENPKAALVFHWIEFARQVRIEGEVKLLNDERTDKYFSSRALGSQISAWCSKQSSIL-----KDWQD---
PDXH_PELUB      KNNPKASMCFHWKSLLRQVRINGMVQKVSNKVADEYYSSRGYESRIGAWASKQSTVI-------------
PDXH_HAEDU      ALNPYVALTFFWPELERSVRVEGIATKLSEQASDDYFASRPYASRIGAWASDQSQVLSS-----------
PDXH_LEPIN      ETNPNVCLVFFWPELERQVRIEGNVTKVSREVSKEYFHSRPRESQIGALASPQSQKI-------------
PDXH_LEPIC      ETNPNVCLVFFWPELERQVRIEGNVTKVSREVSKEYFHSRPRESQIGALASPQSQKI-------------
PDXH_SHEPA      ANNAQVSILFPWHSLDKQVAVTGIAEPLSKTEVLKYFMSRPKESQIASWVSKQSSPI-------------
PDXH_KINRD      -----VALLFTWHGTHRQVAVRGTAEEVPRAETEAYFASRPYGSRIGAWVSEQSR--------------T
PDXH1_THICR     DQNAKAALLFFWPELDRQIRIEGSLQKVPRETSEAYFHSRPKDSQLAASISNQSQPVAS-----------
PDXH_SHESH      AINSKVSLLFPWHSLERQVAITGEAEPLSTAEVMKYFITRPKESQIAAWVSKQSSKI-------------
PDXH2_RALSO     AENMQAAAVLHWKSLRRQVRFRGTVNRVSAEEADAYFVSRARASRIGAWASKQSRPL-------------
PDXH_DEIRA      AANPQAEVLFYWAELERQVRAFGTVSRVPEAESNDYFHKRPRESQLAAHAS-------------------
PDXH_DEIDV      TDNPQAEVLFFWAEHERQVRAYGPVERLSSEDSAAYFHSRPRESQLAAHASDPQSAPVSN----------
PDXH_BRASB      AGNPKAALLFHWKSLRRQVRIRGLVTPVTDEEADAYFATRPKQAQLGAWASKQSQPL-------------
PDXH_ZYMMO      --NPVATLLFHWKKLRRQVRIEGAATLISDEEADAYFATRARKSQLGAWASEQSRPL-------------
PDXH_SHEHH      ANNAQVSILFPWHSIDKQVAVTGIAEPLSKTEVLKYFMSRPKESQIAAWVSKQSSPI-------------
PDXH_PSYWF      EQNPHAEALFFWHDMQRQVRVRGVIAKVDRAKTEAYFQKRPYESQVGAWVSQP-----------------
PDXH_GRABC      AANPQVALLFHWKSLGRQIRIEGKAIPVAVEEAESYFHTRPRISRLGARASDQSRPL-------------
PDXH_DEIGD      AQNPQAELLFFWADLERQVRAYGPVERVSEEESTAYFHARPRESQIAAHASDPQ---------------S
PDXH_NOCSJ      AANPRCSLLFPWHPLERQVRVDGVAAPLPRADVEAYFASRPRASQLGAWASHQSEVV-------------
PDXH_WIGBR      KNNSKVSLLFPWNILDRQVLFLGYAKKIPQDDIKKYFYTRSKNSQISVWASKQSQIIKK-----------
PDXH_FLAPJ      ANNPNICLSFFWHSLERQIIIKGKVKKIAENLSDGYFESRPNGSKLGAIVSNQSEVIAS-----------
PDXH_ACICJ      RANPDVSLLFHWKSLRRQIRIEGRCRAVSDDEADAYFDSRPRISRLGAWASDQSRPL-------------
PDXH_EHRCJ      TDNPFAALVFDWSYIAKQVRIEGKVKILPCQDADEYYASRPVGSKIGAWCSKQSSVL-------------
PDXH_BACTN      AQNPYISLSFVWHELERQVHIEGTAAKVSPEESDEYFRKRPYKSRIGARISPQSQPI-------------
PDXH_RHOPT      AANPKAALLFHWKSLRRQIRIRGTVTPVTDTEADAYFATRPKQAQIGAWASKQSQPL-------------
PDXH_RHOPA      AANPKAALLFHWKSLRRQIRIRGTVTPVTDTEADAYFATRPKQAQIGAWASKQSQPL-------------
PDXH_ANADE      AANPRAALCFHWPALEEQVRVEGAVTPLPDAEADAYFRSRPRESRVGAWASRQSAPL-------------
PDXH_RHOPS      AANPKAALLFHWKSLRRQVRIRGAVSAVTETEADDYFATRPKQAQIGAWASKQSQPL-------------
PDXH_RHOP5      AANPKAALLFHWKSLRRQVRVRGLVAPVTDAEADAYFATRPKQAQIGAWASKQSQPL-------------
PDXH_JANSC      QAGK-AAFVCHWKSLHRQIRVRGLTETEDGPQADAYYASRSLKSRLGAWASDQSKPLSS-----------
PDXH_BRAJA      AANPKAALLFHWKSLRRQVRIRGNVTPVTDAEADAYFATRPKQAQIGAWASKQSEAL-------------
PDXH_RHOS4      ETSGKAAFVLHWKSLRRQIRVRGLVEREEGAQADAYYASRSLKSRLGAWASEQSRPLAS-----------
PDXH_RHOP2      TANPKAALLFHWKSLRRQVRIRGTVTPVSDAEADAYFATRPKQAQIGAWASKQSQPL-------------
PDXH_CAEEL      EENPNAAMLFYWPKVNRQIRVEGVVEKLPDEMAVAYWNSRPVASRIGSKSSDQSKVV-----PDREFLES
PDXH_XYLFT      QANPQAALLFLWRSLREQVRIEGRVQQVLAEEADAYFASRPRQSQIGAWASMQSCPLGSPEE--------
PDXH_RHOS1      ETSGKAAFVLHWKSLRRQIRVRGLVEREEGVQADAYYASRSLKSRLGAWASEQSRPLAS-----------
PDXH_PSYA2      AENPNAEALFFWHKLERQIRISGSIAKIDADKSAAYFQKRPHDSQVGTWVSQP-----------------
PDXH_PSEA8      AANPRAAMTFFWPALERQVRIEGSVEKVTPEESDAYYQVRPLGSRLGAWASPQSRVI----XXXXXXXXX
PDXH_GRAFK      DENPKCCISFFWPSLEKQIIIQGXXXXXXXXXXXXYFHSRPRGSQLGAHASNQSSVIPS-----------
PDXH_ACTSZ      -----------WPELERQVRVEGHVVKLDEIKSDEYFASRPYTSRVGAWASEQSAVI-------------
PDXH_XYLFA      QANPQAALLFLWRSLREQVRIEGRVQQVLAEEADAYFASRPRQSQIGAWASMQSCPLGSPEE--------
PDXH_HERAR      EKNPYAALLFHWIALXXXXXXXXXXXXXSAEESEQYFQSRP-----------------------------
PDXH_ACIBS      AENPYAELLFYWPSLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAYIS-------------------
PDXH_PSYCK      ENPNVEALFF-WHKLERQIRISGSIAKIDADKSAAYFQKRPHDSQVGAWVSQP-----------------
PDXH_PORGI      AANPHVCLTFLWHELERQIHVEGDVRILEPELSDAYFATRPYKSRVGARISPQSR--------------P
PDXH_RHOPB      AANPKAALLFHWKSLRRQVRVRGAVTPVSDAEADAYFATRSKQSQIGAWASKQSQPLESRFAFE----QA
PDXH_PORG3      AANPHVCLTFLWHELERQIHVEGDVRILEPELSDAYFATRPYKSRVGARISPQSR--------------P
PDXH_BLOPB      ANNPKVSLCFLWNVIDRQVIITGSVDKLPEKEVLKYFYTRPKNNQISTWVSNQSKVISS-----------
PDXH_BACFR      AKNPYISLSFVWHALERQVHIEGIASKVPAGESDTYFRQRPYKSRIGARISPQSRPL-------------
PDXH_BACFN      AKNPYISLSFVWHALERQVHIEGIASKVPAGESDTYFRQRPYKSRIGARISPQSRPL-------------
PDXH_ACIBY      AENPYAELLFYWPSLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTQSGKIESREXXXXXXXXX
PDXH_ACIBT      AENPYAELLFYWPSLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTQSGKIESREXXXXXXXXX
PDXH_ACIBC      AENPYAELLFYWPSLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTQSGKIESREXXXXXXXXX
PDXH_ACIB5      AENPYAELLFYWPSLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTQSGKIESREXXXXXXXXX
PDXH_ACIAD      AENPYAELLFYWPSLERQVRIGGIVNKISEHESTDYYHKRPRDSQIAAHISTPQS-----------GIIA
PDXH_NITWN      AANPKAALLFHWKSLRRQVRVRGPVTPVTDAEADAYFATRPRQAQIGAWASRQSRPL-------------
PDXH_ERYLH      RANAQTALLFHWKSLRRQIRVEGPVREVAPEVADAYFHSRARESQLGAVASDQSRPL-------------
PDXH_BRASO      AANPKAALLFHWKSLRRQVRIRGLVTPVTDAEADAYFATRPKQAQLGAWASKQSQPL-------------
PDXH_MANSM      AVNPFAAVNLFWAELXXXXXXXXXXXXISPQASDEYFASRPYTSRIGAWASEQSAVI-------------
PDXH_LEGPH      QKNPYAALNFYWPQMARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQ----------EILDR
PDXH_LEGPC      QKNPYAALNFYWPQMARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQ----------EILDR
PDXH_LEGPA      QKNPYAALNFYWPQMARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQ----------EILDR
PDXH_ALCBS      AANPKVSFTMFWQPFDRQMIVIGEAQKVDQEESDSYFASRPYASQVSAAISPQSRPA-------------
PDXH_LEGPL      QKNPYAALNFYWPQMARQVRVRGRVKKISSEQSDAYFSSRPIKSQFSAIVSPQSQ----------EILDR
PDXH_MYXXD      RAHPYAALCFYWQPLNXXXXXXXXXXXXTDAEADAYFQSRARGSQVGAWASLQS----------------
PDXH_MYXXA      RAHPYAALCFYWQPLNXXXXXXXXXXXXTDAEADAYFQSRARGSQVGAWASLQS----------------
PDXH_HAHCH      AENANVSLHFAWLPMERQICVTGVAEKLSIAEATRYFLSRPHEXXXXXXXXXXXXGIGS-----------
PDXH_VIBCM      AHNNKISLHFPWHPLERQVHITGVAEKLTAMENMKYFMSRPK----------------------------
PDXH_VIBCH      AHNNKISLHFPWHPLERQVHITGVAEKLTAMENMKYFMSRPK----------------------------
PDXH_PARDP      EATGVAAFVMHWKSLRRQIRVRGHVTRVEPELADAYYASRPLQSRIGAWASRQSRPLASR--------GA
PDXH_VIBC3      AHNNKISLHFPWHPLERQVHITGVAEKLTAMENMKYFMSRPK----------------------------
PDXH_NOVAD      AANHHVALLFHWKSLRRQIRIEGTIAKVTPAEADAYFASRHPESRLGSAASDQSRPL-------------
PDXH_IDILO      SENPQVALHFAWLPLERQISIIGSAVPLDDDDNDRYFHSRPKESQVAALASQQSRPV-------------
PDXH_SILPO      -----AAFVMHWKSLRRQLRVRGTITREEGPQADDYYASRSLKSRLGAWASRQSRPLSS-----------
PDXH_NEIMF      DAHPFAAMTFFWPXXXXXXXXXXXXXXLAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_NEIMA      DAHPFAAMTFFWPXXXXXXXXXXXXXXLAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_NEIG2      ELNPFAAMTFFWPXXXXXXXXXXXXXXXAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_NEIG1      ELNPFAAMTFFWPXXXXXXXXXXXXXXXAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_NEIMB      DAHPFAAMTFFWPXXXXXXXXXXXXXXLAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_NEIM0      DAHPFAAMTFFWPXXXXXXXXXXXXXXLAEKLSDEYFESRPYQSRLGAWASAQSEV--------------
PDXH_ROSDO      DGAGKAAFVMHWKSLRRQIRVRGHVSREDGDAADAYFASRSLKSRLGAWASKQSRPLSS-----------
PDXH_JANMA      AQNPHAALLFHWIPLXXXXXXXXXXXXXSSAESEQYFQSRPVKSRLSALASSQSHPVAD-----------
PDXH_VESOH      QSNPNVALLFPWLVLERQVKISGYVEKISMLESLKYF---------------------SSRPK-------
PDXH_SILST      -----ASFVMHWKSLRRQIRVRGHVTKENGPQADEYFASRSLKSRLGAWASKQSQPLASRS---------
PDXH_NITHX      AANPKAALLFHWKSLRRQVRLRGPVTPVTDAEADAYFATRPKQAQIGAWASKQSQPL-------------
PDXH_PHOLL      AHNNKISLHFPWYPLERQVSFLGKAERLSPVEVVKYFHSR---------------------PRDXXXXXX
PDXH_HYPNA      ----------------------------------------------------------------------
PDXH_BAUCH      AHNARISLHFPWHALERQVMVLGTAKQLALKEVMHYFSSRPRNXXXXXXXXXXXXLI-------------
PDXH_BLOFL      NNNPKISLCFPWNIINRQIIITGSVYKISKKEAQKYFYTRPKNNQISTWASKQSTIISSXXXXXXXXXXX
PHZG_PSEFL      LHNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSE--------ELQDVQA
PHZD_PSECL      TENPWASGTLYWRETSQQIILNGQAVRMPDAKADEAWLKRPYATHPMSSVSRQSE--------ELKDVQA


                         +         .         .         .         .         *         .:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
PDX3_SCHPO      -------------------ADREELEKRVEEYKKKFGEDESVPVPDFWGGIRIVPLEIEFWQGGKYRLHD
PDX3_YEAST      -------------------KNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
PDXH_CYAP7      -------------------ESREVLENRLQALKDKY-QAQDVPRPPHWGGFRVMPEKIEFWQGRPNRLHD
PDXH_MARAV      ---------------------RGLLEQKVAEMKRKFS-SGEIPLPSFWGGYRVVPERIEFWQGRPSRLHD
PDXH_BURXL      -------------------ESRSQLETREREFSLLYGD--QPPRPPHWGGYRLVPEAIEFWQGRPSRLHD
PDXH_PSYIN      -------------------NDRQTLVERVKYFEEKFAG-KEIPLPEFWGGYRVIPESIEFWQGKADRLHD
PDXH_BURPP      -------------------ESRSQLETREREISLQYGD--QPPRPPHWGGYRLVPEAIEFWQGRPSRLHD
PDXH_SACEN      -------------------SGRSALESTLNGIERRFADAEKVPVPPHWGGWRIVPESVEFWQGRPDRLHD
PDXH_BURPS      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURP6      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURP1      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURP0      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURMS      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURMA      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURM9      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_BURM7      -------------------ESRALLEAREKEIGARFG--ENPPRPPHWGGYRLVPSSIEFWQGRPSRLHD
PDXH_PSEPG      -------------------AGREELEGLVKATEARFSDTQP-HCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_BURTA      -------------------ESRALLEAREKEISARFG--ENPPRPPHWGGYRLVPSTIEFWQGRPSRLHD
PDXH_BURVG      -------------------DSRATLEAREKEVAARYG--ENPPRPPHWGGYRLVPDAIEFWQGRPSRLHD
PDXH_FRASC      -------------------ESRTVLDDRAAELAARWPEGTRVPTPEFWGGLRIVPDTVEFWQGRADRLHD
PDXH_PSEPW      ---------------------REALEGLVKATEARFSDTQP-HCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_BURS3      -------------------DSRATLEAQEQAVSERYGDNP--PRPPHWGGYRLVPDSIEFWQGRPSRLHD
PDXH_BURCJ      -------------------DSRATLEAREKAVSERYGDNP--PRPPHWGGYRLVPDSIEFWQGRPSRLHD
PDXH_BURCH      -------------------DSRATLEAREKAVSERYGDNP--PRPPHWGGYRLVPDSIEFWQGRPSRLHD
PDXH_BURCA      -------------------DSRATLEAREKAVSERYGDNP--PRPPHWGGYRLVPDSIEFWQGRPSRLHD
PDXH_BURCC      -------------------DSRATLEAREKAVSERYGDNP--PRPPHWGGYRLVPDSIEFWQGRPSRLHD
PDXH_RALPJ      -----------------EVPDRATLEAREAEYRQRFGDAP--PRPPHWGGYRLLPERLEFWQGRPSRLHD
PDXH_PSEPK      -------------------AGREELEGLVKATEARFSDTQP-HCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_PSEP1      -------------------AGREELEGLVKATEARFSDTQP-HCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_NOSP7      -------------------ESREVLERRMQEFYSKY-ENQEIPRPPHWGGLRVIPTEIEFWQGRSSRLHD
PDXH_CYAP4      -------------------TGREVLEQNLRALEQEYRD-REVPRPPHWGGYRLSPTLIEFWQGRPNRLHD
PDXH_BURM1      -------------------DSRATLEAREKAFSERYGD--DPPRPPHWGGYRVVPDTLEFWQGRPSRLHD
PDXH1_RALSO     -----------------EVPDRAVLEAREAEYRERFGDAP--PRPPHWGGYRLLPERIEFWQGRPSRLHD
PDXH_PSEPF      -------------------NGRGELEDLLKATEQRFTDTQP-HCPEHWGGYRLLPERVEFWQGRASRLHD
PDXH_PSEMY      ---------------------RAELENLLAETEKRFLN-QAPHCPPHWGGYRLLPERIEFWQGRPSRLHD
PDXH_BURCM      -------------------DSRATLEAREKAVAERYG--ENPPRPPQWGGYRVVPDAIEFWQGRPSRLHD
PDXH_BURA4      -------------------DSRATLEAREKAVAERYG--ENPPRPPQWGGYRVVPDAIEFWQGRPSRLHD
PDXH_ANAVT      ---------------------REVLEQRMQEFQHKY-ENQEIPRPSHWGGLRVIPSQIEFWQGRSSRLHD
PDXH_MICAN      -------------------SGRDILEKRLTELKEEYAG-REVPRPPHWGGFRLIPSLIEFWQGRPSRLHD
PDXH_CUPTR      -----------------EVPGRDVLEQREQEYRSKFG--ENPPRPPYWGGYRLVPTALEFWQGRPSRLHD
PDXH_ANASP      ---------------------REVLEQRMQEFQHKY-ENQEIPRPAHWGGLRVIPSEIEFWQGRSSRLHD
PDXH_PSE14      -------------------ADRDELEGLIRQTEQRFADTQP-HCPEHWGGYRLLPERIEFWQGRSSRLHD
PDXH_FRAAA      -------------------ESRDVLDXXXXXXXXXXXXGTPVPTPPFWGGLRLVPDTVEFWQGRTNRLHD
PDXH_SALAI      -------------------PNRSALDDAYRAMAERYADGVPIPAPPNWGGFRLRPDGVEFWQGQASRLHD
PDXH_RALEH      -----------------EVPGRDVLEQREQEYRSKFG--ENPPRPPHWGGYRLVPTALEFWQGRPSRLHD
PDXH_PSEE4      -------------------ADREELEGLVKATEARFSDTQP-HCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_STRAW      ---------------------RAELDAAYEQLGVRYPEGEQVPVPPNWGGFRIAPQTVEFWQGRWNRLHD
PDXH_PSESM      -------------------ADRDELEGLIRQTEQRFADTQP-HCPEHWGGYRLLPERIEFWQGRSSRLHD
PDXH_SYNY3      -------------------GDRQELEDNLARWEKQY-ENQSIPRPPHWGGFRVIPHRIEFWQGRPSRLHD
PDXH_SALRD      -------------------DSRADLEENLDTVKAEYGDEDEIPRPSHWGGYVVRPTEVEFWQGRPNRLHD
PDXH_PSEU2      -------------------ADRDELEGLIRQTEQRFADTRP-HCPEHWGGYRLLPERIEFWQGRSSRLHD
PDXH_RALEJ      -----------------EVPGRDVLEQRESEYRAKFG--ENPPRPAHWGGYRLVPTALEFWQGRPSRLHD
PDXH_BORA1      --------------------TREALEARERDFKARFGDTP--PRPPHWGGYRLVPTYFEFWQGRPSRLHD
PNPO_DICDI      ------------FQSSEVT--KQHLEEKTIEMENKFKD-QEVPLPPFWGGWRIKPYAFEFWQGKSGRIHD
PDXH_PSEAE      -------------------ADRAELERLLADTERRFAD-QPPSCPEHWGGYRLLPQRIEFWQGRPSRLHD
PDXH_PSEAB      -------------------ADRAELERLLADTERRFAD-QPPSCPEHWGGYRLLPQRIEFWQGRPSRLHD
PDXH_BURP8      XXXXXXXXXXFSAQYGENP-----------------------PRPPHWGGYRLIPDAIEFWQGRPSRLHD
PDXH_BORPD      --------------------TRAELEAREQEIRARYG--EQPPRPPHWGGYRVVPTLFEFWQGRPSRLHD
PDXH_PSEFS      ---------------------REELQDLLKATEQRFSDTQP-DCPEHWGGYRLLPERIEFWQGRASRLHD
PDXH_ACAM1      ---------------------RDILDQRLQALEQKYQN-QPIPRPPHWGGYRVTPHLIEFWQGRTSRLHD
PDXH_PSEF5      -------------------ADRDELQELLKATEARFSDSQP-DCPEHWGGYRLLPERIEFWQGRPSRLHD
PDXH_NOCFA      -------------------DSRAALDRALAEVTARFAGVDEIPVPPHWGGYLLRPEQVEFWQGRRGRLHN
PDXH_RUBXD      -----------------EPAXXXXXXXXXXXXXXXXXXXXPVPRPPFWGGYRVRPERIEFWQGRENRLHD
PDXH_PSEU5      XXXXT---------------------------EQRFLD-KAPHCPPHWGGYRLLPERIEFWQGRPSRLHD
PDXH_CYAP8      ---------------------RQLLEMKFEEIRRKFAQGE-IPLPSFWGGYRIVPHYFEFWQGRPNRLHD
PDXH_STRCO      ---------------------RRALDGAYAELAARYPEGEQVPVPPHWGGFRVVPDAVEFWQGRENRLHD
PDXH_RHOFD      -------------------SGRSVLVANAAKYGAKFLLNP--PRPPHWGGYRLKPDHWQFWQGRKSRLHD
PDXH_BORPE      ------------------------LEAREREFRDRYG--EHPPRPPHWGGYRLKPNRFEFWQGRPSRLHD
PDXH_BORPA      ------------------------LEAREREFRDRYG--EHPPRPPHWGGYRLKPNRFEFWQGRPSRLHD
PDXH_BORBR      ------------------------LEAREREFRDRYG--EHPPRPPHWGGYRLKPNRFEFWQGRPSRLHD
PDXH_RHOBA      -------------------DSREAMESSLAQLKARYPEGTQIPLPENWGGYAVTPMSFEFWQGRPSRLHD
PDXH_RALME      -----------------EVAGRDVIEAREADFRNKFG--ENPPRPPHWGGYRLKPTWIEFWQGRPSRLHD
PDXH_MYCTU      ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
PDXH_MYCTA      ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
PDXH_MYCS2      ---------------------RAALLEQLAEVTERFADLDEVPVPPNWGGYRIAPEVVEFWQGRENRVHN
PDXH_MYCBT      ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
PDXH_MYCBP      ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
PDXH_MYCBO      ---------------------RAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHN
PDXH_CYAA5      ---------------------RKLLEMKFEELKYKFQHGE-IPLPSFWGGYRVKPTRFEFWQGRPNRLHD
PDXH_MAGSA      -------------------TGRFELEKRVGEFAAKFG-LGKVPRPPHWSGFRLAPRRIEFWHDRPFRLHD
PDXH_AZOVD      ---------------------RXXXXXXXXXXXKRFLD-QAPHCPGHWGGYRLLPDRIEFWQGRASRLHD
PDXH_ACTPJ      -------------------SGKSELVAKAALIAAK--HPLHVPRPPHWGGYIVLPERIEFWQGRPSRLHD
PDXH_POLSJ      ---------------------RSVLVTNAAKYGAKFL--LQPPRPPHWGGYRLQPDNWQFWQGRKSRLHD
PDXH_RUTMC      ---------------------RQILLSQFESMKVKFSKGE-VPLPDFWGGYRVIPSKIEFWQGRENRLHD
PDXH_MYCSJ      ---------------------RAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQGRESRVHN
PDXH_AGRT5      -------------------EGRFALEKAVAEYTARYA-IGEIPRPSHWSGFRIRPVSIEFWHDRKFRLHD
PDXH_MYCSS      ---------------------RAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQGRESRVHN
PDXH_MYCSK      ---------------------RAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQGRESRVHN
PDXH_ENTS8      -----SRIS-----------ARGVLESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQVEFWQGGEHRLHD
PDXH_ESCF3      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSMEQIEFWQGGEHRLHD
PDXH_ERWT9      -----SRIS-----------ARGVLESKFLELKQKFMQGE-IPLPSFWGGYRINIESMEFWQGGAHRLHD
PDXH_MYCVP      ---------------------RAALMQQLTEVTERFADVEEIPVPPHWGGYLIAAEVVEFWQGRENRVHN
PDXH_METPP      ---------------------RAVLVANAAKVGAQFLLNP--PRPPHWGGFRLRPDRWEFWQGRKSRLHD
PDXH_ACTP2      LIAAKHPL--------------------------------HVPRPPHWGGYIVLPERIEFWQGRPSRLHD
PDXH_ACIAC      -------------------SGRGVL---VANAAKYGAQFLLQPLPPHWGGFRLKPDRWEFWQGRKSRLHD
PDXH_SPHWW      -------------------DSRATFEARYEEMLRRF-EGGPVPRPPHWSGFRVAPERIEFWQDRAHRLHE
PDXH_RHIME      -------------------ESRFALEKAVAEYTARHA-IGEIPRPDYWSGFRIRPLSIEFWHDRPFRLHD
PDXH_POLNA      -------------------SGRGVLLANAAKFGAKFM--LQPPRPAHWGGYRLKPDNWQFWQGRKSRLHD
PDXH_ACTP7      LIAAKHPL--------------------------------HVPRPPHWGGYIVLPERIEFWQGRPSRLHD
PDXH_SHIFL      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_SHIF8      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_SHIDS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_SHIBS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_LEPBP      ------------------------LETKFQTLEKEW-EGKEIPMPESWGGYSVSPNKIEFWQGRAGRLHD
PDXH_LEPBA      ------------------------LETKFQTLEKEW-EGKEIPMPESWGGYSVSPNKIEFWQGRAGRLHD
PDXH_ECOSM      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOLU      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOLI      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOLC      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOHS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECODH      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOBW      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO7I      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO27      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_BRUSU      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUSI      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUME      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUMB      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUC2      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUAB      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUA2      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_BRUA1      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_AERS4      -------------------SARGVLEAKFLELKQKFANGE-VPLPSFWGGYRVVIDTVEFWQGGEHRLHD
PDXH_ACISJ      AKGAQFLLKP--------------------------------PRPPHWGGFRLRPDQWEFWQGRKSRLHD
PDXH_RHISN      -------------------ESRFALEKAVAEFTARHA-IGEIPRPEYWSGFRIRPTSIEFWHDRPFRLHD
PDXH_MYCLE      ---------------------RTALLDQLLEVTVRFADSELIPLPPNWGGYLIVPEVVEFWQGRENRVHN
PDXH_GLUOX      -------------------DDRSTFEERLKAVDEKYGDGP-IPRPANWSGFRVLPEAIEFWQDRPYRLHD
PDXH_ECO24      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRISLEQIEFWQGGEHRLHD
PDXH_BDEBA      -----------------------WLSRRVQEYEKQF-DGQVVPRPPHWGGWRVIPTEIEFWFGLGGRLHE
PDXH_SHISS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_SHIB3      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_MYCGI      ---------------------RAALMQQLADVTARFADVDEVPVPPHWGGYLIAAEVVEFWQGRENRVHN
PDXH_ECOUT      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOSE      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOL6      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOL5      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECOK1      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO8A      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO81      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO55      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO45      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_BRUO2      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHDRPFRLHD
PDXH_SPHAL      -------------------DSRATFEARFAEMQARFAG-QDVPRPPRWSGWRVTPERIEFWQDRAHRLHE
PDXH_HAEIN      ---------------------SNYXXXXXXXXXXXXXHPLNVPRPDYWGGYLVVPETVEFWQGRPSRLHD
PDXH_HAEI8      ---------------------SNYXXXXXXXXXXXXXHPLNVPRPDYWGGYLVVPETVEFWQGRPSRLHD
PDXH_ERWCT      -----SRIS-----------ARGVLESKFLELKQKFQNGE-VPLPSFWGGFRVVIDSVEFWQGGEHRLHD
PDXH_ECO5E      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_ECO57      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQGGEHRLHD
PDXH_COLP3      ----------------KYDDE---LKERMSHYQDKFSEGE-VPHPEFWGGWRVKPHAIEFWQGRANRLHD
PDXH_MESSB      -------------------EGRFALEKAVAEYTAKYA-VGEIPRPDYWSGFRIKPVSIEFWHDRPFRLHD
PDXH_KLEP7      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_ALHEH      -------------------ESREVLEQRVAEYAARFPDGEAVPRPPHWSGYRLAPVRIEFWRARPGRLHE
PDXH_AGRRK      -------------------EGRFALEKAVAEYTARYA-LGDIPRPPHWSGFRIRPLSIEFWHDRPFRLHD
PDXH_AERHH      -------------------SARGVLEAKFLELKQKFANGE-VPLPSFWGGFRVRIDTVEFWQGGEHRLHD
PDXH_VEREI      -------------------AGRGVLLANAARYGAQFM--LKPPRPQHWGGYRLEPDLWEFWQGRKSRLHD
PDXH_MYCPA      ---------------------RAALLEQLAQVTARFADHERVPVPPGWGGYLIAADVVEFWQGRENRLHN
PDXH_MYCA1      ---------------------RAALLEQLAQVTARFADHERVPVPPGWGGYLIAADVVEFWQGRENRLHN
PDXH_CITK8      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVNIEQMEFWQGGEHRLHD
PDXH_TERTT      -------------------DSRKALLSQFEAMKAKFTKGE-IPLPDFWGGYVVKPQAIEFWQGGASRLHD
PDXH_SALTY      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALTI      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALSV      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALPK      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALPC      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALPB      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALPA      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALNS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALHS      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALG2      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALEP      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALDC      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALCH      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_SALA4      -----SRIS-----------ARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQGGEHRLHD
PDXH_DICNV      -------------------ESRDFLMLKWQNMKAKFHEGK-IPLPDFWGGYRVRPHKIEFWQGQPSRLHD
PDXH_VIBVY      -----SRIS-----------ARGVLEGKFLELKQKFANGE-IPVPSFWGGFRVKPQSIEFWQGGEHRLHD
PDXH_VIBVU      -----SRIS-----------ARGVLEGKFLELKQKFANGE-IPVPSFWGGFRVKPQSIEFWQGGEHRLHD
PDXH_POLSQ      IP------------------NREFLEEAEKRFKSEFG--EAPPRPEHWGGYRLRPTEMEFWQGRPSRLHD
PDXH_OCHA4      -------------------ESRFALEKAVAEYTAKYA-IGDIPRPSYWSGFRIRPVSIEFWHDRAFRLHD
PDXH_CHRSD      -----------------EIPDRDWLEERKQRFEQVYGE-QTVERPPHWGGYRVLPFLLEFWQGQPNRLHD
PDXH_RHIEC      -------------------ESRFALEKAVAEYTARYA-IGEIPRPPHWSGFRIRPTSIEFWKDQQFRLHD
PDXH_PROMH      -----SRIS-----------ARGVLESKFLELKQKFQHGE-VPLPSFWGGYRVTFDSVEFWQGRENRLHD
PDXH_LEPBL      -----------------EIPNRKFLEERFEEFSKLY-EGKEVDLPNHWGGYAVHPNRIEFWQGRSSRLHD
PDXH_LEPBJ      -----------------EIPNRKFLEERFEEFSKLY-EGKEVDLPNHWGGYAVHPNRIEFWQGRSSRLHD
PDXH_ENT38      -----SRIS-----------ARGVLESKFLELKQKFQQGE-VPLPSFWGGFRVSVEQMEFWQGGEHRLHD
PDXH_CYTH3      -----------------EVASREELESKITYYENKYPEGSVVPRPAHWGGYTLKPAYFEFWQGRPSRLHD
PDXH_SHELP      -------------------SARQALESKFAEMKAKFSQGE-VPLPKFWGGYRVRPSSIEFWQGGEYRLHD
PDXH_SHESR      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQGGEHRLHD
PDXH_RHIL3      -------------------ESRFALEKAVAEYTARYA-IGEIPRPAHWSGFRIRPTSIEFWKDQKFRLHD
PDXH_THEEB      ---------------------ASYXXXXXXXXXXXXHYGENVPRPEHWGGYRVLPTLIEFWQGRPNRLHD
PDXH_PSEA7      XXXXXDQAPS---------------------------------CPEHWGGYRLLPQRIEFWQGRPSRLHD
PDXH_LEPCP      XXXXXXXXXXXXXQYGLHP-----------------------PRPPHWGGYRLVPDRWEFWQGRKSRLHD
PDXH_COXBU      ----------------QEIPDREYLITRYKKYREKFQD--DVRCPEFWGGFRLIPDRMEFWVGQEHRLHD
PNPO_BOVIN      -------------------PDREYLRKKNKELEQLYQE-QEVPKPKYWGGYILYPQVMEFWQGQTNRLHD
PDXH_RHILO      -------------------ESRFALEKAVAEYTARYA-IGEIPRPKHWSGFRIVPKTIEFWHDRPFRLHD
PDXH_BARBK      -------------------EDRFVLEKEVSRYTADYA-IGNVPRPPYWSGFRIKPLFIEFWRDRPSRLHD
PDXH_THEFY      -------------QSAPVAD-RAELDRAYARCAEQWPPGTPVPRPEYWGGFLLVPQEVEFWQGRSDRMHD
PDXH_SHEAM      -------------------SARQVLEAKFMEMKQKFS-AGEVPLPSFWGGYLVRPASIEFWQGGEHRLHD
PDXH_RHORT      -------------------QGRFELERRVAQFAARYA-VGAVPRPPHWSGFRVVPEVIEFWHDRPFRLHD
PDXH_RHIE6      -------------------ESRFALEKAVAEYTARYA-LGEIPRPAHWSGFRIRPTSIEFWKDQAFRLHD
PDXH_AZOC5      -------------------EGRFALEXXXXXXXXRYA-VGSVPRPPHWTGFRILPVQIEFWHDRPFRLHD
PDXH_ARCB4      ---------------------RSLLEQKFDEIKNKFVNGE-VPFPSFWGGYIIKPTKIEFWQGGQDRLHD
PDXH_VIBPA      -----SRIS-----------ARGVLEGKFLELKQKFAKGE-IPMPTFWGGFRVKPQSIEFWQGGEHRLHD
PDXH_SHESM      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQGGEHRLHD
PDXH_SHEB9      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPSSIEFWQGGEHRLHD
PDXH_SHEB8      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPSSIEFWQGGEHRLHD
PDXH_SHEB5      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPSSIEFWQGGEHRLHD
PDXH_SHEB2      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPSSIEFWQGGEHRLHD
PDXH_SERP5      -----SRIS-----------ARGVLESKFLELKQKFQQGE-VPLPSFWGGFRVNFDSVEFWQGGANRLHD
PDXH_SACD2      ---------------------RQLLLQQFNAIKTKFANGE-VPLPDFWGGYRVVPQRMEFWQGGGARLHD
PDXH_ACIC1      ---------------------RAWLDERYAEVAQRFAGVEHIPPPPFWGGFRVIPETVEFWQARPARMHD
PDXH_BARQU      -------------------ENRFVLEKAIAQYTARYA-VGNIPRPPYWSGFRVKPLSIEFWCDRPFRLHD
PDXH_ANAPZ      -------------------EDRDVLLSKIELMEREY-EGREIPRPKFWGGIRVVPNVIEFWMDGKHRLHD
PDXH_SHESA      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQGGEHRLHD
PDXH_RHILW      -------------------ESRFALEKAVAEYTARYA-IGEIPRPAHWSGFRIRPTSIEFWKDQNFRLHD
PDXH_PROMM      ------------------------LEMKWQEMNRRFANGE-VPLPEFWGGFRVAPTEFEFWQGRENRLND
PDXH_PROM3      ------------------------LKMKWQEMNRRFANGE-VPLPEFWGGFRVVPTEFEFWQGRENRLND
PDXH_VIBFM      -----SRLT-----------ARAALEGKYLELKQKFAKGE-IPVPKFWGGFRIKIDSIEFWQGGDHRLHD
PDXH_VIBF1      -----SRLT-----------ARAALEGKYLELKQKFAKGE-IPVPKFWGGFRIKIDSIEFWQGGDHRLHD
PDXH_MARMM      -------------------ESRFALEKSVAREAARFG-LGEVPRPPHWSGFRIRPLSLEFWRDRPFRLHD
PDXH_EDWI9      ---------------------RGILESKFLELKQKFLQGE-IPLPSFWGGYRVSLETIEFWQGRESRLHD
PDXH_ALTMD      ---------------------RALLLTQFKQLKDKFAN-KALPVPDFWGGFRIVPHQIEFWQGGEDRLHD
PDXH2_THICR     ---------------------KQLLLSQFEKMKQKF-QSGEIPFPDFWGGYMVVPQQIEFWQGGDNRLHD
PDXH_SHESW      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPKSIEFWQGGEHRLHD
PDXH_SHEON      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQGGEHRLHD
PDXH_PARL1      -------------------AGRFELEKQVAVFAAKFG-VSRVPRPDHWSGFRVVPRHIEFWRDRPFRLHD
PDXH_CAUCR      -------------------PDRHALEKRVAEMGLKFG-LGKVPRPPHWSGYRITPVTIEFWRDRPFRLHE
PDXH_CAUCN      -------------------PDRHALEKRVAEMGLKFG-LGKVPRPPHWSGYRITPVTIEFWRDRPFRLHE
PNPO_HUMAN      -------------------PDREYLRKKNEELEQLYQD-QEVPKPKSWGGYVLYPQVMEFWQGQTNRLHD
PDXH_XANAC      ----------------------------IAKVEATFAG-REVPRPDGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_SODGM      ---------------------RGVLESKFLELKQKFAQGD-VPLPSFWGGYRVSIEAMEFWQGGEHRMHD
PDXH_VIBHB      -----SRIS-----------ARGVLEGKFLELKQKFAKGE-IPMPTFWGGFRVKPQSIEFWQGGEHRLHD
PDXH_CHRVO      ---------------------KATLVTRAAMFGARYPIN--VPRPPHWGGFAVVPDRVEFWQGRPSRLHD
PDXH_YERPS      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERPN      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERPG      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERPE      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERPA      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERP3      -----SRIS-----------ARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_YERE8      -----SRIS-----------ARGVLESKFLELKQKFQQGE-VPLPSFWGGFRVKFDSVEFWQGGEHRLHD
PDXH_PHOPR      -------------------SARQALEGKYLELKQKFAQGK-VPVPTFWGGYRVKINSIEFWQGGENRLHD
PDXH_XANC5      ---------------------------AIAKVEATF-EGREVPRPDGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_HALHL      ---------------------RHELEARLEEVESRF--PERVPRPPHWSGYRIIPVSIELWSAGDGRLHQ
PDXH_XANP2      -------------------EGRFALEAAVASATAKYA-LGTVPRPPHWTGFRVLPVAIEFWHDRPFRLHD
PDXH_XANOR      ---------------------RAEFDAAIAKVEATF-EGREVPRPEGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_XANOM      ---------------------RAEFDAAIAKVEATF-EGREVPRPEGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_XANCP      ------------------------FEAAIAKVEATF-DGRDVPRPDGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_XANC8      ------------------------FEAAIAKVEATF-DGRDVPRPDGWGGFRVVPQAFEFWYGAKFRLHE
PDXH_SHEWM      -------------------SARQVLETKYAEMKAKFSKGE-VPLPKFWGGYLVKPSSIEFWQGGERRLHD
PDXH_SHEDO      ---------------------RQALEGKFNEMKAKFAQGE-VPIPKFWGGFLVRPKSIEFWQGGEHRLHD
PNPO_MOUSE      -------------------PDREYLRKKNEELGQLYQD-QEVPKPEYWGGYILYPQVMEFWQGQTNRLHD
PDXH_PSEHT      ---------------------RKVLMETFANMKNKFAKGE-IPLPDFWGGYCVVPQKIEFWQGGAHRLHD
PDXH_SHEPC      -------------------SARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPKSIEFWQGGEHRLHD
PDXH_EHRRW      ------------------EDKQEFITN-VQKMTKEFMG-KPVPRPSYWMGLRVVPMLIEFWQEGVDRIHT
PDXH_EHRRG      ------------------EDKQEFITN-VQKMTKEFMG-KPVPRPSYWMGLRVVPMLIEFWQEGVDRIHT
PDXH_ALISL      -----SRLT-----------ARAALEGKYLELKQQFSKGE-IPVPKFWGGFRVKIDSIEFWQGGDSRLHD
PDXH_VIBSL      -----SRIS-----------ARGILEGKYLELKQKFAKGE-IPVPSFWGGFRVRVDSIEFWQGGEHRLHD
PDXH_EHRCR      -------------------ENREDFVELIKEMTIKFHE-KPIPRPDYWVGIVVVPMLMEFWQEGLNRIHT
PDXH_ANAMM      -------------------ESRKLLLEQFERERQRF-DGQEIPRPGHWGGVRVVPHVVEFWEDGAHRLHS
PNPO_RAT        -------------------PDREYLRKKNEELGQLYRE-QEVPKPEYWGGYILYPQVMEFWQGQTNRLHD
PDXH_PSEA6      -------------------ESRDALLSRFEDTKIKFSD-KDIPAPEFWGGFKIIPQEIEFWQGGEHRLHD
PDXH_BARHE      -------------------ESRFVLEKAIARYTTRYA-VGNIPRPPYWSGFRVKPLSIEFWCDRPFRLHD
PDXH_AGRVS      -------------------ESRFALEKAVAEYTARYA-LGSIPRPAHWSGFRIKPLTIEFWRDGKFRLHD
PDXH_SINMW      -------------------ESRFALEKAVAEYTARHA-IGEIPRPDYWSGFRIRPLSIEFWHDRPFRLHD
PDXH_SHEFN      -------------------SARQALEGKFAEMKAKFAQGE-VPLPKFWGGYLVRPASIEFWQGGEHRLHD
PDXH_FLAJ1      ---------------------RTFLEENLKKLEAEF-EGKPIPRPENWGGYLVTPLQVEFWQGRPNRLHD
PDXH_RHOSR      ---------------------RXXXXXXXXXXXXRFPVDVDIPVRPDWGGILIRPAVVEFWQGRANRMHN
PDXH_WOLPM      ------------------------FEQAIKLKEKEFHNT-QVSRPDFWVGFCVIPKVIEFWQEGEYRKHI
PDXH_PELUB      -------------------NNRDELLNSIEEYKKKYSNKNDVPRPEHWSGWNLIPTSIEFWLDGESRIHE
PDXH_HAEDU      ---------------------KRTLVAKVALLSAKY--PLFVPRPAHWGGYLVQPTKIEFWQGRPSWLHD
PDXH_LEPIN      -------------------PDRKFLEGRFQKFTNQYQN-KEVDLPNHWGGYAVYPCRIEFWQGRSSRLHD
PDXH_LEPIC      -------------------PDRKFLEGRFQKFTNQYQN-KEVDLPNHWGGYAVYPCRIEFWQGRSSRLHD
PDXH_SHEPA      -------------------SARKALESKFAEMKAKFSQGD-VPLPKFWGGYLVRPKSIEFWQGGEHRLHD
PDXH_KINRD      TPSAAA------------------LHEREAQLRERWPDTDDVPTPPHWGGYLVRALEVEFWQGRTSRLHD
PDXH1_THICR     ---------------------RDILEAKLQEAMS--LPDRNLTCPAHWGGYQLKPCYFEFWQGRPSRLHD
PDXH_SHESH      -------------------SARQALESKFAEMKAKFSQGE-VPLPKFWGGYIVKPTSIEFWQGGEHRLHD
PDXH2_RALSO     -------------------ENRTALAKSVATEAARFG-ISDIPRPAFWTGFRIVPNCIEFWMDKPFRLHD
PDXH_DEIRA      ------------TPQSAPVENRAALEAKFAALHEQFPEGTTIPRPAFWGGYRVQVQEWEFWQGRPNRMHD
PDXH_DEIDV      ---------------------RAELETRLTALHERFAADQEVPCPEFWGGYRIQVQEWEFWQGRPNRMHD
PDXH_BRASB      -------------------ESRFAFEQAIAKVAAQYI-IGEVPRPPGWSGWRITPVRMEFWHDRPFRLHD
PDXH_ZYMMO      -------------------PARDVFEKRIADIEARY-EGKDVPRPPYWTGFRVSPIRMEFWNDREFRLHE
PDXH_SHEHH      -------------------SARKALETKFAEMKAKFSKGD-VPLPKFWGGYLVRPKSIEFWQGGEHRLHD
PDXH_PSYWF      -------------QSGEVAS-REAMDEIFANLKQKFPEGDTVPTPEFWGGYEIAATEIEFWQGRANRLHD
PDXH_GRABC      -------------------PDRKTLQKRVEEEEARYPG-DDIPRPAYWSGYRVTPTVIEFWQQMPFRLHD
PDXH_DEIGD      APIA----------------NRGXXXXXXXXXXXXYPEGTPVPRPDFWGGYRVRVREWEFWQGRPSRLHD
PDXH_NOCSJ      -------------------SGRXXXXXXXXXXXVRYPD--QVPTPEEWGGYVVRPEVVEFWQGRTGRLHD
PDXH_WIGBR      ---------------------RSILDDKFLKLKHEF-QKKVVPFPKFWGGYKINISSAEFWQGRKNRLHD
PDXH_FLAPJ      ---------------------RMILEEKLKQLEDNCVG-KEILRPKNWGGYIVEPQEVEFWQGRPNRLHD
PDXH_ACICJ      -------------------GXXXXXXXXXXXVTARYGD-GPIPRPPHWSGWHVMPDSIEFWQDRDFRLHD
PDXH_EHRCJ      ------------------EDRMSFLKS-IEKMTAEF-HGKSIPRPDYWVGVVVVPMLMEFWQEGLNRIHT
PDXH_BACTN      ----ASRMQ--------------LIRAFVKEAARWLG--KEVERPDNWGGYAVTPTRMEFWQGRPNRLHD
PDXH_RHOPT      -------------------ESRFAFEQAIAKVTARHL-IGDVPRPPGWSGWRITPSRIEFWHDRPFRLHD
PDXH_RHOPA      -------------------ESRFAFEQAIAKVTARHL-IGDVPRPPGWSGWRITPSRIEFWHD