[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00774

[Show Plain Result]


## Summary of Sequence Search
    1::714
   10::85      1e-53  37%  682 aa  ESF1_SCHPO RecName: Full=Pre-rRNA-processing protein esf1;
   12::584     8e-48  47%  628 aa  ESF1_YEAST RecName: Full=Pre-rRNA-processing protein ESF1;AltName:
    5::72      1e-35  38%  845 aa  ESF1_MOUSE RecName: Full=ESF1 homolog;AltName: Full=ABT1-associated
    4::574     5e-33  43%  619 aa  ESF1_ASHGO RecName: Full=Pre-rRNA-processing protein ESF1;AltName:
    5::87      2e-32  41%  851 aa  ESF1_HUMAN RecName: Full=ESF1 homolog;AltName: Full=ABT1-associated
    5::831     2e-32  40%  842 aa  ESF1_RAT RecName: Full=ESF1 homolog;AltName: Full=ABT1-associated
    1::714

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxSSNDKADKDVITDPRFANIQSDPRYRLPSKKHTRVKIDKRFAHMFHDKDFSRNA
ESF1_SCHPO      ----------------NAKSRSESNVVADPRFQSVHSDPRFSRLKRGNFKVKVDERFKSLKEDKDFKTTA
ESF1_YEAST      ----------------------------DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKK--DLEVQHKS
ESF1_MOUSE      -----------------------QEIMDDQRFRRVSKDPRFWEMPEKERKVKIDKRFRAMFHDKKFKLNY
ESF1_ASHGO      -----------------NNEGTGKDSI-DKRFARIESDPKFRAPKQKNLKIKLDDRFSK--QDLEYKRKA
ESF1_HUMAN      -----------------------QEIMSDQRFRRVAKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNY
ESF1_RAT        -----------------------QEIMDDQRFRRVSKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNY


                         .         .         *         .         .         .         .:140
query           AVDRYGRKLRRDDTKKQLEKFYRLDKDDVEGQISADDDEEVQKELLRVEKEDYDPARDGGFXXXXXXXXX
ESF1_SCHPO      SVDRYGRPLNQDKATKEIDRLY------------------------------------------------
ESF1_YEAST      KVDKYGRKIKNAQNNRELEDFDKYFEKEAEN----DEDSEVNKTVVDRARGEVPDXXXXXXXXXXXXXXX
ESF1_MOUSE      AVDKRGRPISH-STTEDLKRFY------------------------------------------------
ESF1_ASHGO      KVDKYGRRIGTAPGKKDFEKYF------------------------------------------------
ESF1_HUMAN      AVDKRGRPISH-STTEDLKRFY--DLSDSDSNLSGEDSK-------------------------------
ESF1_RAT        AVDKRGRPISH-STTEDLKRFY------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXXXGQLDSQTGDIPLGEITDRIAVVNLDWDNIRAEDLMAVFSSFLPTGGKILNVAV
ESF1_SCHPO      -------------------------NIPRGSETNRLAVVNMDWDNLQAVDLFVALSSFCPPGGKLLKVSI
ESF1_YEAST      XXXXXXXXXXXXXXXXXXNAKPESGDI-----SKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAI
ESF1_MOUSE      ------------------------------EITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVVFSVKI
ESF1_ASHGO      -----------------------------GDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAI
ESF1_HUMAN      ------------------------------EITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVIFSVKI
ESF1_RAT        ------------------------------EITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVVFSVKI


                         .         .         .         +         .         .         .:280
query           YPSEFXXXXXXXXXXXXXXXXVFAKRXXXXXXXXXXXXXXXXXXKIKQAILKEDEGQDFDSTQLRKYQLE
ESF1_SCHPO      YPSEFGKSRMAAEHVQGPPRDIFTPADNQPSSAELHEAQKFGFDNNESALIEEDLGNEFDMVKXXXXXXX
ESF1_YEAST      YPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIKDLYEEGDADKDVDSXXXXXXXXX
ESF1_MOUSE      YPSEFGKERMKEEQVQGPVELL--------------------------SIPEDAPEKDWASRELRDYQFK
ESF1_ASHGO      YPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEIG-----LKDLYEQGDAEKDYDSKAXXXXXXX
ESF1_HUMAN      YPSEFGKERMKEEQVQGPVELL--------------------------SIPEDAPEKDWTSRELRDYQFK
ESF1_RAT        YPSEFGKQRMKEEQIQGPVELL--------------------------SIPEDAPEKDWASRELRDYQFK


                         .         *         .         .         .         .         +:350
query           RLRYFYAVLTCSSKDAAKHIYDTVDGTEYMSSANFFDLRFVPESTDFAEDVPRDECNRIPDGYKPNEFVT
ESF1_SCHPO      XXXXXXAVVECDSVRTAKVIYETCDGAEYETSANIYDLRFIPDDVTFDDDESREVCTKAPEKYEPRDFVT
ESF1_YEAST      XXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDV-RDECSILPKNYRPHQFST
ESF1_MOUSE      RLKYYYAVAECDSPETASKIYEDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDVALEVDTAYKPKYFTS
ESF1_ASHGO      XXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTF-DDEPREECASVPKDYKPVQFST
ESF1_HUMAN      RLKYYYAVVDCDSPETASKIYEDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDVASEVNTAYKPKYFTS
ESF1_RAT        RLKYYYAVVECDSPETASKIYEDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDAASEVDTAYKPKYFTS


                         .         .         .         .         *         .         .:420
query           DALQHSKVKLTWXXXXXXXXXXXXXXFKGGKKEIDENDLKAYLGXXXXXXXXXXXXXXXXXXAAGASTKL
ESF1_SCHPO      DALQHSKVKLSWDAEDPHRKDLIKKAFT--SQDIEDLDFSAYI--------------------ASSESED
ESF1_YEAST      DALQHSSVKLTWDETPADRVEVAKRAFT--QKEIDDMDFKAYL---------------------------
ESF1_MOUSE      AAMGTSTVEITWDETDHERITTLNRKFK--KDELLDMDFQAYLSXXXXXXXXXXXXXXGVNIGEDGKTKK
ESF1_ASHGO      SALQHLQVKLTWDETPADRVEMAKRAF--SQKEIEDMDFKAYL---------------------------
ESF1_HUMAN      AAMGTSTVEITWDETDHERITMLNRKFK--KEELLDMDFQAYLAXXXXXXXXXXXXLQGDDGVEDGKTKK
ESF1_RAT        AAMGTSTVEITWDETDHERITTLNRKFK--KDELLDMDFEAYLXXXXXXXXXXXXXXXXXXXXSDGKTKK


                         .         .         +         .         .         .         .:490
query           SKKEAERARIRALLGLSNDAPSKAKEKGPVGDMEVTFAAGLTAAPARDSVFXXXXXXXXXXXXXXXXXXX
ESF1_SCHPO      EDVDVIRSRYQKLLANSNPFEDDDKLEGANGEMEVTFTSGFDVDNNANS--------------SEKDETT
ESF1_YEAST      ----------------------------------------------------------------------
ESF1_MOUSE      SQKDDEEAKYRQLLQVIQEKEKKGKENDM--EMEIKWVPGLKES-AEEMV----------KNKLEGKDKL
ESF1_ASHGO      ----------------------------------------------------------------------
ESF1_HUMAN      SQKDDEEAKYRQLLQVIQEKEKKGKENDM--EMEIKWVPGL-----------------------------
ESF1_RAT        SQKDDEEAKYRQLLQVIQEKEKKGKENDM--EMEIKWVPGL-----------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXXXXXXXSGTVPEIDADKPTAESKEEEDLGFDDPFFTAPELDSAKVXXXXXXXXXXXXXXXXX
ESF1_SCHPO      IEKYXXXXXXXXXXXXXXXXXXXTKDDEGEGSDVDLGFDDPFF--KDKDASRNNKKNKKGKHTQIED---
ESF1_YEAST      ----------------------------------------------------------------------
ESF1_MOUSE      TPWXXXXXXXXXXXXXXXXXXXXXXXDSEDELPSDVDFNDPYFXXXXXXXXXXXXXXXXXXXXXXXXXXT
ESF1_ASHGO      ----------------------------------------------------------------------
ESF1_HUMAN      ----------------------------------------------------------------------
ESF1_RAT        ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DGAASAAQRAELELLMMDDKTSTIKHFDMNEIEXXXXXXXXXXXXXXXXXDEATMPXXXXXXXXXXPRFQ
ESF1_SCHPO      ---PTAASKEELENLVREDENDSLDHFDMKSILXXXXXXXXXXXXXXASNLEGLQ--EGFEADVSDPRFA
ESF1_YEAST      ------------------------------------------------------------------PRFK
ESF1_MOUSE      D---LEKQKAEMALLVMDEEEDSKKHFNYDKIVEHQNLSXXXXXXXXXXXE---LVEDDFEVNVSDARFQ
ESF1_ASHGO      ------------------------------------------------------------------PRFK
ESF1_HUMAN      ----------------------------------------------------------------------
ESF1_RAT        -------------------------------------------------------------------RFQ


                         .         +         .         .         .         .         *:700
query           RIYESHEYAIDPTNPRFRQTDGMKALLEEGRKRRRHLAHDEPDGDAVEPIKKKKRGKTAGPDRMPETEDL
ESF1_SCHPO      ALYTNHNFALDPTNPHFKRTKTVEKIMDESRKRRSNQLEQTQDGKPELKIKKRKAEK--GDQR----QEL
ESF1_YEAST      EVFEDHDFAIDPTQPEFKGTQAMSKILKERSKR-------------------------------------
ESF1_MOUSE      AMYTSHLFNLDPSDPNFKKTKAMEKI-----XXXXXXXXXXXXXXXIQAVERAQQDTGKPTQKQPMDPAL
ESF1_ASHGO      EVFEDRDFAIDPSQPEFKETAAMKQILQE-----------------------------------------
ESF1_HUMAN      ----------------------------------------------------------------------
ESF1_RAT        AMYTSHLFNLDPSDPNFKKTKAMEKILEEKARHR-----EQKEERLIQAVERAQQDTGKPAQKQPMDPAL


                         .         .         .         .         +         .         .:770
query           SKLVEQVKAKAKxx
ESF1_SCHPO      DRIVKSIKRSGK--
ESF1_YEAST      --------------
ESF1_MOUSE      SMLIKSVKNKTE--
ESF1_ASHGO      --------------
ESF1_HUMAN      --------------
ESF1_RAT        SMLIKSVKNKTE--