[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00779

[Show Plain Result]


## Summary of Sequence Search
    1::1773
  191::1486    2e-73  25% 1583 aa  MIS4_SCHPO RecName: Full=Sister chromatid cohesion protein
  647::1999    6e-67  25% 2072 aa  NPBL_COPC7 RecName: Full=Protein rad9;AltName: Full=SCC2 homolog;
 1418::2463    1e-47  23% 2798 aa  NIPBL_MOUSE RecName: Full=Nipped-B-like protein;AltName:
 1424::2469    3e-47  23% 2804 aa  NIPBL_HUMAN RecName: Full=Nipped-B-like protein;AltName:
  359::1297    1e-42  22% 1493 aa  SCC2_YEAST RecName: Full=Sister chromatid cohesion protein 2;
  328::1267    1e-38  23% 1479 aa  SCC2_ASHGO RecName: Full=Sister chromatid cohesion protein 2;
 1123::1945    9e-26  21% 2077 aa  NIPB_DROME RecName: Full=Nipped-B protein;AltName: Full=SCC2 homolog;
  949::2120    9e-24  23% 2203 aa  NPBL_CAEEL RecName: Full=Nipped-B-like protein pqn-85;AltName:
    1::1773

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIS4_SCHPO      ----------------------------------------------------------------------
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIS4_SCHPO      ----------------------------------------------------------------------
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIS4_SCHPO      ----------------------------------------------------------------------
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxKRRKLDSNNEEKQDPLPLRDQKELSDTALVKLQSLLHEIFEAEEQLLPD
MIS4_SCHPO      ---------------------KKRLMEDTYSPRESPSKIQ---RLQDVLLKQLQDLISQVIEAENSE---
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APLDAQAGGKFFKFPNTIGDLGPIMSSETHEVLSKALQKVSDYRRLGDIPTEYIKHIQRLCEAPIMAVQS
MIS4_SCHPO      ---DFSSNSLFIKRED---DDGKHISSHAIEKLYMALTKLS---RLGACD-------KLLEEGSIILVQI
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADFKLESPPSDTDIERWITQLEDVQNALLAIITLLQTMPGNQSTKDLCPEDLIHAIPTALGQVFDHCIIP
MIS4_SCHPO      LEKELKELPSIINLHDSLTQFPNLDFILKTTALVLFIIFLVPSFKKLQXXXXXXXXXXXXXXIFEYAIDN
NPBL_COPC7      -------PPNDIELEKLTRLLDLARDSVLAADCCIAILASDRLPKQLYSEELITSCLNTVKNQLTKVLYP
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VVECRSSGKDSTHFHVFSAQKQVISNVIHQTKRVLSRLAVFLSNVDLAEGPITAIEFLAARLIFVENAPN
MIS4_SCHPO      IVQSKTSDARTSEIQHLSVLLQKVANVLN----ILSKVA---HEIPLSEAVVIRIVYLFPKVSTLDNSFK
NPBL_COPC7      FIE--GASPDSINSKLYNGHRKQMSEIFQSLSSVLPRISIIIQTVYIAIGPFFVVEGXXXXXXXXXXXXX
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ---------------------------------------------------------VTAKLVYIFSMNN
SCC2_ASHGO      --------------------------MLHST---LDVFYMYISNKPLDDGLVVKLVYMFTELIMSTWSHN
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DKESAIGVQKYEASRRAAMDVLAKIFAKYPEQRPFILDEILVSLEKLPSNRQSARQFKLIDGKSIQLLSA
MIS4_SCHPO      TKLPNCNSSSFDFLKAPLFQTLQYLFRLYPYQRDFIIEESLTNFSHLPTARSVSRTYRLSNGKSIQYYST
NPBL_COPC7      XXNRTLGKSAMRGLRLDALSLIRSIFSNHEDQRSWIIEEILTSLIKLSDTKQKAGQFRLRDGRSIRTVSA
NIPBL_MOUSE     -------VENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLVDGEPIQMVTA
NIPBL_HUMAN     -------VENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLMDGEPIQMVTA
SCC2_YEAST      DIEATTNIQFWDNVKRISSDILVSLFGSFDQQRGFIIEELLSHIEKLPTKRIQ-KKLRKVGNQNIYITDT
SCC2_ASHGO      --VSSVSLQNHIGNKTIGMKSIEVLFEKLPEQRLFIIDELLSHLDNLPNTRSQKRMKNIGKNLHITHFSY
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      -----------------AMLLASNIFSRAEDSLRFMITDLLSSLHRAPTQKNSNNGYSLPDGSWISTTTA


                         .         .         .         *         .         .         .:630
query           LVIQLVQTTALRQTSSRLTVAKGSLQKATXXXXXXXXXXXXXXXXXXXRKTSPIKQLSKQVELLYDNAIH
MIS4_SCHPO      LFVRLIQSCSIQNLFDSEIVQSES--KSTEALH-----------------SGNLTEHLKTVESILSKSRH
NPBL_COPC7      LLMQLVQTSA-----HDVRINARRLEKERQNALALKRQESISDLNGQPKSDEPFLDNIDMEEILYGGGLE
NIPBL_MOUSE     LVLQLIQCVVHLPSSEK----------------------------DPNSEEDSNKKVDQDVVITYETAMR
NIPBL_HUMAN     LVLQLIQCVVHLPSSEKDSNAEEDSNK----------------------------KIDQDVVITYETAMR
SCC2_YEAST      LMSMLENINCYSFCNQMKDIAPENIDLLK-------------------------NEYKKQEEFLFNIVEH
SCC2_ASHGO      IMLSILQVWNNYDYCSNL--------------------------------------VSPDTEQLHDLIAH
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      LFIQLVQST-IKIPKFKKHADEDELAKR-----------------------------SKKEEAMVKEGFL


                         .         +         .         .         .         .         *:700
query           SAQYVTKFIVQRAMTSTKSGDQPYRNLLDIFTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSAN
MIS4_SCHPO      EANHIVAYLLSRSLKQNKTSDNSFAILTKILLEDLLNMLSLPEWCGTETIIRQFAMNLVMTVTNDKQAVS
NPBL_COPC7      SATKAAKTIIGKGKTTKNSNEAEYRAIFDNLIDDLLVVLYWPEWPAASLLLNIASKFMVSSLDDVKSNAQ
NIPBL_MOUSE     TAQNFLSIFLKKC--GSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAEXXXXXXXXXXVHQFSNKSTEMA
NIPBL_HUMAN     TAQNFLSIFLKKC--GSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAEXXXXXXXXXXVHQFSNKSTEMA
SCC2_YEAST      ----INDTILERFFKNPSA----LRYVIDNFVQDLLLLISSPQWPVTEKIXXXXXXXXXXVYSPSMQSAN
SCC2_ASHGO      HAEFAADHIIDTILKKCFSNISKYRFVFDQFVTDMTTVVTLPDWPVSDXXXXXXXXXXXSIFNQSQKHIN
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      KASKVTNFLAKCSQKGNKDGEEDYRILFSNFLQELLSALYSPEWPAAEMILTALGSLLVKNFRSKSSDMT


                         .         .         .         .         +         .         .:770
query           AKNMSLELLGWMGSAISDLTSTAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLE
MIS4_SCHPO      SKNAALDLISLIVNALFDLSLFEKH-NIPAPTNFNDIISFIPSITR------LNELSQVSFNHFY-----
NPBL_COPC7      AKSMALDHLGVIAARISSILKVQKDEDGTSYRGLKPLDEIVNNLFMDHRDVAAHLCKRSTEDQAYESARE
NIPBL_MOUSE     LRVASLDYLGTVAARLRKDAVTSKMDQGSIE-----------RILKQVSGGEDEIQQL------QKALLD
NIPBL_HUMAN     LRVASLDYLGTVAARLRKDAVTSKMDQGSIE-----------RILKQVSGGEDEIQQL------QKALLD
SCC2_YEAST      IETICLQLIGNIGSTIFDIKSTRDHEDNNL----IKMINYPETLPHFFKS----FEECIA----YNETIK
SCC2_ASHGO      IESVALQGIGLIGSTILDIRLSS----------NSNPTANLIHLFN-------YPEDIDGLFKAYRTCLA
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      IRQASLDYLG-------NITAKLRKDQKEAIAGERRLDAVVKKSFLLLSDKGVEDYESVDISNKQNDKLK


                         .         .         *         .         .         .         .:840
query           YLEEGDLGSWQLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD
MIS4_SCHPO      FLCKGDIS---LENILPYNYNKWFSFLL-------QLRKVCNDSEALKIIDNCKNMQKSQEGFQGPSPFK
NPBL_COPC7      -LTAAILGHELAASLKRVNV--WLDHPEQD-EDLDLRDSSKALSFGQKLKTALREVWKDPATQEEVSRID
NIPBL_MOUSE     YLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSDATHHAKELETTGQIMHRAENRKKFL
NIPBL_HUMAN     YLDENTETDPSLVFSRKFYIAQWFRMKSQKDEESSEGTHAKEIETTGQIMKFLRSIISQFSTLKMNS--D
SCC2_YEAST      CRRSATRFLWNLRLGTILILEEYTK-------DAKEQIITVD----NELKKILEQIKDGGLGPELENREA
SCC2_ASHGO      YCTN----SVQHHTPYKFL---WCKQLLKEMDKESQGWGSKLQQ------KFLSLIESIHLPLEQAANLG
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      VLETSLIDYLVITNACNFYVGEWYKEVAEDLESAAERKYEKIQYRGAEMKVFLSKILDKKRRLEKSNKVK


                         +         .         .         .         .         *         .:910
query           RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSLLDRDGSVISL
MIS4_SCHPO      ADENDEDIF--IISLYHSSLFLNLKFFVSLIIGFLDSPQASLRTKCLR-IINQMKTIPSILRTHPEVLAQ
NPBL_COPC7      RLSEE--------IGTIQSLRNSFQPILNVILSALDAPVIFMRTKALRALGQIVTSDATILGT-ASVRQG
NIPBL_MOUSE     RIKTTPSQFSTLYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGV
NIPBL_HUMAN     TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGV
SCC2_YEAST      DFST--IKLDYFSILHAFELLNLYDPYLKLILSLLAKDKIKLRSTAIKCLSMLASKDKVILSNP-MVKET
SCC2_ASHGO      AVEILPT---YCSTLLTSELINMYEPYLKLVLSLLERHKVKLRSGAIRCLALLISKDKNMLYTP-IVKET
NIPB_DROME      -------------------FSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGV
NPBL_CAEEL      MLDSD-AFWAVKFLAQSREFTHSFDTYLKHIVFGAGSETVALRSKALKCLSSIIEADSSVLILE-DVQQA


                         .         .         .         +         .         .         .:980
query           ILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVRKRAIGLMKDVYIQTSNQELK
MIS4_SCHPO      IISKSNDQSAIVRDTVLDLLGTYIMAYRETIPQIYGCIISGISDPSTIVRKRAIKQLCEVYEATEDLNIR
NPBL_COPC7      IENHLLDSSPAVRDAAVELIGKYMIDSPEVAGNYYQKIAERMADTGLAVRKRVIKLLKSYYGVIDDTQRK
NIPBL_MOUSE     HGRLM-DNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKI
NIPBL_HUMAN     HGRLM-DNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKI
SCC2_YEAST      IHRRLNDSSASVKDAILDLVS----INSSYFE-FYQQINNNYNDDSIMVRKHVLRINEKMYDETNDIVTK
SCC2_ASHGO      IENRLTDSSPLVKDAILELIELGSSYIDFYQH-----ININYNDDSMLVRKHVLRMNQIIYDDTEDIIIK
NIPB_DROME      NQKFL-DTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKI
NPBL_CAEEL      VHTRMVDSHAQVRESAVELIGRFVLYDEEYVRKYYSQIAERILDTGVAVRKRVIRIMREICEKFPTFEMI


                         .         *         .         .         .         .         +:1050
query           LTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTESTQGTPQSKVSLKNLMNLIVGSVRRNEGVI
MIS4_SCHPO      VDIASKLLTRSNDEEETISELSLEVLEKLWFSPASNELDEQLTFLEKQKLRVQYFPILKLCAEPSTERHV
NPBL_COPC7      IDISARLVLRMVDEDDGVKDLAMKTLEELWFXXXXXXSAMKVKPTSQDKAALLSKVAIIMGTAARQSPLE
NIPBL_MOUSE     TEMCVKMIRRVND-EEGIKKLVNETFQKLWFTP--------TPHNDKEAMTRKILNITDVVAACRDTGY-
NIPBL_HUMAN     TEMCVKMIRRVND-EEGIKKLVNETFQKLWFTP--------TPHNDKEAMTRKILNITDVVAACRDTGY-
SCC2_YEAST      VYVIARILMKIEDEEDNIIDMARLILLNRWILKVHEVLDQ-----PEKLKEISSSVLLVMSRVAMNEKCS
SCC2_ASHGO      AYVASXXXXXXXXXXXXXXXTARSELLKRWILSIQCPNAKPELQIKNCRVSIRVIAQLLVGG----DKIC
NIPB_DROME      PEICVKMIRRVHD-EEGIQKLVTEVFMKMWFTPC----------TKNDKIGIQRKINHIIDVVNTAEGLL
NPBL_CAEEL      PDMLARMIRRVTD-EEGVKKLVFETFTTLWFQPVDTRITKVTTMCSVAQHCIKDAMSLILHIVKNGQAVK


                         .         .         .         .         *         .         .:1120
query           ATFEAFVKDELSAEAKSASLNFNVCKAVVAAMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQ
MIS4_SCHPO      LLVTSLKTMLTSKEEINLSTLHTQIRLLLSCLFNQLIEQVDESTKGILYEIMSTLFVFSRAFPFLFDLSY
NPBL_COPC7      DMLHKIISDKEGNEAASLHQRYEICETLIDGLVD-----ATDLPGFTIINCIRTIHLFTAAYPSILPGTH
NIPBL_MOUSE     DWFEQLLQNLLKSEEDSSYKPVKACTQLVDNLVEHILKDSDNVNSGRLVACITTLFLFSKIRPQLMVKHA
NIPBL_HUMAN     DWFEQLLQNLLKSEEDSSYKPVKACTQLVDNLVEHILKDSDNVNSGRLVACITTLFLFSKIRPQLMVKHA
SCC2_YEAST      QXXXXXXXXXXXXKEAHSKEAYDKITHVLTILTDFLVQNSDDTNEKNSQNFLNLLAKFADSTVSFLTKDH
SCC2_ASHGO      DLFEHFLNKNAHTEDQNKLISSSLCDQVIEMVIENEAADVDNQREEEGRNIMKFLSVLSSCQDSFITKDH
NIPB_DROME      MSIEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELED-TDNSRMLGCITTLHLLAKVRPQLLVKHA
NPBL_CAEEL      QIIDSLVDHILNLEQHKSSENVSEVELM-----------RRKEQEEKYMAYLSTLAVFSKIRPLLLT-SH


                         .         .         +         .         .         .         .:1190
query           LETLHPYIGHLSNADDLMLFRSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWT
MIS4_SCHPO      LHLLKPYLRSASTIEEQRFLYYVVAIFRQVLPFQKEISESFLRSLESVLLQRLTKAGTATLMEIVPCLCS
NPBL_COPC7      ASTLLPYLKNASTTEELLTSDFLLKIFRASIPHMPKTAAKFGQELQTSLQPLILKPGVNILQEAVGCMCA
NIPBL_MOUSE     M-TMQPYLTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGA
NIPBL_HUMAN     M-TMQPYLTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGA
SCC2_YEAST      ITALYPYMVSDEKSD---FHYYILQVFRCTFEKLANFKQKFLYDLETTLLSRLPKMNVREIDEAMPLIWS
SCC2_ASHGO      ITALYPYL-HSDTKSDFQLH--ILKVYRNTFEQLSHFKPKFLYDLETTILSRLPRMNVRELDEAIPLSWS
NIPB_DROME      I-TIEPYLNKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGA
NPBL_CAEEL      VEVLLPYLGAKTNAENQVTKEMIGMLER-VIPLVPFPSNIVLDSIDENLCKVI---MFNGMXXXXXXXXX


                         *         .         .         .         .         +         .:1260
query           INGVLQNTERLVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP
MIS4_SCHPO      LFTRLNDYERLKKIVVSCLKSLEEA-------RHSENNFQKMVRLIDLIGLFSRYGDLNRINDDWKHS--
NPBL_COPC7      ---VVRHLTHDFKRLINLLKGCNRLLSYLRHPPTKQ--LNNVESLLFIVALLGEHCNFDRLRLEQPDLAP
NIPBL_MOUSE     VNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNTSLLTNKPALLRSLFTVGALC---RHFDFDLEDFK
NIPBL_HUMAN     VNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNTSLLTNKPALLRSLFTVGALC---RHFDFDLEDFK
SCC2_YEAST      VATHRHDTARVAKACSSCLSHLHPYINKANNEEAAIVVDGKLQRLIYLSTGFARFCDKIAFLQEGETLYE
SCC2_ASHGO      LSRHRKDDTRICKACASCLGQLSPYIAATTDPSAVRPD-GKLQRLLYLATGFARFCSFENT----EGKFP
NIPB_DROME      VNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNI-YTPSFRRSLFTIG------ILMRYFDFKSP
NPBL_CAEEL      XXXIYKKFKRGATKTIDVLKHL-EVIKRNFDSNPRYDLDPKLRSIFTL-GVLSRYFQFEEFV----KEDP


                         .         .         .         *         .         .         .:1330
query           HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFEEDSPDLQNIV
MIS4_SCHPO      -----------LDFISPECDDAYKGQLRIHIIDNMSRICLRETSLFISPLMLSTLDMIIAENNVNEVSVL
NPBL_COPC7      DIDSITQGSVMIYFTLLRIYDKFDFDIRPRILQCLGFLFRAQPTLMTKEESAAIMDAIFEEGRARLLKIM
NIPBL_MOUSE     GNSKVNIKDKVLELLMYFTKHS-DEEVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNSILSDSSVNLKIQV
NIPBL_HUMAN     GNSKVNIKDKVLELLMYFTKHS-DEEVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNNILSDSSVNLKIQV
SCC2_YEAST      HITKC----LLV-----LSKDKITHVIRRVAVKNLTKLCGNHPKLFNSRHVLHLLDKEFQSDQLDIKLVI
SCC2_ASHGO      NLKTRNIFEYVTKCLLMFTKENIHHVIRRIATKNLVKIASRYPKLFNSRHVLTVLDTQFEKGILDIQLVV
NIPB_DROME      IALGETNDGLPVSICEDFFCRCTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEILSSIANDFKIIC
NPBL_CAEEL      TEEKVEALKEKVFITLEFFSRYHKGGLRQKALTAMGHFC----AQHSTYLTKRQLTNTYLENSPXXRILV


                         .         +         .         .         .         .         *:1400
query           LKGFLAFFSIHEGKSEKLIQTKDTNGKSEGSTRLGGSLKASENDGAAALIAQHFLQQMLHAALSKEDSHA
MIS4_SCHPO      FKSFLELLAIFEADQKLSLKGKQNSNKSVDRDMLKGTKDKQWIEGVSASLMQHFLPCILDSCFSKNLRYS
NPBL_COPC7      QDFLIXXXXXXXXXXXXXXXXXXXXXTDVNMEELVGNTDGFADSGVSSAIVQRYLSHILDAALSQNSQIQ
NIPBL_MOUSE     LKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMG-----DVSSGMSSSIMQLYLKQVLEAFFHTQSSVR
NIPBL_HUMAN     LKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMG-----DVSSGMSSSIMQLYLKQVLEAFFHTQSSVR
SCC2_YEAST      LESLYDLFLLEERKSVRNTGVXXXXXXXXXXXXXXXXXXRVENDGVCSALATRFLDNILQLCLLRDLKNS
SCC2_ASHGO      LESLYDFFLAEERRSLIQVGVDGTISSNNELRKVVANHTKSDNDGICSALVSRYLDKILKICLIADLNNA
NIPB_DROME      MRNIWIYLT----ESEMFMHNKEKEWEKQSKHE---DLKEMNDSGMASRIIQLYLEEILECFLNRDDTVR
NPBL_CAEEL      LQNLEMFLQCEEQKLAASHDKWDENKEAQ-------NLKEMEXXXXXXXVIQKYWKAVLESYVDADIQLR


                         .         .         .         .         +         .         .:1470
query           LTGIELIASINRQGLIHPKECAGVLVALETSTNASIANVAFETHKMLHQQHESMFDREYMRAVQDAFYYQ
MIS4_SCHPO      MLGIEILKCIIHQGLVNPRMCFSTIIALESNAIKETREVAILLHTELHRRHESLIDGLYAQSADLIFSLQ
NPBL_COPC7      MAAIDVLTFTIKQGLAHPLQSFPVIIALETSPHAVLSARAIALHSILNSKHASLLNTRYSISARKSFDYQ
NIPBL_MOUSE     HFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQ
NIPBL_HUMAN     HFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQ
SCC2_YEAST      LVAIRLLKLILKFGYTNPSHSIPTVIALFASTSQYIRHVAYELLEDLFEKYETLVFSSLSRGVTKAIHY-
SCC2_ASHGO      MVAIRFLKQILTYGYTNPSLCVPTVIALTASPNSYMRDLSSEMFSELLQGYESM----------------
NIPB_DROME      LWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQ
NPBL_CAEEL      RAAVQVVWLTLNQGLVTPGASIPTLIAMTTDPVDVIRNRIDILLKEIDSKYSGMVQSKAMQGVQEKFVFH


                         .         .         *         .         .         .         .:1540
query           RDVVGDPTGASTRPFTAKLAALFEIIKISNSKYQKKFLTNLCSKVDFQPRALDVAGSPPEHMLLARFVCQ
MIS4_SCHPO      K--TEEYQTFKLGEFSPFQSAYTIVSADKSSKSRKKLIMQILKPLKLD--GIDLPSFTEEKVSFVSFCCV
NPBL_COPC7      KKIVGVVHGFRTNGHTALLQRWYTLVREKRATRQDKSLVKVFSENDYQATQDDVD--------FTRYMAE
NIPBL_MOUSE     QAILKDPVRGQDESSSALCSHLYSMIR-GNRQHRRAFLISLLNLFD------DTAKTEVTMLL---YIAD
NIPBL_HUMAN     QAILKDPVRGQDESSSALCSHLYSMIR-GNRQHRRAFLISLLNLFD------DTAKTDVTMLL---YIAD
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      KILQINNRGASRGPDNTTTALNFLYTLLRTTKPQRRALVQTVTKFDDQKTSL-------QQML---YIAD
NPBL_CAEEL      LNTLPNALPEKTHDGMAVLSGLYQSLR-TNRQQRRSFLQSMVKLF-----SEEFSHDKPQLMEYI-FIAD


                         +         .         .         .         .         *         .:1610
query           NLAYFEYAQIGELLATVACMERIVASTGTTVAHAIETDIFPVKIDCPNEQMQVDGAAADQAPHSVDPNSL
MIS4_SCHPO      CLAGIPYVSIEEPLMIISTVDSVLATIGPTI---------------------------------------
NPBL_COPC7      NFASFEYKTQEEVFTVIKHLTTVLSTTGMQLAHLLXXXXXXXXXXXXNGGDEISSNAAEAVVPLATPNDP
NIPBL_MOUSE     NLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFK----------------------------------
NIPBL_HUMAN     NLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFK----------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      NLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKPSXXXXXXXXXXXXXXXXXXLFNRLDLTEI
NPBL_CAEEL      NLAMFPYQMIDEPLYVMRQIDQNIAQTGQSLLVQYKLQLRMQESE-DEDIVFLDENMMSRLSQLGQIETF


                         .         .         .         +         .         .         .:1680
query           KQLATAAATLSMLWETRTYLRRLYGVGFHSMPKESKASAKDLNKSLTKVQGIGGDRLWDAISKTMAxxxx
MIS4_SCHPO      ----------------------------------------------------------------------
NPBL_COPC7      VSLMRTSVIVAMVMLLKSYLKTLYGL--------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      IKCITSAQACMLLLILKDHLKEMYAITDSKISRYSPSEQKLYEKAVTRVNDFNPKTTIDVIKKQMS----
NPBL_CAEEL      HQLFLDSQVPSLLLYVRTFLMQLYGFNETKVAEQPSEAAKVYEKAVTR----------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIS4_SCHPO      ----------------------------------------------------------------------
NPBL_COPC7      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
SCC2_YEAST      ----------------------------------------------------------------------
SCC2_ASHGO      ----------------------------------------------------------------------
NIPB_DROME      ----------------------------------------------------------------------
NPBL_CAEEL      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxx
MIS4_SCHPO      -----------------------
NPBL_COPC7      -----------------------
NIPBL_MOUSE     -----------------------
NIPBL_HUMAN     -----------------------
SCC2_YEAST      -----------------------
SCC2_ASHGO      -----------------------
NIPB_DROME      -----------------------
NPBL_CAEEL      -----------------------