[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_00781

[Show Plain Result]


## Summary of Sequence Search
    1::335
    1::335     e-162 100%  335 aa  DOHH_COCIM RecName: Full=Deoxyhypusine hydroxylase;       
    7::326     e-116  68%  335 aa  DOHH_ASPCL RecName: Full=Deoxyhypusine hydroxylase;       
    4::323     e-114  68%  336 aa  DOHH_EMENI RecName: Full=Deoxyhypusine hydroxylase;       
   19::326     e-113  70%  335 aa  DOHH_NEOFI RecName: Full=Deoxyhypusine hydroxylase;       
   19::326     e-113  69%  335 aa  DOHH_ASPFU RecName: Full=Deoxyhypusine hydroxylase;       
    1::324     e-111  62%  339 aa  DOHH_ASPOR RecName: Full=Deoxyhypusine hydroxylase;       
   10::320     e-107  63%  329 aa  DOHH_PHANO RecName: Full=Deoxyhypusine hydroxylase;       
    3::326     7e-95  59%  338 aa  DOHH_ASPNC RecName: Full=Deoxyhypusine hydroxylase;       
    4::321     1e-90  59%  324 aa  DOHH_NEUCR RecName: Full=Deoxyhypusine hydroxylase;       
   28::336     8e-77  53%  344 aa  DOHH_CHAGB RecName: Full=Deoxyhypusine hydroxylase;       
    2::328     3e-76  50%  337 aa  DOHH_GIBZE RecName: Full=Deoxyhypusine hydroxylase;       
    2::314     3e-64  45%  318 aa  DOHH_CANAL RecName: Full=Deoxyhypusine hydroxylase;       
   17::319     2e-59  47%  322 aa  DOHH_KLULA RecName: Full=Deoxyhypusine hydroxylase;       
   11::310     4e-59  45%  311 aa  DOHH_DEBHA RecName: Full=Deoxyhypusine hydroxylase;       
   43::306     1e-56  49%  308 aa  DOHH_YARLI RecName: Full=Deoxyhypusine hydroxylase;       
   17::320     7e-55  43%  325 aa  DOHH_YEAST RecName: Full=Deoxyhypusine hydroxylase;       
    3::291     7e-55  43%  302 aa  DOHH_DROPS RecName: Full=Deoxyhypusine hydroxylase;       
    3::291     6e-54  44%  302 aa  DOHH_DROME RecName: Full=Deoxyhypusine hydroxylase;       
   17::319     1e-51  47%  322 aa  DOHH_ASHGO RecName: Full=Deoxyhypusine hydroxylase;       
   11::318     2e-50  41%  318 aa  DOHH_SCHPO RecName: Full=Deoxyhypusine hydroxylase;       
    3::294     1e-49  43%  305 aa  DOHH_DANRE RecName: Full=Deoxyhypusine hydroxylase;       
   17::319     2e-49  41%  322 aa  DOHH_CANGA RecName: Full=Deoxyhypusine hydroxylase;       
   18::324     2e-48  45%  330 aa  DOHH_LENED RecName: Full=Deoxyhypusine hydroxylase;       
    3::290     1e-47  41%  299 aa  DOHH_CHICK RecName: Full=Deoxyhypusine hydroxylase;       
    9::292     2e-47  42%  303 aa  DOHH_XENLA RecName: Full=Deoxyhypusine hydroxylase;       
    3::291     1e-45  39%  302 aa  DOHH_MOUSE RecName: Full=Deoxyhypusine hydroxylase;       
   14::360     2e-45  43%  360 aa  DOHH_USTMA RecName: Full=Deoxyhypusine hydroxylase;       
   17::295     3e-45  42%  298 aa  DOHH_CAEEL RecName: Full=Deoxyhypusine hydroxylase;       
    3::291     8e-43  38%  302 aa  DOHH_RAT RecName: Full=Deoxyhypusine hydroxylase;       
    5::293     6e-40  36%  315 aa  DOHH_DICDI RecName: Full=Deoxyhypusine hydroxylase;       
    3::291     5e-38  37%  303 aa  DOHH_BOVIN RecName: Full=Deoxyhypusine hydroxylase;       
    2::301     2e-36  38%  314 aa  DOHH_ARATH RecName: Full=Deoxyhypusine hydroxylase;       
    3::290     7e-36  36%  302 aa  DOHH_HUMAN RecName: Full=Deoxyhypusine hydroxylase;       
   20::321     3e-34  44%  361 aa  DOHH_CRYNE RecName: Full=Deoxyhypusine hydroxylase;       
   13::303     2e-31  37%  319 aa  DOHH1_ORYSJ RecName: Full=Deoxyhypusine hydroxylase-A;       
    3::281     8e-30  35%  285 aa  DOHH_ENCCU RecName: Full=Deoxyhypusine hydroxylase;       
    9::294     2e-29  40%  302 aa  DOHH2_ORYSJ RecName: Full=Deoxyhypusine hydroxylase-B;       
  216::357     0.001  26%  377 aa  YPGR_BACSU RecName: Full=Uncharacterized protein ypgR;
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MASTIADNADNNGNSKDSVQYLRKVLTSESSPLAQRFRALFSLKHLASSKPPTEETLPAIEAIAAAFSSP
DOHH_COCIM      MASTIADNADNNGNSKDSVQYLRKVLTSESSPLAQRFRALFSLKHLASSKPPTEETLPAIEAIAAAFSSP
DOHH_ASPCL      ---------DNSDGPDATVLTLRKVLTSESEPLARRFRALFSLKYLACQQPATEKTLPAIQAIAAAFTSP
DOHH_EMENI      ---------DNLNSADTTVQTLRNVLTSETEPLARRFRALFSLKHLACLQPPTEKTLPAIQAIAAGFSSA
DOHH_NEOFI      ---------------------LRKVLTSESEPLARRFRALFSLKHLACLQPPTEKTLPAIQAIAAAFTSP
DOHH_ASPFU      ---------------------LRKVLTSESEPLGRRFRALFSLKHLACLQPPTEKTLPAIQAIAAAFTSP
DOHH_ASPOR      MASSAVDQPEG---VDETILTLRKVLVNESEPLARRFRALFSLKYIACLQPPTEKTLPAIQAIAAGFTSS
DOHH_PHANO      ------------------VPTLRKIVTSESEPLARRFRALFSLKHLASLQPPTEQTVPAIEAIAAAFSSP
DOHH_ASPNC      -----AVNENNLEGVSETVLTLRKVVVNESEPLARRFRALFSLKYLACLQPPSEDTLPXXXXXXXXXXXX
DOHH_NEUCR      -----------------TIASLRESLCSETTPLPIRFRALFSLKHLAVQNKGTXXXXXXXXXXXXXXXXX
DOHH_CHAGB      ---------------------LHQSLTTETTPLPVRFRALFSLKHVAATHPATXXXXXXXXXXXXXXXXP
DOHH_GIBZE      --SPSADTPEISNSADSTVLSLKKSLCSEDSPLPIRFRALFSLKHVXXXXXXXXXXXXXXXXXXXXXXSP
DOHH_CANAL      -------SADEVNIDTASLEELRDILINKTTKLANRFRALFNLKSVGSEDSDKERAHKAIKYIAECFNDD
DOHH_KLULA      -----------------SLEQLRDILVNNSAPLANRFRALFNLKGHAASKP--EDALKATQYLAEAFGDE
DOHH_DEBHA      -----------------TLEQLRDVLTNKSGDLANRFRALFNLKCVGAESENQDEVHKAIDYIAESFKDD
DOHH_YARLI      ----------------------------------------------------------AIDVIAEGFKDD
DOHH_YEAST      -----------------TLEQLRDILVNKSGKLANRFRALFNLKTVAEATKPXXXXXXXXXXXXSFVNDK
DOHH_DROPS      --------------SQEQIEAIGGVLNNKDRPLKERFRALFTLKNIGGKT--------AIDAISKAFDDD
DOHH_DROME      --------------SQQQIEAIGGVLNNKERPLKERFRALFTLKNIGGGA--------AIEAISKAFDDD
DOHH_ASHGO      -----------------SLEQLRDILVNKNAKLTNRFRALFNLKCVAEEAQRPEEAQRAVEYICEAFADS
DOHH_SCHPO      ------------------IDELERVLVNKSNPLSFRYRALFSLNALAKKGDKR-----AVDAIYKAFIDD
DOHH_DANRE      -------------NDKD-IAAVGSILVNTKQDLTTRFRALFTLRNLGGAE--------AVKWISEAFVDE
DOHH_CANGA      -----------------NLEQLRDILVNKESALANRFRALFNLKTAASEEANPSDAEKAVQYMGETFGDN
DOHH_LENED      --------------------------TSGKVLLHDRVRALFTLKSLKNED--------AIRIISKGFQDS
DOHH_CHICK      --------------TEEEVTAIGRTLLDAAQPLPARFRALFTLRNLGGPA--------AIDCIVRGFADS
DOHH_XENLA      ------------------VHSLGQLLIDPGKPLPLRFRALFTLRNLGGAE--------AIDCIGRGFQDE
DOHH_MOUSE      --------------TEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPD--------AISWISRGFEDS
DOHH_USTMA      -----------------------------STPLDQRFRSLFTIKGLAATSD--QHMQRAISIISQAFSDD
DOHH_CAEEL      -----------------------EALNDTKKPLKARFRALFILRNIGCDR--------SVDWIGKCLNDE
DOHH_RAT        --------------TEQEVEAIGKTLVDSTQPLQARFRALFTLRGLGGPD--------AISWISRGFEDS
DOHH_DICDI      --------------TEEIVNGLKETLTDVSQPIAKRFRSLFTLRNLNGPL--------CIDAMASALNDK
DOHH_BOVIN      --------------TEQEVEAVGQTLVDPGQPLQARFRALFTLRGLGGPV--------AISWISRAFDDD
DOHH_ARATH      ---------ESNGSVSSMVKFLCERLVDQSQPISERFRALFSLRNLKGPGPRN--------ALILASRDS
DOHH_HUMAN      --------------TEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPG--------AIAWISQAFDDD
DOHH_CRYNE      --------------------------TPGNVPLHERFRALFMLKAVGGDE--------VVDIVSEGLKDP
DOHH1_ORYSJ     ------------GPTPEMEKFLCDLLLDTAQPIAERFRALFSLRNLHGDGPRC--------ALLQAARDS
DOHH_ENCCU      ------------------IEVARKNIGCDSVSIAKRMRSLFYLRNVLLPE--------SARAITEAFGSK
DOHH2_ORYSJ     -------------------------LLDAAQPIAERFRALFSLRNLRGDAPR--------RALLQAARDS
YPGR_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SALLKHELAYCLGQTRNLDTVPHLRKVLEDTQEDAMCRHXXXXXXXXXXXXXXXXILQRLXXXXXXXXXX
DOHH_COCIM      SALLKHELAYCLGQTRNLDTVPHLRKVLEDTQEDAMCRHEXXXXXXXXXXXXXXXILQRLXXXXXXXXXX
DOHH_ASPCL      SALLKHELAYCLGQTRNPESVPYLQEVVKDTEQDTMCRHXXXXXXXXXXYEDSLEILKVLRDNKDEPDVI
DOHH_EMENI      SALLKHELAYCLGQTRNTDALPFLLDVVQDTQEDSMCRHXXXXXXXXXXYESSLEVLKALRDNENEVDVV
DOHH_NEOFI      SALLKHELAYCLGQTRNPESVPFLQQVAKDTEQDTMCRHXXXXXXXXXXYEDSLEILKALRDNQNESDVI
DOHH_ASPFU      SALLKHELAYCLGQTRNPASLPFLQQVAKDTEQDTMCRHXXXXXXXXXXYEDSLEILKALRDNQNEPEVI
DOHH_ASPOR      SALLKHELAYCLGQTRNPDAVSYLLEVVKNTEQDAMCRHEAAEGLGALGFDTSLDVLKALRDDEKEEDVI
DOHH_PHANO      SALLKHELAYCLGQSGHDAAIAPLRGVLEDKDEDSMCRHEAAEALGALSDKGSLELLKKMRDDANEVDVV
DOHH_ASPNC      XXXXXHELAYCLGQTRNPDAVAFLQQVLKDKEEDVMCRHXXXXXXXXXXYEDSLEILKALKDDENEPEVI
DOHH_NEUCR      XXXLKHELAYCLGQTGSDAAIPHLTQVLEDLQEDPMCRHXXXXXXXXXXXXXXXXVLQKYLHREGEDVSV
DOHH_CHAGB      SALLKHELAYCLGQTANGAAIPYLTAVLEDTGEDAMCRHEAAEALGALGDVASLGVLKRFRDRXXXXXXX
DOHH_GIBZE      SALLKHELAYCLGQTGNTAAVKPLRQVLSDLKEDPMCRHXXXXXXXXXXWADNLDILREYRDRKEEDISI
DOHH_CANAL      SELLKHEVAYVLGQTKDLYAAPYLREVLENDNQQCMVRHEAAEALGALGDKESLPLLEKYFKEDPLLEIR
DOHH_KLULA      SELLKHEVAYVLGQTKNMAGAPLLRDVLADDKQQCMVRHEAAEALGALNDVDSLDILEK-YFKEDPLLEI
DOHH_DEBHA      SELLKHEVAYVLGQTKNLHAAQYLRSVLENNNQQIMVRHEAAEALGALGDKDSLALLED-YFKNDPSIEI
DOHH_YARLI      SELLKHELAYVLGQTKNFHAVKPLQGVLADTNQQAMVRHEAAEALGALGDKGSVAMLQEYFENDPLEVIR
DOHH_YEAST      SELLKHEVAYVLGQTKNLDAAPTLRHVMLDQNQEPMVRHEAAEALGALGDKDSLDDLNKAAKEDPHVAVR
DOHH_DROPS      SALLKHELAYCLGQMQDPTALEILTKVLKDTTQEPMVRHEAAEAMGAIGHADVLAILEEYKKDPVVEVAE
DOHH_DROME      SALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAE
DOHH_ASHGO      SELLKHEVAYVLGQTGNLACAATLREVMLDHAQQCMVRHXXXXXXXXXXXXXXXXXXXR-SRREDPSEEV
DOHH_SCHPO      SELLKHEMAYVMGQSGQQYAVQPLINIVNDLDQQVMVRHEAAEALGALGFTESLPVLEKYYKEDPLAPIR
DOHH_DANRE      SALLKHELAYCLGQMQDESAIPTLEAVLKDTNQEPMVRHEAGEALGAIGNPKVLELLKK--YAEDPVIEV
DOHH_CANGA      SELLKHEVAYVLGQTKNLKAAPLLRKTMLDLAQQPMVRHEAAEALGALGDKDSLEDLEKCLKNDPHVAVR
DOHH_LENED      AALLKHELAYCLGQIRNPLALPVLESVLRNPSEDPMVRHEAAEAMGAISTADSIPILKQYLSDPDRSVRE
DOHH_CHICK      SALLKHELAFCLGQMRDRAAIPALLGVLQDSQQEPMVRHEAGEALGAIGDPEVLDVLRR--YSEDPVVEV
DOHH_XENLA      SALLKHELAYCLGQMKDRRALPVLKQVLQDRQQEPMVRHEAGEALGAIGDPEVLELLRE--YAQDPVIEV
DOHH_MOUSE      SALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQ--YSTDPVVEV
DOHH_USTMA      SALLKHELAYVLGQLEDARALPTLKKILQDLSQDAMVRHEAAEAMGAISDPSVLPILEQYRSDSDVSVRE
DOHH_CAEEL      SALLKHELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRK--YAQDPCPEV
DOHH_RAT        SALLKHELAYCLGQMRDPRAIPVLVSVLQDRNQEPMVRHEAGEALGAIGNPKVLGLLKQ--YSTDPVVEV
DOHH_DICDI      SALLRHEIAYCLGQMEDEYALKVLIDLVKNSDEHPMVRHEAAEALGAIGSESAHKTLKEYSNDPVREVSE
DOHH_BOVIN      SALLKHELAYCLGQMQDRRAIPVLLDVLRDTRQEPMVRHEAGEALGAIGDPEVLEILKQ--YSTDPVVEV
DOHH_ARATH      SNLLAHEAAFALGQMQDAEAIPALESVLNDMSLHPIVRHXXXXXXXXXXXXXNVNILKK-SLSSDPAQEV
DOHH_HUMAN      SALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQ--YSSDPVIEV
DOHH_CRYNE      SPLLKHELAYVLGQLLNTRALPTLSRVLENPTGESMVRHXXXXXXXXXXXXXSLPILRKYMQDENREVRE
DOHH1_ORYSJ     SNLLAHEAAFALGQMQDAEAIPALEAVLKDLSLHPIVRHXXXXXXXXXXXXKSIPLLEE-SLAADPAVEV
DOHH_ENCCU      SVLLKHEAAYVLGQMRMXXXXXXXXXXXXXXXXXXIVRHEAGEALGNFRPREEIVEALR-KYSNHPKKPI
DOHH2_ORYSJ     SNLLAHEAAFALGQMQDAEAIPALEAVLKDLSLHPIVRHXXXXXXXXXXXXXXXXXXXXXXAVDPAVEVQ
YPGR_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXTCDIAVDRILWETSKDSKSEKLKQSDFTSIDPAPPLPLSSAEQSIPELKQILLDASLPLFKRYRAMFA
DOHH_COCIM      XXTCDIAVDRILWETSKDSKSEKLKQSDFTSIDPAPPLPLSSAEQSIPELKQILLDASLPLFKRYRAMFA
DOHH_ASPCL      RETCDIAVDRILWENSEQRKAEKLKASDFTSIDPAPPLPMATSEPSIPDIEKRLLDTSLPLFQRYRAMFA
DOHH_EMENI      RETCDIAVDRILWEQSEARKAEKLKPSDFTSIDPAPPMPLTAKEPSIPDLEKTLLDTNLPLFERYRAMFG
DOHH_NEOFI      RETCDIAVDRILWENSEARKAEKLKTSDFTSIDPAPPLPMTASEPSIPEIEKTLLDTSLPLFLRYRAMFA
DOHH_ASPFU      RETCDIAVDRILWENSEARKAEKLKTSDFTSIDPAPPLPMTASEPSIPEIEQTLLDTSLPLFLRYRAMFA
DOHH_ASPOR      RETCDIAVDRILWENSEERKSEKLKPSDFTSIDPAPPLPMASSQPSISDLEKTLLDTKLPLFQRYRAMFA
DOHH_PHANO      RETCDIAVDRIEWEHGLQKGTEKLKKSDFTSVDPAPPMPESNEAPSIPALEKTLLDTTLPLFQRYRAMFA
DOHH_ASPNC      RETCDIAVDRIVWENSEARKAEKLKPSDFTSIDXXXXXXXXXXXXSIPELEKTLLDTKLPLFQRYRAMFA
DOHH_NEUCR      KETCEIAIDRIEWENSEERKQEKLRQSDFASVDPAPPMPEDDEKQTVETLEKKLLDTSLPLFKRYRAMFA
DOHH_CHAGB      XXXXXXXXXRIEWENGEGKKAEKLRASDFSSVDPAPPTAQGQEEQTVEELGNALMDTSLPLFKRYRAMFA
DOHH_GIBZE      VETCEIAIERIEWENSAERQKEKLRPSDFASIDPAPPMPESDKEAEVEDLGRKLMDTNADLFSRYRAMFA
DOHH_CANAL      Q-TCELAIERIHWENSEKAKNEVLEKSLYTSIDPAPPLATNDSTSKVEKLKEILNDQDKPLFERYRAMFR
DOHH_KLULA      RQTCELAIDRIKWETSEEGRREALQESLYSSIDPAPPFSLEK-DYKIQELKDILNDQNRPLFERYRAMFR
DOHH_DEBHA      KQTCELAIERIRWENSEKAKAENLETSLYTSIDPAPPMP-SDQESKVEKLQKILNNQDEPLFERYRAMFR
DOHH_YARLI      E-TCELALERIKWENSEAAKTETLQKSAYTSIDPAPPLPTDQAEGSVEKLQKTLMDKSQSLFHRYRAMFR
DOHH_YEAST      E-TCELAINRINWTHGGAKDKENLQQSLYSSIDPAPPLPLEK-DATIPELQALLNDPKQPLFQRYRAMFR
DOHH_DROPS      --TCAIALDRVRWLQSGQQVADN---NPYASVDPSPP---TAGDKSVAELKAIYLDAKQTLFDRYRAMFS
DOHH_DROME      --TCAIALDRVRWLQS----GQKVDDSNYASVDPSPP---TAGDKSVTELKAIYLDAQQSLFDRYRAMFS
DOHH_ASHGO      RQTSELAIERIRWQASGAAATEQLQQSLYSSVDPAPALSLEK-DYDVPQLQALLNDQRAPLFERYRAMFR
DOHH_SCHPO      E-TCELAIARIQWKNGLDKNNEKITPSMYDSVDPAPPMPEQDVKSEVAKLRSEIVDQNLPLFYRYRVMFR
DOHH_DANRE      AETCQLAVKRLEWEQTKDGTDE----NPYCSVDPAPP----AQRKSVPELRTQLLDETLPLFDRYRAMFA
DOHH_CANGA      E-TCELAIARINWQHSDAPTKESLQQSLYSSIDPAPPLAXXXXXXXXXXXXXXXXXXX-PLFLRYRAMFR
DOHH_LENED      --TCEIAIAKIEWDTEEGAKNDKATRDEYTSIDPAPPRPEEISQTKIDELRDNLLDVNRPLFERYRAMFA
DOHH_CHICK      AETCQLAVRRLEW---LQEHGEEPGSSPYRSVDPAPP----AEETDVATLRAVLLDESRPLFDRYRAMFA
DOHH_XENLA      AETCQLAVSRIEWQKNPDSPD----TNPYLSVDPAPP----AEEKDVPTLRATLLDETCPLFHRYRAMFA
DOHH_MOUSE      AETCQLAVGRLEW--LQQHPGEATCAGPYLSVDPAPP----AAEQDVGRLREALLDEARPLFERYRAMFA
DOHH_USTMA      --TCELAISKISFDNSEEGXXXXXXESAFKPIDPAPAMPAASKEAAVPLFQSTLLDTNLSLFERYRAMFA
DOHH_CAEEL      SETCQIALGRVEWV----EKSGKDTNSPYDSVDPTP----SASTSDVEELAATLIDASLPLFDRYRAMFS
DOHH_RAT        AETCQLAVRRLEW--LQQHPGEATCAGPYLSVDPAPP----AAEGDVGRLRETLLDEAQPLFERYRAMFA
DOHH_DICDI      --TCQLALSRVEWYEKNKPETEEDKM--YMSVDPAPPLKKGSVSRD--ELRSKFLDSNLDIFNRYRALFS
DOHH_BOVIN      AETCQLAVRRLEW--LQQHGGESAVRGPYLSVDPAPP----AEERDLGQLREALLDEARPLFDRYRAMFA
DOHH_ARATH      RETCELALKRIMSNVDAENQSSTTEKSPFMSVDPAGP---AASFSSVHQLRQVLLDETKGMYERYAALFA
DOHH_HUMAN      AETCQLAVRRLEWLQQHGGEP---AAGPYLSVDPAPP----AEERDVGRLREALLDESRPLFERYRAMFA
DOHH_CRYNE      --TCEIAVGKIEFDLSEEGKKTNANP-DF----PTXXXXXXXXXXXXXXLRADLLNTSLPLFQRYRAMFA
DOHH1_ORYSJ     QETCELALRRI--EQQKNAGSESTTISPFLSVDPALP---AKQGLSVHQLREILLNEQESMYERYAALFA
DOHH_ENCCU      SETCYLALMKL-----KDGSDIVSK---FGSRDPALPM-----EGSFEEARRILLDKNECLYRRYQAMFY
DOHH2_ORYSJ     E-TCELAIRRIE-EQKNTSGVESATVSPFLSVDPALP-----AKQGLPXXXXXXXXXXXSMYERYAALFA
YPGR_BACSU      -----------------DDEDWKKRYAHLEQMDPK--------EEDIPVLQKALDDPKVSI--RRQAVVY


                         .         .         .         +         .         .         .:280
query           LRDMCSPPDLPTAVPAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHXXXX
DOHH_COCIM      LRDMCSPPDLPTAVPAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHXXXX
DOHH_ASPCL      LRDLASPPDLPTATHAVEALAKGLKDPSALFRHEIAFVFGQLSHPASIPSLTEALSDQNEVGMVRHEAAE
DOHH_EMENI      LRDLASPPDLPTAKQAVQSLAKGMKDPSALFRHEIAFVFGQLCHPASVPSLTETLSDLNEVGMVRHEAAE
DOHH_NEOFI      LRDLASPPDLPTATRAVEALAKGLKDPSALFRHEIAFVFGQLCHPASIPSLTEALSNQSEAGMVRHEAAE
DOHH_ASPFU      LRDLASPPDLPTATRAVEALAKGLKDPSALFRHEIAFVFGQLCHPASIPSLTEALSNQSEAGMVRHEAAE
DOHH_ASPOR      LRDLASPPDLPTAVEAVEALAKGLKDPSALFRHEVAFVFGQLCHPASVPSLTETLSDQKEMGMVRHEAAE
DOHH_PHANO      LRDLSSPPDLPTAVPAVHALARGFGDPSALFRHEIAFVFGQLSHPASIPSLTEALSNTKEASMVRHEAAE
DOHH_ASPNC      LRDLASPPDLPTAVQAVDALAKGLKDPSALFRHEVAFVFGQLCHPASVPSLTECLSNQEEAGMVRHEAAE
DOHH_NEUCR      LRDLASPPDLPTAVPAILALAKGLKDESALFRHEIAFVFGQLSHPASIPALTEALSNLDEVSMVRHEAAE
DOHH_CHAGB      LRDLASXXXXXXXXXXXXXXXKGFADSSALFRHEIAFVFGQLAHPASIPALTEALSNTEEASMVRHEAAE
DOHH_GIBZE      LRDLASXXXXXXXXXXXXXXXKGLSDSSALFRHEIAFVFGQLSHPASIPALTEALSNTNEASMVRHEAAE
DOHH_CANAL      LRDIGTD-------EACLALASGFDDPSALFKHEIAYVFGQMCNPVTVPSLIKVLKDESEAGMVRH-EAA
DOHH_KLULA      LRDIGND-------EACLALASGFDDPSALFKHEIAYVFGQICNPVVVPHLKEVLARPEEAPMVRH-EAA
DOHH_DEBHA      LRDMGTD-------EACLALASGLDDPSALFKHEIAYVFGQLCNPVTVPALIKTLKDEREAAMVRH-EAA
DOHH_YARLI      LRDIGTED-------AVLALATGFDDSSALFRHEIAYVFGQMSDPASVPALIKVLGKTEEEGMVRH-EAA
DOHH_YEAST      LRDIGTDE-------AILALATGFSAESSLFKHEIAYVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAE
DOHH_DROPS      LRNLCTEE-------SVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPYLQENLEDHKENEMVRHECAE
DOHH_DROME      LRNLRTEE-------SVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPFLQENLEDRLENEMVRHECAE
DOHH_ASHGO      LRDIGSDE-------ACYALASGFDDPSALFKHEIAYVFGQIGNPCVVPHLQEVLKREHEAPMVRH-EAA
DOHH_SCHPO      LRNIGNEE-------AVLALTDGFKDPSPLFRHEIAFVFGQMIAPASVPALIKVLENTEEVPMVRH-EAA
DOHH_DANRE      LRNLGTE-------EAVLALGDGLQCSSALFRHEIGYVLGQIQHEASIPQLQAALEKMDENAMVRHECAE
DOHH_CANGA      LRDIGTDE-------AVLALASGFNDPSALFKHEIAYVFGQMGSTAAVPSLTEVLGRKEEAPMVRHEAAE
DOHH_LENED      LRNIGSPA-------AVDALAAGFSGDSALFKHEIAFVFGQLLSPHSVPCLIEVLQNSPESDMVRHEAAE
DOHH_CHICK      LRNL-------GGRDAVLALADGLRAGSALFRHEIGYVLGQMQDEACVPQLTAALRSRAENPMVRHECAE
DOHH_XENLA      LRNI-------GGEEAVLALADGLQIGGSLFRHEIGYVLGQMQHKAAVPGLSAALERFEENPMVRHECAE
DOHH_MOUSE      LRNVXXXXXXXXXXXXXQC-------GSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRH-ECA
DOHH_USTMA      LRNVAHGGG-DGAIQAVLALARGLQDGSALFRHEICFVFGELCHPASIPSMLHVLNDTKEHEMVRHGEHA
DOHH_CAEEL      LRNIKTD-------KSIKALAQGYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHECAE
DOHH_RAT        LRNVXXXXXXXXXXXXXXC-------GSALFRHEVGYVLGQLQHEAAVSELAATLARTTESPMVRH-ECA
DOHH_DICDI      LRDIGDEQ-------SVLALCDGLKDQSALLRHEVAFVLGQLQHRVAIDPLTTCVLDESENAMVRHEAAE
DOHH_BOVIN      LRDXXXXXXXXXXXXXXRC-------GSALFRHEIGYVLGQMQHEXXXXXXXXXXXXXTENPMVRH-ECA
DOHH_ARATH      LRNHGGEE-------AVSAIVDSLSASSALLRHEVAYVLGQLQSKTALATLSKVLRDVNEHPMVRHEAAE
DOHH_HUMAN      LRNXXXXXXXXXXXXXXHC-------GSALFRHEVGYVLGQLQHEXXXXXXXXXXXRCTENPMVRH-ECA
DOHH_CRYNE      LRDFGAG-----SKEAVEALADGFRDGSALFRHEIAYIFGQXXXXXXXXXXXXXXXDAKEDDMVRH-EAA
DOHH1_ORYSJ     LRN-------DSRDXXXXXXXXXXXXKSALLKHEVAYVLGQLQNKAASDALSTVLKNVDEHPMVRHEAAE
DOHH_ENCCU      LRDLGTSA-------AIHALGKSMEDDSALFKHEVSFVFGQMRSRESIPYLIKGMEDEKEHGMVRH-ECA
DOHH2_ORYSJ     LRN-------DSGDAAVSAIVAALGVKSALLRHEVAYVLGQLQNKAASDALSTVLKNVDEHPMVRHEAAE
YPGR_BACSU      LGMIETPDVLPLLYKALE-------DKAVSVRRTAGDCLSDIGDPQAIPAMIKSLSDSSK--LVRWRAAM


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDGVEETLKRFVNDPETVVRDSIIVALDMAEYEKSGEQEYILEQPVAA
DOHH_COCIM      XXXXXXXXDGVEETLKRFVNDPETVVRDSIIVALDMAEYEKSGEQEYILEQPVAA
DOHH_ASPCL      ALGSLGDCEGVEDTLKKFLNDPEQVVRDSVIVALDMAEYEKNGEIEYAL------
DOHH_EMENI      ALGSLGDVEGVEDTLKKFLNDPEKVVRDSIIVALDMAEFEKNGEIEYAL------
DOHH_NEOFI      ALGSLGDCEGVEETLRKFLNDPEQVVRDSVIVALDMAEYEKNGEVEYAL------
DOHH_ASPFU      ALGSLGDYEGVEETLRKFLNDPEQVVRDSVIVALDMAEYEKNGEVEYAL------
DOHH_ASPOR      ALGSLGDVEGVEDTLKKFLNDPEQVVRDSIIVALDMAEYEKNGEMEY--------
DOHH_PHANO      ALGSLGDEEGVEETLKKFLNDPEQVVRDSVIVALDMAEFEKNGEVEYAI------
DOHH_ASPNC      ALGSLGDVEGVEDTLKKFLNDPEQVVRDSIIVALDMAEFEKNGEMEYAL------
DOHH_NEUCR      ALGSLGDEEGVEETLLKFLHDKEKVVRESVIVALDMAEFEQSGQAEYALIPEVAS
DOHH_CHAGB      ALGSLGDEEGVEETLRKFLHDAEAVVRESVIVALDMAEYEKSNETEYAL------
DOHH_GIBZE      ALGSLGEKDGVEDTLRKFLHDKEKVVRESCIVALDIAEYEKGEDAEYAL------
DOHH_CANAL      EALGSIATDECLPVLQSFLNDSEPVVRDSAIVALDMYEYENSNELEY--------
DOHH_KLULA      EALGSIATDDVLPVLKEHLKDSDSVVRESAIVALDMYEYENSNDLEY--------
DOHH_DEBHA      EALGSIATDECLPVLQSFLNDKDQVVRDSAVVALDMYEYENSTE-----------
DOHH_YARLI      EALGSIATDDVLPILKKFAEDKDQVVRESAIVALDMYEYENSNEVEY--------
DOHH_YEAST      ALGAIASPE-VVDVLKSYLNDEVDVVRESCIVALDMYDYENSNELEY--------
DOHH_DROPS      ALGAIATDDCI-QILTRYADDEKRVVKESCVIALDMCEYENSPEFQY--------
DOHH_DROME      ALGAIATEDCI-QILNRYAEDDKRVVKESCVIALDMCEYENSPEFQY--------
DOHH_ASHGO      EALGSIATDDVLPVLKRHLQDKDEVVRESAAIALDMYDYENSNELEY--------
DOHH_SCHPO      EALGGIANDECLPVLKKFSKDDVRVVAESCIVALDMIEYEKSGDMEYAYIPKVSA
DOHH_DANRE      ALGSIGKEPCV-QILERYRKDQERVVKESCEVALDMLEYENSSQFQY--------
DOHH_CANGA      ALGAIASEDAL-PILKQYLNDEVDVVRESAIVALDMWEYENSNELEY--------
DOHH_LENED      ALGGIATPE-VLPPLKEWVDDAPVVVRESCQVALDLWEYENSGDFQYALESP---
DOHH_CHICK      ALGSIARPSCL-ETLRAFAQDEERVVRESCEVALDMYEYENGPQFQY--------
DOHH_XENLA      ALGSIAHEDCL-KALRAHVGDGERVVRESCEVALDMHDYENSGDFQY--------
DOHH_MOUSE      EALGAIARPACLAALREHIEDPEQVVRESCEVALDMYEYESSQDFQY--------
DOHH_USTMA      ANDSANDYTRVLDTLNKWAHDMDAVVRESCIVALDELAYNNDPTQFHRIETPVAA
DOHH_CAEEL      ALGAIANEE-CTEILKQYVNDEERVVRESCEVALDMAEYENSDDLQY--------
DOHH_RAT        EALGAIARPACLAALREYITDPERVVRESCEVALDMYEYENGQDFQY--------
DOHH_DICDI      ALGAIASTETI-PLLEKLLQDKEPIVSESCAVALDVTEYFNNTE-----------
DOHH_BOVIN      EALGAIARPACLAALRAHVADPERVVRESCEVALDMYEYETGSTFQY--------
DOHH_ARATH      ALGSIADEQSI-ALLEEFSKDPEPIVAQSCEVALSMLEFENSGK-----------
DOHH_HUMAN      EALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQY--------
DOHH_CRYNE      EALGGIASDGVESENPEVVADAPTVVRESCQVAIDMWEYENSADQ----------
DOHH1_ORYSJ     ALGSIADQESI-ALLEEFAKDPEPIVSQSCEVALSMLEYERSGK-----------
DOHH_ENCCU      EALGAIGDDAALKALSKYLHDPCDILRESVEVAVDIHSYMTGDEIEY--------
DOHH2_ORYSJ     ALGSIADQESI-ALLEEFAKDPEPIVSQSCEVALSMLEYERSGKAEFLFPQ----
YPGR_BACSU      FLYEVGDESAI-EALRAAEDDPEFEVSLQVKMALERIEH----------------