[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01210

[Show Plain Result]


## Summary of Sequence Search
    1::551
    1::556     e-171  61%  556 aa  MPIP_EMENI RecName: Full=M-phase inducer phosphatase;       
   60::585     3e-41  33%  596 aa  MPIP_SCHPO RecName: Full=M-phase inducer phosphatase;       
  227::417     1e-33  41%  554 aa  MPIP_YEAST RecName: Full=M-phase inducer phosphatase;       
  374::563     4e-31  43%  580 aa  MPIP2_HUMAN RecName: Full=M-phase inducer phosphatase 2;       
  402::542     4e-30  47%  576 aa  MPIP2_MOUSE RecName: Full=M-phase inducer phosphatase 2;       
  262::506     7e-30  36%  524 aa  MPIP1_HUMAN RecName: Full=M-phase inducer phosphatase 1;       
  334::540     1e-29  39%  574 aa  MPIP2_RAT RecName: Full=M-phase inducer phosphatase 2;       
  269::470     4e-29  35%  502 aa  MPIP3_PIG RecName: Full=M-phase inducer phosphatase 3;       
  297::507     1e-28  38%  525 aa  MPIP1_RAT RecName: Full=M-phase inducer phosphatase 1;       
  358::507     1e-28  41%  525 aa  MPIP1_BOVIN RecName: Full=M-phase inducer phosphatase 1;       
  302::463     3e-28  41%  473 aa  MPIP3_HUMAN RecName: Full=M-phase inducer phosphatase 3;       
  347::496     3e-28  41%  514 aa  MPIP1_MOUSE RecName: Full=M-phase inducer phosphatase 1;       
  192::386     7e-28  39%  420 aa  MPIP3_MESAU RecName: Full=M-phase inducer phosphatase 3;       
  278::445     9e-28  40%  477 aa  MPIP3_BOVIN RecName: Full=M-phase inducer phosphatase 3;       
  268::414     2e-27  42%  447 aa  MPIP3_MOUSE RecName: Full=M-phase inducer phosphatase 3;       
  297::476     2e-25  39%  479 aa  MPIP_DROME RecName: Full=M-phase inducer phosphatase;       
  170::383     1e-24  36%  426 aa  TWINE_DROME RecName: Full=Cdc25-like protein phosphatase twine;    
  385::546     6e-24  37%  550 aa  MPI1B_XENLA RecName: Full=M-phase inducer phosphatase 1-B;       
  118::257     2e-23  43%  316 aa  MPIP3_CAEEL RecName: Full=M-phase inducer phosphatase cdc-25.3;    
  256::423     2e-23  39%  604 aa  MPIP1_CAEEL RecName: Full=M-phase inducer phosphatase cdc-25.1;    
  245::366     4e-23  45%  480 aa  MPIP2_CAEEL RecName: Full=M-phase inducer phosphatase cdc-25.2;    
  325::595     4e-22  29%  599 aa  MPIP2_XENLA RecName: Full=M-phase inducer phosphatase 2;       
  276::546     4e-22  29%  550 aa  MPI1A_XENLA RecName: Full=M-phase inducer phosphatase 1-A;       
  905::1021    4e-21  42% 1053 aa  MPIP_DICDI RecName: Full=M-phase inducer phosphatase;       
  295::560     6e-21  29%  572 aa  MPIP3_XENLA RecName: Full=M-phase inducer phosphatase 3;       
    5::124     4e-06  32%  138 aa  IBP1_SCHPO RecName: Full=Dual specificity phosphatase ibp1;        
  897::984     0.001  40% 1043 aa  KRBA1_MOUSE RecName: Full=Protein KRBA1;
    1::551

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEQSSPLAAMQPPSVMLRHHFRSEAKAGCSSFPAVRKFGPDSFNFRDLSMKTGHSDYFNTKALRGSSPTV
MPIP_EMENI      MEHSSPLAAMQPPSVMLGHCFRSDAPTSYHGFSXXXXXXXXXFNFKDLSMKRSNGDYFGTKVVRGSSPTA
MPIP_SCHPO      ------------------------------------------------------------KTCSTASPAS
MPIP_YEAST      ----------------------------------------------------------------------
MPIP2_HUMAN     ----------------------------------------------------------------------
MPIP2_MOUSE     ----------------------------------------------------------------------
MPIP1_HUMAN     ----------------------------------------------------------------------
MPIP2_RAT       ----------------------------------------------------------------------
MPIP3_PIG       ----------------------------------------------------------------------
MPIP1_RAT       ----------------------------------------------------------------------
MPIP1_BOVIN     ----------------------------------------------------------------------
MPIP3_HUMAN     ----------------------------------------------------------------------
MPIP1_MOUSE     ----------------------------------------------------------------------
MPIP3_MESAU     ----------------------------------------------------------------------
MPIP3_BOVIN     ----------------------------------------------------------------------
MPIP3_MOUSE     ----------------------------------------------------------------------
MPIP_DROME      ----------------------------------------------------------------------
TWINE_DROME     ----------------------------------------------------------------------
MPI1B_XENLA     ----------------------------------------------------------------------
MPIP3_CAEEL     ----------------------------------------------------------------------
MPIP1_CAEEL     ----------------------------------------------------------------------
MPIP2_CAEEL     ----------------------------------------------------------------------
MPIP2_XENLA     ----------------------------------------------------------------------
MPI1A_XENLA     ----------------------------------------------------------------------
MPIP_DICDI      ----------------------------------------------------------------------
MPIP3_XENLA     ----------------------------------------------------------------------
IBP1_SCHPO      ----------------------------------------------------------------------
KRBA1_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SLAADLSQNFHIDKSPQLATPRRSLFTASLFGPENGRDNMTTXXXXXXXXXXNMEIMDMSPLPHKIPYCH
MPIP_EMENI      SLAADLSQNFHIDQSPQVATPRRSLFSACLLGNGNRRDXXXXXXXXXXXXXXXXDIMDMSPLPHKPPFIS
MPIP_SCHPO      SLAADMSMNMHIDESPALPTPRRTLFRSLSCTVETPLANKTI----------------VSPLPESPSNAS
MPIP_YEAST      ----------------------------------------------------------------------
MPIP2_HUMAN     ----------------------------------------------------------------------
MPIP2_MOUSE     ----------------------------------------------------------------------
MPIP1_HUMAN     ----------------------------------------------------------------------
MPIP2_RAT       ----------------------------------------------------------------------
MPIP3_PIG       ----------------------------------------------------------------------
MPIP1_RAT       ----------------------------------------------------------------------
MPIP1_BOVIN     ----------------------------------------------------------------------
MPIP3_HUMAN     ----------------------------------------------------------------------
MPIP1_MOUSE     ----------------------------------------------------------------------
MPIP3_MESAU     ----------------------------------------------------------------------
MPIP3_BOVIN     ----------------------------------------------------------------------
MPIP3_MOUSE     ----------------------------------------------------------------------
MPIP_DROME      ----------------------------------------------------------------------
TWINE_DROME     ----------------------------------------------------------------------
MPI1B_XENLA     ----------------------------------------------------------------------
MPIP3_CAEEL     ----------------------------------------------------------------------
MPIP1_CAEEL     ----------------------------------------------------------------------
MPIP2_CAEEL     ----------------------------------------------------------------------
MPIP2_XENLA     ----------------------------------------------------------------------
MPI1A_XENLA     ----------------------------------------------------------------------
MPIP_DICDI      ----------------------------------------------------------------------
MPIP3_XENLA     ----------------------------------------------------------------------
IBP1_SCHPO      ----------------------------------------------------------------------
KRBA1_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NADLDLDSPTTEISLAKSQQVHAQLSLEDSPMDLEPPGRPQRHKPPILRPSLMRSKAYSSGDKGSLAPQP
MPIP_EMENI      TPEIELDSPTLESSPMDTTMMSTDGLVPDSPTVLPKDGKQERRRPTFLRPSLARSKAQSF-QVGMTRPAP
MPIP_SCHPO      KYSITQDSPRVSSTIAYSFKPKASIALNTTKXXXXXXXXXXXXXXXYLRPNVSRSRSSGNGTSGGQATRH
MPIP_YEAST      ----------------------------------------------------------------------
MPIP2_HUMAN     ----------------------------------------------------------------------
MPIP2_MOUSE     ----------------------------------------------------------------------
MPIP1_HUMAN     ----------------------------------------------------------------------
MPIP2_RAT       ----------------------------------------------------------------------
MPIP3_PIG       ----------------------------------------------------------------------
MPIP1_RAT       ----------------------------------------------------------------------
MPIP1_BOVIN     ----------------------------------------------------------------------
MPIP3_HUMAN     ----------------------------------------------------------------------
MPIP1_MOUSE     ----------------------------------------------------------------------
MPIP3_MESAU     ----------------------------------------------------------------------
MPIP3_BOVIN     ----------------------------------------------------------------------
MPIP3_MOUSE     ----------------------------------------------------------------------
MPIP_DROME      ----------------------------------------------------------------------
TWINE_DROME     ----------------------------------------------------------------------
MPI1B_XENLA     ----------------------------------------------------------------------
MPIP3_CAEEL     ----------------------------------------------------------------------
MPIP1_CAEEL     ----------------------------------------------------------------------
MPIP2_CAEEL     ----------------------------------------------------------------------
MPIP2_XENLA     ----------------------------------------------------------------------
MPI1A_XENLA     ----------------------------------------------------------------------
MPIP_DICDI      ----------------------------------------------------------------------
MPIP3_XENLA     ----------------------------------------------------------------------
IBP1_SCHPO      ----------------------------------------------------------------------
KRBA1_MOUSE     ---------------------------------------PTRPRPKILRTQAEGCKTSDSRGKGSLVPQL


                         .         .         .         +         .         .         .:280
query           PPFRFAAGSSKPTACSSLSLSEMFEQSPPRESSPRFLTSISMGPPRPRAPFSGVVGQCRSNGSPVNGIRK
MPIP_EMENI      PPFKFQTGINKTSSGVAASLEDMFGESPQRERPMMRINSTSGLNSRLRPPL-GSGSHVRGNGSPAASVRK
MPIP_SCHPO      LTYALSRTCSQSSNTTSLLESCLTDDTDDFELMSDHEDTFTMGKQRPNSDF----GACNDNSKPIDMLPK
MPIP_YEAST      ----------------------------------------------------------------------
MPIP2_HUMAN     ----------------------------------------------------------------------
MPIP2_MOUSE     ----------------------------------------------------------------------
MPIP1_HUMAN     -----------PSLCSSSTRSVLKRPERSQEESPP-------GSTKRRKSMSGA--------SP----KE
MPIP2_RAT       ---------------------------------------------RPHDRDVPVLSKRRKSGTPLE----
MPIP3_PIG       ---------------------------------------------------------------------K
MPIP1_RAT       -----------------------------------------------------------SEASPV----K
MPIP1_BOVIN     ----------------------------------------------------------------------
MPIP3_HUMAN     ----------------------------------------------------------------------
MPIP1_MOUSE     ----------------------------------------------------------------------
MPIP3_MESAU     --------------------------------------------------------EVRSLGSPITAVPK
MPIP3_BOVIN     ----------------------------------------------------------------------
MPIP3_MOUSE     ----------------------------------------------------------------------
MPIP_DROME      ----------------------------------------------------------------------
TWINE_DROME     ----------------------------------------------------------------------
MPI1B_XENLA     ----------------------------------------------------------------------
MPIP3_CAEEL     ----------------------------------------------------------------------
MPIP1_CAEEL     ----------------------------------------------------------------------
MPIP2_CAEEL     ----------------------------------------------------------------------
MPIP2_XENLA     ----------------SLNRSRLYRSPSMPEKLDRPMLKRPVRPLDSETPVR--VKRRRSTSSPLQPEEE
MPI1A_XENLA     ----------------SLNRSRLYRSPSMPEKLDRPMLKRPVRPLDSETPVR--VKRRRSTSSPLQPEEE
MPIP_DICDI      ----------------------------------------------------------------------
MPIP3_XENLA     ----------------SLNRSRLYRSPSMPEKLDRPMLKRPVRPLNSETPVR--VKRRRSTSSPLQPEEE
IBP1_SCHPO      ----------------------------------------------------------------------
KRBA1_MOUSE     PPEASLVESSRPTCSSSQQISSVLTAHPPLEH-----TACHQNPLSPSVPTS------------------


                         .         *         .         .         .         .         +:350
query           SSNPFCRPRKQSRRSLSMFEHPEDIVNQEEDTIMSSPGLQPIADIDSQPTLQLPHFIPEDGPDQLPRVES
MPIP_EMENI      SAHPNMRPRKQCRRSLSMYEHPEDVIADSEVSYTSNAPLQSISDFEETQALQLPHFIPEEQADNLPRIDK
MPIP_SCHPO      INKDIAFPSLKVRSPSPMFAMQEDAEYDEQDTPVTRLGLFKSQDLPKQSTKESERFISEDKEDSLKRITQ
MPIP_YEAST      ---------------------------------------------------QIPYYYDDNSNDFFPRISP
MPIP2_HUMAN     ----------------------KSLCHDEIENLLDSDHRELIGDYSKAFLLQTV-----DGKHQLKYISP
MPIP2_MOUSE     -----------------------------------------------------------DGKHQLKYISP
MPIP1_HUMAN     STNPE-KAHETLHQSLSLASSPKGTI----ENILDNDPRDLIGDFSKG---YLFHTVAGKHQD-LKYISP
MPIP2_RAT       -EQQLEEPKARVFRSKSLCHEIESILDSDHRGL--------IGDYSKAFLLQTV-----DGKHQLKYISP
MPIP3_PIG       VKKKYCSSHEELRKGLGVKKMVSNMIQMLEEDSNQGPLIGDFSKVCALPTVSGRH-------QDLKYVNP
MPIP1_RAT       ADVP--EPTQLPHQSLSLTSFPKGTI----ENIFHSDPRDLIGDFSKG---YLFHTVSGKHQD-LKYISP
MPIP1_BOVIN     ----------------------------------------------------------------LKYISP
MPIP3_HUMAN     ----------------------------------------------------------------LKYVNP
MPIP1_MOUSE     ----------------------------------------------------------------LKYISP
MPIP3_MESAU     LS-----------KNLNL---------EDQEEISEEPMEFSLEDHDTKPTVSGKH-------QDLKYITP
MPIP3_BOVIN     ----------------------------EEDS-NQGPLIGDFSKVCALPTVSGKH-------QDLKYVNP
MPIP3_MOUSE     --------------------------------------------------------VPGKHPD-LKYISP
MPIP_DROME      ----------------------------------------------------------------LKSISS
TWINE_DROME     ------------RRCLSMYEQPEEAVQEPDQEIMRALGDEPELIGDLSKPCTLPCLATGIRHRDLKTISS
MPI1B_XENLA     -------------------------------------------------------------------ITG
MPIP3_CAEEL     ------------------------------------------------------------------KITS
MPIP1_CAEEL     -----------------------------------------VGEIDSEPTLEVKYTLPGDNPQRESQAFR
MPIP2_CAEEL     ----------------------------------------------------------------------
MPIP2_XENLA     N----CQPQRRGKKTLSLCD--VDISTVLDEDCGHRQLIGDFSKVYALPTVTGRH-------QDLRYITG
MPI1A_XENLA     N----CQPQRRGKKTLSLCD--VDISTVLDEDCGHRQLIGDFSKVYALPTVTGRH-------QDLRYITG
MPIP_DICDI      ----------------------------------------------------------------------
MPIP3_XENLA     N----CQPQRRGKKTLSLCD--VDISSVLDEDCGHRQLIGDFSKVYALPTVTGRH-------QDLRYITG
IBP1_SCHPO      ---------------------------------------------------------------------S
KRBA1_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVLVDIINGKYNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
MPIP_EMENI      ATLVDIKEGKYDNMFDNIMIIDCRFEYEYDGGHIVGAVNYNDKENLAAELF-ADPKPRTAIVFHCEYSVH
MPIP_SCHPO      ETLLGLLDGXXXXXXXXXXXXXXRFEYEYLGGHISTAVNLNTKQAIVDAFLSKPLTHRVALVFHCEHSAH
MPIP_YEAST      ETLKNILNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIHSRDELEYEFIHKVLHSDTSLIIHCEFSSH
MPIP2_HUMAN     ETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLLIFHCEFSSE
MPIP2_MOUSE     ETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLERDAETFLLQRPIMPCSILIFHCEFSSE
MPIP1_HUMAN     EIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTVIVVFHCEFSSE
MPIP2_RAT       ETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLEPDAETFLLKHPITPCNILIFHCEFSSE
MPIP3_PIG       ETVAALLSGKFQGLIEKFYIIDCRYPYEYLGGHIQGALNLYSQEELC-NFFLKKPQKRIIVVFHCEFSSE
MPIP1_RAT       EIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEEFLLKKPIVPAVIVVFHCEFSSE
MPIP1_BOVIN     EIITSVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEEFLLKKPIVPTVIVVFHCEFSSE
MPIP3_HUMAN     ETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELF-NFFLKKPQKRIIIVFHCEFSSE
MPIP1_MOUSE     EIMASVLNGKFASLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKNPIVPTVIVVFHCEFSSE
MPIP3_MESAU     DTVAALLSGKFQGLIEKFYIIDCRYPYEYLGGHILGAINLCSQKELH-EFFLKKPQKRVIIVFLCEFSSE
MPIP3_BOVIN     ETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELY-NFFLKKPQKRIVIVFHCEFSSE
MPIP3_MOUSE     DTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELH-EFFLRKPQKRVIIVFLCEFSSE
MPIP_DROME      ETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFXXESGHKRNIIIFHCEFSSE
TWINE_DROME     DTLARLIQGEFDEQLGSYEIIDCRYPYEFLGGHIRGAKNLYTRGQIAFPTLTSNQENRRIYVFHCEFSSE
MPI1B_XENLA     ETLAALIHGDFSSLVEKIFIIDCRYPYEYDGGHIKGALNLHRQEEVTDYFLKQPLTPTMAIIFHCEFSSE
MPIP3_CAEEL     ETLIEIMQKLSQEFMQKYILIDCRYDYEYNGGHIKGAQSLFNPETAADFFFNKDKKINRIPIFYCEYSQK
MPIP1_CAEEL     SISPTTLLLEFQDDFDKYIIVDCRFPFEYKGGHVKGAINLFRHDKIKPIFFPENGEASSVPIFYCEYSQK
MPIP2_CAEEL     ---------------DKYILIDCRYPYEYNRGHIKNAINHFDRVTVSKIFYDENGRKNKIPIFYCEFSQA
MPIP2_XENLA     ETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQEEV-TDYFLQQPQKRLIIIFHCEFSSE
MPI1A_XENLA     ETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQEEV-TDYFLQQPQKRLIIIFHCEFSSE
MPIP_DICDI      -----------------ITVVDCRYKYEYDGGHIKNAINITGSRQMVLDRFFKFPTPKNVIIFHCEFSSK
MPIP3_XENLA     ETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQDEVTDYFLQQPLTPLMAIIFHCEFSSE
IBP1_SCHPO      YVSPDALKGWLMESPNEISIIDVR-DYDYEGERIPGSVRIPSDTFLASDQHVDDLMKKRSLIVHCTYSQV
KRBA1_MOUSE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEHEFACERGLGK
MPIP_EMENI      RAPLMAKYIRHRDRAYNVDHYPQLSYPDMYILEGGYSGFFAEHRSLCYPQNYVEMSAKEHEFACERGLGK
MPIP_SCHPO      RAPHLALHFRNTDRRMNSHRYPFLYYPEVYILHGGYKSFYENHKNRCDPINYVPMNDASHVMTCTKAMNN
MPIP_YEAST      RGPSLASHLRNCDRIINQDHYPKLFYPDILILDGGYKAVFDNFPELCYPRQYVGMNSQENLLNCEQEMDK
MPIP2_HUMAN     RGPRMCRFIRERDRAVND--YPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN---HEFKDELKTFR
MPIP2_MOUSE     RGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN--------------
MPIP1_HUMAN     RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPM----HHEDFKEDLKK
MPIP2_RAT       RGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN--------------
MPIP3_PIG       RGPRMCRSLREEDRALNQ--YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHK---------
MPIP1_RAT       RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPM----HHEDFKEDLKK
MPIP1_BOVIN     RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPM----HHEDFKEDLKK
MPIP3_HUMAN     RGPRMCRCLREEDRSLNQ--YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHELLRCRSQSK
MPIP1_MOUSE     RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPM----HHEDFKEDLKK
MPIP3_MESAU     RGPRMCRSLRRKDRALNQ--YPALYYPELYILKGGYRDFFPEYTELCEPQGYCPMHHQDHQ---------
MPIP3_BOVIN     RGPRMCRSLREEDRTLNQ--YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHK---------
MPIP3_MOUSE     RGPRMCRSLREKDRALNQ--YPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQ---------
MPIP_DROME      RGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTMEAYRHFRAKSKGLGG
TWINE_DROME     RGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPMLAPAH----------
MPI1B_XENLA     RGPKMCRFLREEDRARN--XXXXXXXXXXXXXKGGYKDFFPEYKELCEPQSYCPMHHQDFRTKCKTSVGD
MPIP3_CAEEL     RGPTMANNLREVDRKLNSNIYPRCDYEEIYLLEGGYKNFYAFTRGLCEPDNYVIM---------------
MPIP1_CAEEL     RGPTMAHAVRSIDRVLNELRYPHVEYPEMYLLDYGYKSLWAECRQICEPCSYIPMT--------------
MPIP2_CAEEL     RGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFANITNLCQPHAYCEMHDKEH----------
MPIP2_XENLA     RGPKMCRFLREEDRASN--DXXXXXXXXXXXXKGGYKDFFPEYKELCEPQSYCPMHHQDFRTKCKTSVGD
MPI1A_XENLA     RGPKMCRFLREEDRASN--DXXXXXXXXXXXXKGGYKDFFPEYKELCEPQSYCPMHHQDFRTKCKTSVGD
MPIP_DICDI      RAPDCYSLFRELDREHNE--YPNIHYPEIYLLNGGYKKFFESFQGDMCEGNYIRMDDKLYQ---------
MPIP3_XENLA     RGPKMCRSLREEDRASN--DXXXXXXXXXXXXKGGYKDFFPEYKELCEPQSYCPMHHQDFRTKCKTSVGD
IBP1_SCHPO      RGPVLSEILRNRITXXXXXXXXXXNLPTVYILHGGFSAW-------------------------------
KRBA1_MOUSE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VKQRSKLSRAQTFAFGQNSLQIEESPTGRCRPVGDRSCDPDAPFDRDVEVTRLPGRRMFSY
MPIP_EMENI      VKQRSKLSRAQTFAFGQQSPEMEDSPTGRCRNPGDRKL-LASPFN-DSPGSRFPGRRMLSY
MPIP_SCHPO      FKRNATFMRTKSYTFGQSVLDVNDSPT----------------------------------
MPIP_YEAST      FRRESK-----RFATKNNSFRKLASPS----------------------------------
MPIP2_HUMAN     LKTRS--------------------------------------------------------
MPIP2_MOUSE     -------------------------------------------------------------
MPIP1_HUMAN     FRTKSR-------------------------------------------------------
MPIP2_RAT       -------------------------------------------------------------
MPIP3_PIG       -------------------------------------------------------------
MPIP1_RAT       FRTKSR-------------------------------------------------------
MPIP1_BOVIN     FRTKSR-------------------------------------------------------
MPIP3_HUMAN     VQEGERQLREQ--------------------------------------------------
MPIP1_MOUSE     FRTKSR-------------------------------------------------------
MPIP3_MESAU     -------------------------------------------------------------
MPIP3_BOVIN     -------------------------------------------------------------
MPIP3_MOUSE     -------------------------------------------------------------
MPIP_DROME      ATGRLKKSRSR--------------------------------------------------
TWINE_DROME     -------------------------------------------------------------
MPI1B_XENLA     RKRREQIAR----------------------------------------------------
MPIP3_CAEEL     -------------------------------------------------------------
MPIP1_CAEEL     -------------------------------------------------------------
MPIP2_CAEEL     -------------------------------------------------------------
MPIP2_XENLA     RKRREQVAR----------------------------------------------------
MPI1A_XENLA     RKRREQVAR----------------------------------------------------
MPIP_DICDI      -------------------------------------------------------------
MPIP3_XENLA     RKRR---------------------------------------------------------
IBP1_SCHPO      -------------------------------------------------------------
KRBA1_MOUSE     -------------------------------------------------------------