[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01225

[Show Plain Result]


## Summary of Sequence Search
    1::252
  272::374     1e-33  58%  392 aa  RBM42_XENLA RecName: Full=RNA-binding protein 42;AltName:
  354::456     1e-33  59%  474 aa  RBM42_RAT RecName: Full=RNA-binding protein 42;AltName:
  354::456     1e-33  59%  474 aa  RBM42_MOUSE RecName: Full=RNA-binding protein 42;AltName:
  360::462     1e-33  59%  480 aa  RBM42_HUMAN RecName: Full=RNA-binding protein 42;AltName:
  328::430     1e-33  59%  448 aa  RBM42_BOVIN RecName: Full=RNA-binding protein 42;AltName:
    7::111     3e-33  58%  219 aa  YDB2_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  272::374     1e-32  57%  392 aa  RBM42_XENTR RecName: Full=RNA-binding protein 42;AltName:
  282::379     5e-32  58%  402 aa  RBM42_DANRE RecName: Full=RNA-binding protein 42;AltName:
  105::177     8e-13  40%  386 aa  TIA1_MOUSE RecName: Full=Nucleolysin TIA-1;AltName:
  105::177     8e-13  40%  386 aa  TIA1_HUMAN RecName: Full=Nucleolysin TIA-1 isoform p40;AltName:
  113::185     2e-12  40%  392 aa  TIAR_MOUSE RecName: Full=Nucleolysin TIAR;AltName:
   96::168     2e-12  40%  375 aa  TIAR_HUMAN RecName: Full=Nucleolysin TIAR;AltName:
  162::238     8e-11  39%  453 aa  PUB1_YEAST RecName: Full=Nuclear and cytoplasmic polyadenylated
  148::258     2e-10  35%  473 aa  YG41_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  269::340     2e-10  39%  414 aa  NSR1_YEAST RecName: Full=Nuclear localization sequence-binding
    9::85      3e-10  34%  992 aa  RMXL3_PANTR RecName: Full=RNA-binding motif protein,
    6::81      3e-10  34%  163 aa  CIRBP_XENLA RecName: Full=Cold-inducible RNA-binding protein;      
    8::86      4e-10  33%  157 aa  GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic
    7::82      4e-10  33%  172 aa  CIRBP_PONAB RecName: Full=Cold-inducible RNA-binding
    7::82      4e-10  33%  172 aa  CIRBP_HUMAN RecName: Full=Cold-inducible RNA-binding
  113::171     5e-10  46%  659 aa  MIP6_YEAST RecName: Full=RNA-binding protein MIP6;AltName:
    6::84      5e-10  32%  157 aa  GRP1_DAUCA RecName: Full=Glycine-rich RNA-binding protein;
    9::85      7e-10  32% 1067 aa  RMXL3_HUMAN RecName: Full=RNA-binding motif protein,
  165::235     7e-10  37%  523 aa  NAM8_YEAST RecName: Full=Protein NAM8;
  244::318     9e-10  36%  762 aa  PABP_MAGGR RecName: Full=Polyadenylate-binding protein, cytoplasmic
    6::84      9e-10  32%  169 aa  GRP8_ARATH RecName: Full=Glycine-rich RNA-binding protein
    7::82      9e-10  32%  172 aa  CIRBP_RAT RecName: Full=Cold-inducible RNA-binding protein;AltName:
    7::82      9e-10  32%  172 aa  CIRBP_MOUSE RecName: Full=Cold-inducible RNA-binding
    7::82      9e-10  32%  172 aa  CIRBP_CRIGR RecName: Full=Cold-inducible RNA-binding
  193::270     1e-09  37%  644 aa  PABP4_HUMAN RecName: Full=Polyadenylate-binding protein 4;       
    8::86      1e-09  32%  168 aa  GRP2_SORBI RecName: Full=Glycine-rich RNA-binding protein 2;
    6::84      1e-09  33%  169 aa  GRP10_BRANA RecName: Full=Glycine-rich RNA-binding protein 10;
    2::95      1e-09  36%  632 aa  CSTFT_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa
    2::95      1e-09  36%  616 aa  CSTFT_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa
  240::324     2e-09  35%  329 aa  ROC3_ARATH RecName: Full=31 kDa ribonucleoprotein,
    7::100     3e-09  36%  230 aa  RBM24_DANRE RecName: Full=RNA-binding protein 24;AltName:
    8::84      3e-09  34%  166 aa  GRP1_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP1A;
   96::174     4e-09  45%  287 aa  TSAP1_PONAB RecName: Full=tRNA selenocysteine 1-associated protein
   96::174     4e-09  45%  287 aa  TSAP1_HUMAN RecName: Full=tRNA selenocysteine 1-associated protein
   96::174     4e-09  45%  287 aa  TSAP1_BOVIN RecName: Full=tRNA selenocysteine 1-associated protein
  251::321     4e-09  32%  524 aa  RBM39_PONAB RecName: Full=RNA-binding protein 39;AltName:
  251::321     4e-09  32%  530 aa  RBM39_MOUSE RecName: Full=RNA-binding protein 39;AltName:
  251::321     4e-09  32%  530 aa  RBM39_HUMAN RecName: Full=RNA-binding protein 39;AltName:
    7::100     4e-09  40%  214 aa  RBM38_XENLA RecName: Full=RNA-binding protein 38;AltName:
  334::407     4e-09  38%  660 aa  PABP3_ARATH RecName: Full=Polyadenylate-binding protein 3;       
  144::258     4e-09  33%  672 aa  NGR1_YEAST RecName: Full=Negative growth regulatory protein
    9::84      4e-09  33%  391 aa  HNRPG_PANTR RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::84      4e-09  33%  391 aa  HNRPG_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    7::100     6e-09  40%  219 aa  RBM38_XENTR RecName: Full=RNA-binding protein 38;AltName:
  264::334     6e-09  34%  439 aa  RBM23_HUMAN RecName: Full=Probable RNA-binding protein 23;AltName:
  296::368     6e-09  38%  614 aa  PAP1L_HUMAN RecName: Full=Polyadenylate-binding protein 1-like;
    7::71      7e-09  38%  226 aa  RBM24_XENTR RecName: Full=RNA-binding protein 24;AltName:
    7::71      7e-09  38%  225 aa  RBM24_CHICK RecName: Full=RNA-binding protein 24;AltName:
    7::71      7e-09  38%  224 aa  RB24B_XENLA RecName: Full=RNA-binding protein 24-B;AltName:
    7::71      7e-09  38%  225 aa  RB24A_XENLA RecName: Full=RNA-binding protein 24-A;AltName:
  294::367     7e-09  34%  370 aa  PAB4L_HUMAN RecName: Full=Polyadenylate-binding protein 4-like;    
    9::84      1e-08  32%  396 aa  HNRPG_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   36::111     1e-08  37%  158 aa  GRP2_ARATH RecName: Full=Glycine-rich RNA-binding protein 2,
    7::71      1e-08  38%  236 aa  RBM24_HUMAN RecName: Full=RNA-binding protein 24;AltName:
  330::403     1e-08  36%  668 aa  PABP5_ARATH RecName: Full=Polyadenylate-binding protein 5;       
    9::84      1e-08  33%  392 aa  HNRGT_HUMAN RecName: Full=RNA-binding motif protein,
   96::174     2e-08  44%  287 aa  TSAP1_RAT RecName: Full=tRNA selenocysteine 1-associated protein
    7::71      2e-08  38%  215 aa  RBM38_CHICK RecName: Full=RNA-binding protein 38;AltName:
    9::84      2e-08  32%  388 aa  HNRPG_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein G; 
    8::84      2e-08  32%  176 aa  GRP7_ARATH RecName: Full=Glycine-rich RNA-binding protein 7;
    8::95      2e-08  35%  577 aa  CSTF2_PONAB RecName: Full=Cleavage stimulation factor 64 kDa
    8::95      2e-08  35%  580 aa  CSTF2_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa
    8::95      2e-08  35%  577 aa  CSTF2_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa
    8::95      2e-08  35%  572 aa  CSTF2_BOVIN RecName: Full=Cleavage stimulation factor 64 kDa
   90::171     2e-08  38%  300 aa  RU17_YEAST RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa
   36::88      2e-08  43%  379 aa  ROA3_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein A3; 
   36::88      2e-08  43%  379 aa  ROA3_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   36::88      2e-08  43%  378 aa  ROA3_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   96::174     3e-08  44%  287 aa  TSAP1_MOUSE RecName: Full=tRNA selenocysteine 1-associated protein
  258::337     3e-08  35%  342 aa  ROC2_ARATH RecName: Full=29 kDa ribonucleoprotein,
   30::94      3e-08  38%  239 aa  RBM38_HUMAN RecName: Full=RNA-binding protein 38;AltName:
  296::368     3e-08  36%  631 aa  PABP3_HUMAN RecName: Full=Polyadenylate-binding protein 3;       
   30::109     3e-08  33%  369 aa  MSIR6_DROME RecName: Full=RNA-binding protein Musashi homolog Rbp6;
    8::84      3e-08  31%  169 aa  GRP2_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP2A;
  296::368     3e-08  37%  629 aa  EPAB_XENTR RecName: Full=Embryonic polyadenylate-binding protein;  
    7::76      4e-08  33%  217 aa  ZCRB1_RAT RecName: Full=Zinc finger CCHC-type and RNA-binding
    7::76      4e-08  33%  217 aa  ZCRB1_MOUSE RecName: Full=Zinc finger CCHC-type and RNA-binding
    7::77      4e-08  41%  674 aa  YOCE_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  189::268     4e-08  34%  273 aa  ROC1_NICSY RecName: Full=29 kDa ribonucleoprotein A,
  205::284     4e-08  34%  289 aa  ROC1_ARATH RecName: Full=Ribonucleoprotein At2g37220,
  237::310     4e-08  38%  731 aa  PABP_ASPNC RecName: Full=Polyadenylate-binding protein, cytoplasmic
   38::97      4e-08  42%  629 aa  PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2;       
   22::71      4e-08  40%  346 aa  MSI2H_MOUSE RecName: Full=RNA-binding protein Musashi homolog 2;   
   22::71      4e-08  40%  328 aa  MSI2H_HUMAN RecName: Full=RNA-binding protein Musashi homolog 2;   
    9::84      4e-08  32%  388 aa  HNRPG_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
  115::164     5e-08  42%  346 aa  ROA1_CAEEL RecName: Full=Heterogeneous nuclear ribonucleoprotein
    3::80      5e-08  38%  373 aa  RO31_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A3
    5::122     5e-08  31%  751 aa  PABP_NEOFI RecName: Full=Polyadenylate-binding protein, cytoplasmic
  328::405     5e-08  35%  673 aa  PABP_CRYNE RecName: Full=Polyadenylate-binding protein, cytoplasmic
    9::84      5e-08  32%  394 aa  HNRGT_MACFA RecName: Full=RNA-binding motif protein,
  191::271     6e-08  30%  276 aa  ROC3_NICSY RecName: Full=28 kDa ribonucleoprotein, chloroplastic;  
  438::506     6e-08  32%  519 aa  ELAV_DROVI RecName: Full=Protein elav;AltName: Full=Embryonic
  402::470     6e-08  32%  483 aa  ELAV_DROME RecName: Full=Protein elav;AltName: Full=Embryonic
    7::76      8e-08  33%  217 aa  ZCRB1_HUMAN RecName: Full=Zinc finger CCHC-type and RNA-binding
   28::80      8e-08  42%  385 aa  RO32_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A3
  296::368     8e-08  36%  629 aa  EPABB_XENLA RecName: Full=Embryonic polyadenylate-binding protein
    7::76      1e-07  34%  218 aa  ZCRB1_XENLA RecName: Full=Zinc finger CCHC-type and RNA-binding
    7::76      1e-07  31%  218 aa  ZCRB1_DANRE RecName: Full=Zinc finger CCHC-type and RNA-binding
    9::83      1e-07  32%  496 aa  RBY1E_HUMAN RecName: Full=RNA-binding motif protein, Y chromosome,
    9::83      1e-07  32%  496 aa  RBY1D_HUMAN RecName: Full=RNA-binding motif protein, Y chromosome,
    9::83      1e-07  32%  496 aa  RBY1B_HUMAN RecName: Full=RNA-binding motif protein, Y chromosome,
    9::83      1e-07  32%  496 aa  RBY1A_HUMAN RecName: Full=RNA-binding motif protein, Y chromosome,
  336::404     1e-07  36%  592 aa  PABP_KLULA RecName: Full=Polyadenylate-binding protein, cytoplasmic
  296::368     1e-07  34%  633 aa  PABPB_XENLA RecName: Full=Polyadenylate-binding protein 1-B;       
  193::270     1e-07  33%  633 aa  PABPA_XENLA RecName: Full=Polyadenylate-binding protein 1-A;       
  299::371     1e-07  33%  382 aa  PABP5_PONPY RecName: Full=Polyadenylate-binding protein 5;       
  299::371     1e-07  33%  382 aa  PABP5_PANTR RecName: Full=Polyadenylate-binding protein 5;       
  299::371     1e-07  33%  382 aa  PABP5_MACMU RecName: Full=Polyadenylate-binding protein 5;       
  299::371     1e-07  33%  382 aa  PABP5_HYLLA RecName: Full=Polyadenylate-binding protein 5;       
  299::371     1e-07  33%  382 aa  PABP5_HUMAN RecName: Full=Polyadenylate-binding protein 5;       
  299::371     1e-07  33%  382 aa  PABP5_GORGO RecName: Full=Polyadenylate-binding protein 5;       
  193::270     1e-07  32%  636 aa  PABP1_RAT RecName: Full=Polyadenylate-binding protein 1;       
  296::368     1e-07  34%  636 aa  PABP1_PONAB RecName: Full=Polyadenylate-binding protein 1;       
  193::270     1e-07  32%  636 aa  PABP1_MOUSE RecName: Full=Polyadenylate-binding protein 1;       
  296::368     1e-07  34%  636 aa  PABP1_HUMAN RecName: Full=Polyadenylate-binding protein 1;       
  296::368     1e-07  34%  636 aa  PABP1_BOVIN RecName: Full=Polyadenylate-binding protein 1;       
   48::124     1e-07  31%  272 aa  U1SBP_XENLA RecName: Full=U11/U12 small nuclear ribonucleoprotein
   99::179     1e-07  38%  316 aa  TSP1L_DANRE RecName: Full=tRNA selenocysteine 1-associated protein
  104::229     1e-07  28%  233 aa  ROC1_SPIOL RecName: Full=28 kDa ribonucleoprotein, chloroplastic;  
  196::274     1e-07  33%  279 aa  ROC1_NICPL RecName: Full=30 kDa ribonucleoprotein,
  366::439     1e-07  34%  653 aa  PABP_SCHPO RecName: Full=Polyadenylate-binding protein, cytoplasmic
    1::65      1e-07  35%  142 aa  GRP1_SORBI RecName: Full=Glycine-rich RNA-binding protein 1;Flags:
  368::438     1e-07  37%  500 aa  GAR2_SCHPO RecName: Full=Protein gar2;
  296::368     1e-07  36%  629 aa  EPABA_XENLA RecName: Full=Embryonic polyadenylate-binding protein
    7::76      2e-07  31%  217 aa  ZCRB1_BOVIN RecName: Full=Zinc finger CCHC-type and RNA-binding
    4::67      2e-07  41%  314 aa  TSAP1_DANRE RecName: Full=tRNA selenocysteine 1-associated protein
   22::92      2e-07  37%  476 aa  RBM45_RAT RecName: Full=RNA-binding protein 45;AltName:
  337::410     2e-07  38%  627 aa  PABP_DEBHA RecName: Full=Polyadenylate-binding protein, cytoplasmic
   22::92      2e-07  37%  476 aa  RBM45_HUMAN RecName: Full=RNA-binding protein 45;AltName:
  300::373     2e-07  36%  565 aa  PAP1A_DICDI RecName: Full=Polyadenylate-binding protein 1-A;       
  102::177     3e-07  32%  424 aa  SF3B4_RAT RecName: Full=Splicing factor 3B subunit 4;
  102::177     3e-07  32%  424 aa  SF3B4_MOUSE RecName: Full=Splicing factor 3B subunit 4;
  102::177     3e-07  32%  424 aa  SF3B4_HUMAN RecName: Full=Splicing factor 3B subunit 4;AltName:
   26::80      3e-07  39%  365 aa  ROA1_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
    7::77      3e-07  28%  153 aa  RBM3_MOUSE RecName: Full=Putative RNA-binding protein 3;AltName:
  225::298     3e-07  35%  732 aa  PABP_EMENI RecName: Full=Polyadenylate-binding protein, cytoplasmic
  160::228     3e-07  33%  534 aa  HRP1_YEAST RecName: Full=Nuclear polyadenylated RNA-binding protein
   32::95      4e-07  38%  212 aa  RT19_ARATH RecName: Full=40S ribosomal protein S19,
  218::293     4e-07  32%  324 aa  ROC5_NICSY RecName: Full=33 kDa ribonucleoprotein,
   15::67      4e-07  38%  320 aa  ROA1_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein
   15::67      4e-07  38%  320 aa  ROA1_PANTR RecName: Full=Heterogeneous nuclear ribonucleoprotein
   15::67      4e-07  38%  320 aa  ROA1_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   15::67      4e-07  38%  372 aa  ROA1_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   15::67      4e-07  38%  320 aa  ROA1_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    7::77      4e-07  28%  157 aa  RBM3_HUMAN RecName: Full=Putative RNA-binding protein 3;AltName:
   28::79      4e-07  42%  237 aa  RBM38_MOUSE RecName: Full=RNA-binding protein 38;AltName:
   15::67      4e-07  38%  320 aa  RA1L3_HUMAN RecName: Full=Putative heterogeneous nuclear
   15::67      4e-07  38%  320 aa  RA1L2_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  237::319     4e-07  34%  461 aa  PPIL4_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   21::104     4e-07  32%  362 aa  MSI1H_RAT RecName: Full=RNA-binding protein Musashi homolog 1;     
   21::104     4e-07  32%  362 aa  MSI1H_MOUSE RecName: Full=RNA-binding protein Musashi homolog 1;   
   21::104     4e-07  32%  362 aa  MSI1H_HUMAN RecName: Full=RNA-binding protein Musashi homolog 1;   
  179::264     4e-07  36%  632 aa  CSX1_SCHPO RecName: Full=RNA-binding post-transcriptional regulator
   34::94      4e-07  36%  281 aa  BOLL_MOUSE RecName: Full=Protein boule-like;
   34::94      4e-07  38%  283 aa  BOLL_MACFA RecName: Full=Protein boule-like;
   34::94      4e-07  38%  283 aa  BOLL_HUMAN RecName: Full=Protein boule-like;
  103::154     5e-07  38%  297 aa  YDC1_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  173::224     5e-07  40%  307 aa  SXL_CHRRU RecName: Full=Sex-lethal homolog;
   81::173     5e-07  30%  261 aa  RU17_SCHPO RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa
  230::301     5e-07  28%  315 aa  ROC4_NICSY RecName: Full=31 kDa ribonucleoprotein,
    9::83      5e-07  31%  496 aa  RBY1F_HUMAN RecName: Full=RNA-binding motif protein, Y chromosome,
  237::319     5e-07  34%  459 aa  PPIL4_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  324::392     5e-07  36%  577 aa  PABP_YEAST RecName: Full=Polyadenylate-binding protein, cytoplasmic
  235::308     5e-07  35%  753 aa  PABP_ASPFU RecName: Full=Polyadenylate-binding protein, cytoplasmic
  324::392     5e-07  33%  585 aa  PABP_ASHGO RecName: Full=Polyadenylate-binding protein, cytoplasmic
  311::371     5e-07  36%  841 aa  MRD1_CANAL RecName: Full=Multiple RNA-binding domain-containing
  402::489     5e-07  35%  490 aa  CELF1_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 1;       
  399::486     5e-07  35%  487 aa  CELF1_RAT RecName: Full=CUG-BP- and ETR-3-like factor 1;       
  425::512     5e-07  35%  513 aa  CELF1_PONAB RecName: Full=CUG-BP- and ETR-3-like factor 1;       
  398::485     5e-07  35%  486 aa  CELF1_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 1;       
  398::485     5e-07  35%  486 aa  CELF1_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 1;       
  401::488     5e-07  35%  489 aa  CELF1_CHICK RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   38::102     5e-07  31%  352 aa  C3H42_ARATH RecName: Full=Zinc finger CCCH domain-containing
   34::85      5e-07  40%  228 aa  BOULE_DROME RecName: Full=Protein boule;
   15::66      7e-07  38%  320 aa  ROA1_MACMU RecName: Full=Heterogeneous nuclear ribonucleoprotein
   39::146     7e-07  32%  512 aa  PSPC1_DANRE RecName: Full=Paraspeckle component 1;
  237::319     7e-07  34%  461 aa  PPIL4_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  315::398     7e-07  35%  858 aa  MRD1_USTMA RecName: Full=Multiple RNA-binding domain-containing
  413::500     7e-07  35%  501 aa  CELF1_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   38::99      7e-07  32%  312 aa  C3H25_ORYSJ RecName: Full=Zinc finger CCCH domain-containing
  164::213     9e-07  40%  474 aa  YHKF_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   12::66      9e-07  37%  342 aa  ROA1_SCHAM RecName: Full=Heterogeneous nuclear ribonucleoprotein
    3::64      9e-07  34%   99 aa  RBPE_ANASP RecName: Full=Putative RNA-binding protein rbpE;
   38::99      9e-07  32%  322 aa  RBMX2_HUMAN RecName: Full=RNA-binding motif protein, X-linked 2;
  332::400     9e-07  33%  629 aa  PABP_YARLI RecName: Full=Polyadenylate-binding protein, cytoplasmic
  243::316     9e-07  32%  764 aa  PABP_NEUCR RecName: Full=Polyadenylate-binding protein, cytoplasmic
  248::321     9e-07  32%  783 aa  PABP_CHAGB RecName: Full=Polyadenylate-binding protein, cytoplasmic
   11::60      9e-07  40%  360 aa  DAZP1_XENLA RecName: Full=DAZ-associated protein 1;AltName:
   11::60      9e-07  40%  406 aa  DAZP1_MOUSE RecName: Full=DAZ-associated protein 1;AltName:
   11::60      9e-07  40%  407 aa  DAZP1_HUMAN RecName: Full=DAZ-associated protein 1;AltName:
  364::451     9e-07  35%  452 aa  CELF3_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 3;       
  374::461     9e-07  35%  462 aa  CEL3B_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 3-B;       
  401::488     9e-07  33%  489 aa  CEL1B_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 1-B;       
  190::241     1e-06  38%  324 aa  SXL_MUSDO RecName: Full=Sex-lethal homolog;
   88::158     1e-06  34%  291 aa  ROC2_NICSY RecName: Full=29 kDa ribonucleoprotein B,
   38::99      1e-06  32%  326 aa  RBMX2_MOUSE RecName: Full=RNA-binding motif protein, X-linked 2;
   22::92      1e-06  34%  476 aa  RBM45_MOUSE RecName: Full=RNA-binding protein 45;AltName:
  338::411     1e-06  35%  632 aa  PABP_PICST RecName: Full=Polyadenylate-binding protein, cytoplasmic
  426::513     1e-06  34%  514 aa  CELF2_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  374::461     1e-06  35%  462 aa  CEL3A_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 3-A;       
  401::488     1e-06  34%  489 aa  CEL1A_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 1-A;       
   88::175     2e-06  30%  448 aa  RU17_DROME RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
  209::271     2e-06  33%  292 aa  ROC2_NICPL RecName: Full=31 kDa ribonucleoprotein,
  101::178     2e-06  29%  358 aa  RO22_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A2
   93::139     2e-06  45%  611 aa  PES4_YEAST RecName: Full=Protein PES4;AltName: Full=DNA polymerase
  344::417     2e-06  35%  631 aa  PABP_PICGU RecName: Full=Polyadenylate-binding protein, cytoplasmic
   50::118     2e-06  35%  744 aa  PABP_PHANO RecName: Full=Polyadenylate-binding protein, cytoplasmic
  324::387     2e-06  31%  833 aa  MRD1_SCHPO RecName: Full=Multiple RNA-binding domain-containing
   47::110     2e-06  34%  296 aa  MK67I_BOVIN RecName: Full=MKI67 FHA domain-interacting nucleolar
  425::512     2e-06  34%  513 aa  CELF2_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  448::535     2e-06  34%  536 aa  CELF2_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  420::507     2e-06  34%  508 aa  CELF2_RAT RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  420::507     2e-06  34%  508 aa  CELF2_PONAB RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  420::507     2e-06  34%  508 aa  CELF2_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  420::507     2e-06  34%  508 aa  CELF2_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  396::483     2e-06  34%  484 aa  CELF2_CHICK RecName: Full=CUG-BP- and ETR-3-like factor 2;       
    9::84      2e-06  26%  380 aa  RBY1B_MOUSE RecName: Full=RNA-binding motif protein, Y chromosome,
  367::466     2e-06  29%  960 aa  RBM19_HUMAN RecName: Full=Probable RNA-binding protein 19;AltName:
   25::73      2e-06  37%  385 aa  RB87F_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
  299::354     2e-06  36%  462 aa  NOP12_KLULA RecName: Full=Nucleolar protein 12;
  302::366     2e-06  31%  825 aa  MRD1_ASPFU RecName: Full=Multiple RNA-binding domain-containing
   35::102     2e-06  31%  367 aa  ELAV3_MOUSE RecName: Full=ELAV-like protein 3;AltName:
   35::102     2e-06  31%  367 aa  ELAV3_HUMAN RecName: Full=ELAV-like protein 3;AltName:
    9::78      2e-06  27%  363 aa  CTF1_SCHPO RecName: Full=Cleavage and termination factor 1;AltName:
  377::464     2e-06  35%  465 aa  CELF3_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 3;       
  377::464     2e-06  35%  465 aa  CELF3_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 3;       
  373::460     2e-06  35%  461 aa  CELF3_BOVIN RecName: Full=CUG-BP- and ETR-3-like factor 3;       
   15::62      3e-06  38%  365 aa  ROA1_XENLA RecName: Full=Heterogeneous nuclear ribonucleoproteins
    3::55      3e-06  38%  103 aa  RBPB_ANASP RecName: Full=Putative RNA-binding protein rbpB;
    4::73      3e-06  34%  200 aa  PAP1M_HUMAN RecName: Full=Polyadenylate-binding protein 1-like
   49::117     3e-06  35%  651 aa  PABP_USTMA RecName: Full=Polyadenylate-binding protein, cytoplasmic
  230::309     3e-06  29%  396 aa  NOP12_CANGA RecName: Full=Nucleolar protein 12;
   16::91      3e-06  33%  326 aa  ELAV1_HUMAN RecName: Full=ELAV-like protein 1;AltName:
  215::291     3e-06  33%  354 aa  SXL_DROSU RecName: Full=Protein sex-lethal;
  213::289     3e-06  33%  354 aa  SXL_DROME RecName: Full=Protein sex-lethal;
   83::176     3e-06  28%  471 aa  RU17_XENTR RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
   25::85      3e-06  33%  196 aa  RSP4_CAEEL RecName: Full=Probable splicing factor,
    1::58      3e-06  37%  346 aa  RO21_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A2
    9::84      3e-06  26%  380 aa  RBY1A_MOUSE RecName: Full=RNA-binding motif protein, Y chromosome,
    5::121     3e-06  29%  754 aa  PABP_ASPCL RecName: Full=Polyadenylate-binding protein, cytoplasmic
  281::329     3e-06  39%  459 aa  NOP12_YEAST RecName: Full=Nucleolar protein 12;
  306::394     3e-06  38%  623 aa  HNRPQ_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  278::343     3e-06  32%  359 aa  ELAV2_RAT RecName: Full=ELAV-like protein 2;AltName:
  278::343     3e-06  32%  359 aa  ELAV2_PONAB RecName: Full=ELAV-like protein 2;
  279::344     3e-06  32%  360 aa  ELAV2_MOUSE RecName: Full=ELAV-like protein 2;AltName:
  278::343     3e-06  32%  359 aa  ELAV2_HUMAN RecName: Full=ELAV-like protein 2;AltName:
  372::459     3e-06  35%  460 aa  CELF6_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 6;       
  393::480     3e-06  35%  481 aa  CELF6_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 6;       
    1::58      4e-06  37%  341 aa  ROA2_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoproteins
   96::146     4e-06  33%  421 aa  RB27C_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
  338::411     4e-06  32%  629 aa  PABP_CANAL RecName: Full=Polyadenylate-binding protein, cytoplasmic
  232::305     4e-06  32%  765 aa  PABP_ASPOR RecName: Full=Polyadenylate-binding protein, cytoplasmic
  203::276     4e-06  31%  609 aa  PABPX_ARATH RecName: Full=Probable polyadenylate-binding protein
  228::310     4e-06  29%  403 aa  NOP13_YEAST RecName: Full=Nucleolar protein 13;
  219::282     4e-06  35%  290 aa  EIF3G_NEOFI RecName: Full=Eukaryotic translation initiation factor
  213::279     4e-06  31%  287 aa  EIF3G_ASPOR RecName: Full=Eukaryotic translation initiation factor
  214::280     4e-06  31%  288 aa  EIF3G_ASPNC RecName: Full=Eukaryotic translation initiation factor
  219::282     4e-06  35%  290 aa  EIF3G_ASPFU RecName: Full=Eukaryotic translation initiation factor
  219::282     4e-06  35%  290 aa  EIF3G_ASPFC RecName: Full=Eukaryotic translation initiation factor
  198::249     6e-06  38%  348 aa  SXL_CERCA RecName: Full=Sex-lethal homolog;AltName: Full=CCSXL;
   89::176     6e-06  29%  448 aa  RU17_MOUSE RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
   89::176     6e-06  29%  437 aa  RU17_HUMAN RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
   89::176     6e-06  29%  439 aa  RU17_BOVIN RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
  108::156     6e-06  37%  305 aa  ROA0_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    3::47      6e-06  38%  102 aa  RBPA_ANASP RecName: Full=Putative RNA-binding protein rbpA;
  353::426     6e-06  31%  661 aa  PABP_LODEL RecName: Full=Polyadenylate-binding protein, cytoplasmic
  306::362     6e-06  37%  634 aa  PABP_DROME RecName: Full=Polyadenylate-binding protein;       
  261::309     6e-06  37%  426 aa  NOP12_ASHGO RecName: Full=Nucleolar protein 12;
  296::359     6e-06  33%  819 aa  MRD1_EMENI RecName: Full=Multiple RNA-binding domain-containing
  326::386     6e-06  36%  861 aa  MRD1_CANGA RecName: Full=Multiple RNA-binding domain-containing
   33::81      6e-06  35%  217 aa  IST3_SCHPO RecName: Full=U2 snRNP component ist3;AltName:
  246::311     6e-06  32%  326 aa  ELAV1_MOUSE RecName: Full=ELAV-like protein 1;AltName:
  146::260     6e-06  28%  271 aa  EIF3G_PICST RecName: Full=Eukaryotic translation initiation factor
  215::281     6e-06  31%  289 aa  EIF3G_EMENI RecName: Full=Eukaryotic translation initiation factor
  219::282     6e-06  33%  290 aa  EIF3G_ASPCL RecName: Full=Eukaryotic translation initiation factor
  242::313     8e-06  33%  604 aa  RSD1_SCHPO RecName: Full=RNA-binding protein rsd1;
  230::285     8e-06  38%  369 aa  RNP24_SCHPO RecName: Full=RNA-binding protein rnp24;
   57::125     8e-06  33%  768 aa  PABP_COCIM RecName: Full=Polyadenylate-binding protein, cytoplasmic
  321::389     8e-06  33%  579 aa  PABP_CANGA RecName: Full=Polyadenylate-binding protein, cytoplasmic
  290::344     8e-06  40%  685 aa  NOP4_YEAST RecName: Full=Nucleolar protein 4;AltName:
  272::320     8e-06  35%  438 aa  NOP12_SCHPO RecName: Full=Nucleolar protein 12;
  302::362     8e-06  34%  838 aa  MRD1_ASHGO RecName: Full=Multiple RNA-binding domain-containing
  216::304     8e-06  37%  533 aa  HNRPQ_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein Q; 
  306::394     8e-06  37%  623 aa  HNRPQ_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
  121::199     8e-06  30%  747 aa  FCA_ARATH RecName: Full=Flowering time control protein FCA;
  316::389     1e-05  32%  468 aa  YKX5_SCHPO RecName: Full=Uncharacterized RNA-binding protein
    1::58      1e-05  35%  341 aa  ROA2_SAGOE RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::70      1e-05  38%  353 aa  ROA2_RAT RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::70      1e-05  38%  353 aa  ROA2_PONAB RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::70      1e-05  38%  353 aa  ROA2_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::70      1e-05  38%  353 aa  ROA2_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoproteins
   20::86      1e-05  30%  296 aa  RNA15_YEAST RecName: Full=mRNA 3'-end-processing protein RNA15;
    2::65      1e-05  34%  750 aa  RBM28_MOUSE RecName: Full=RNA-binding protein 28;AltName:
   45::118     1e-05  32%  753 aa  PABP_ASPTN RecName: Full=Polyadenylate-binding protein, cytoplasmic
  276::324     1e-05  39%  509 aa  NOP12_YARLI RecName: Full=Nucleolar protein 12;
  331::391     1e-05  33%  878 aa  MRD1_KLULA RecName: Full=Multiple RNA-binding domain-containing
  292::357     1e-05  30%  373 aa  ELAV4_RAT RecName: Full=ELAV-like protein 4;AltName:
  304::369     1e-05  30%  385 aa  ELAV4_MOUSE RecName: Full=ELAV-like protein 4;AltName:
  299::364     1e-05  30%  380 aa  ELAV4_HUMAN RecName: Full=ELAV-like protein 4;AltName:
  212::278     1e-05  31%  286 aa  EIF3G_ASPTN RecName: Full=Eukaryotic translation initiation factor
  432::519     1e-05  34%  520 aa  CELF4_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 4;       
  239::335     1e-05  34%  440 aa  SYY_BIFLO RecName: Full=Tyrosyl-tRNA synthetase;       
  239::335     1e-05  34%  440 aa  SYY_BIFLI RecName: Full=Tyrosyl-tRNA synthetase;       
  239::335     1e-05  34%  440 aa  SYY_BIFLD RecName: Full=Tyrosyl-tRNA synthetase;       
   57::108     1e-05  35%  344 aa  SQD_DROME RecName: Full=RNA-binding protein squid;AltName:
  233::295     1e-05  35%  582 aa  SHEP_DROYA RecName: Full=Protein alan shepard;
  233::295     1e-05  35%  579 aa  SHEP_DROSE RecName: Full=Protein alan shepard;
  233::295     1e-05  35%  578 aa  SHEP_DROME RecName: Full=Protein alan shepard;
  233::295     1e-05  35%  582 aa  SHEP_DROER RecName: Full=Protein alan shepard;
  289::366     1e-05  28%  430 aa  RBM34_HUMAN RecName: Full=RNA-binding protein 34;AltName:
  372::444     1e-05  34%  977 aa  RBM15_HUMAN RecName: Full=Putative RNA-binding protein 15;AltName:
  120::183     1e-05  36%  269 aa  PAB1L_HUMAN RecName: Full=Putative protein PABPC1-like;AltName:
  362::425     1e-05  31%  895 aa  MRD1_DICDI RecName: Full=Multiple RNA-binding domain-containing
  309::397     1e-05  40%  633 aa  HNRPR_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  398::468     1e-05  32%  486 aa  CELF5_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 5;       
  260::335     2e-05  26%  475 aa  U2AF2_MOUSE RecName: Full=Splicing factor U2AF 65 kDa
  260::335     2e-05  26%  475 aa  U2AF2_HUMAN RecName: Full=Splicing factor U2AF 65 kDa
  393::474     2e-05  27%  591 aa  U2A2A_WHEAT RecName: Full=Splicing factor U2af large subunit
  166::217     2e-05  33%  321 aa  SXL_MEGSC RecName: Full=Sex-lethal homolog;
   56::110     2e-05  39%  403 aa  RBMS1_RAT RecName: Full=RNA-binding motif,
   56::110     2e-05  39%  403 aa  RBMS1_MOUSE RecName: Full=RNA-binding motif,
   56::110     2e-05  39%  406 aa  RBMS1_HUMAN RecName: Full=RNA-binding motif,
   56::110     2e-05  39%  403 aa  RBMS1_BOVIN RecName: Full=RNA-binding motif,
  366::464     2e-05  33%  952 aa  RBM19_MOUSE RecName: Full=Probable RNA-binding protein 19;AltName:
  335::403     2e-05  33%  887 aa  RB15B_MOUSE RecName: Full=Putative RNA-binding protein 15B;AltName:
  339::407     2e-05  33%  890 aa  RB15B_HUMAN RecName: Full=Putative RNA-binding protein 15B;AltName:
  220::263     2e-05  36%  294 aa  EIF3G_YARLI RecName: Full=Eukaryotic translation initiation factor
  208::265     2e-05  31%  281 aa  EIF3G_PHANO RecName: Full=Eukaryotic translation initiation factor
  178::275     2e-05  34%  293 aa  EIF3G_DANRE RecName: Full=Eukaryotic translation initiation factor
   35::116     2e-05  32%  286 aa  DAZLB_XENLA RecName: Full=Deleted in azoospermia-like-B;       
   35::116     2e-05  32%  286 aa  DAZLA_XENLA RecName: Full=Deleted in azoospermia-like-A;       
  197::268     2e-05  26%  781 aa  YG5B_YEAST RecName: Full=Uncharacterized RNA-binding protein
  120::175     2e-05  36%  326 aa  TRA2_DICDI RecName: Full=Transformer-2 protein homolog;
   58::104     2e-05  40%  407 aa  RBMS2_BOVIN RecName: Full=RNA-binding motif,
  131::205     2e-05  25%  637 aa  PUF68_DROME RecName: Full=Poly(U)-binding-splicing factor half
   42::177     2e-05  24%  374 aa  FOX1C_MOUSE RecName: Full=Fox-1 homolog C;
  214::280     2e-05  31%  288 aa  EIF3G_COCIM RecName: Full=Eukaryotic translation initiation factor
  269::349     3e-05  26% 1028 aa  SR140_PONAB RecName: Full=U2-associated protein SR140;AltName:
  270::350     3e-05  26% 1029 aa  SR140_HUMAN RecName: Full=U2-associated protein SR140;AltName:
  239::301     3e-05  33%  581 aa  SHEP_DROWI RecName: Full=Protein alan shepard;
  101::175     3e-05  32%  335 aa  SAP49_SCHPO RecName: Full=Spliceosome-associated protein 49;
    2::65      3e-05  33%  759 aa  RBM28_HUMAN RecName: Full=RNA-binding protein 28;AltName:
  231::308     3e-05  32%  446 aa  PPIL4_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  472::540     3e-05  26%  814 aa  PAP1B_DICDI RecName: Full=Polyadenylate-binding protein 1-B;       
  235::292     3e-05  33%  310 aa  EIF3G_XENTR RecName: Full=Eukaryotic translation initiation factor
  245::302     3e-05  33%  320 aa  EIF3G_RAT RecName: Full=Eukaryotic translation initiation factor 3
  245::302     3e-05  33%  320 aa  EIF3G_MOUSE RecName: Full=Eukaryotic translation initiation factor
  245::302     3e-05  33%  320 aa  EIF3G_HUMAN RecName: Full=Eukaryotic translation initiation factor
  245::302     3e-05  33%  320 aa  EIF3G_BOVIN RecName: Full=Eukaryotic translation initiation factor
  233::290     3e-05  33%  308 aa  EI3GB_XENLA RecName: Full=Eukaryotic translation initiation factor
  233::290     3e-05  33%  308 aa  EI3GA_XENLA RecName: Full=Eukaryotic translation initiation factor
  397::467     3e-05  32%  485 aa  CELF5_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 5;       
  270::350     4e-05  26% 1029 aa  SR140_MOUSE RecName: Full=U2-associated protein SR140;AltName:
  245::307     4e-05  33%  595 aa  SHEP_DROVI RecName: Full=Protein alan shepard;
  231::293     4e-05  33%  592 aa  SHEP_DROMO RecName: Full=Protein alan shepard;
  259::321     4e-05  33%  609 aa  SHEP_DROGR RecName: Full=Protein alan shepard;
   47::110     4e-05  31%  293 aa  MK67I_HUMAN RecName: Full=MKI67 FHA domain-interacting nucleolar
   33::98      4e-05  29%  148 aa  IST3_YEAST RecName: Full=U2 snRNP component IST3;AltName: Full=U2
   42::92      4e-05  39%  298 aa  DAZL_MOUSE RecName: Full=Deleted in azoospermia-like;AltName:
   42::92      4e-05  39%  295 aa  DAZL_MACFA RecName: Full=Deleted in azoospermia-like;AltName:
   42::92      4e-05  39%  295 aa  DAZL_HUMAN RecName: Full=Deleted in azoospermia-like;AltName:
   38::88      4e-05  39%  289 aa  DAZL_CHICK RecName: Full=Deleted in azoospermia-like;       
   53::124     5e-05  26%  245 aa  U1SBP_BOVIN RecName: Full=U11/U12 small nuclear ribonucleoprotein
  102::177     5e-05  29%  388 aa  SF3B4_CAEEL RecName: Full=Splicing factor 3B subunit 4;AltName:
    3::55      5e-05  35%  105 aa  RBPF_ANASP RecName: Full=Putative RNA-binding protein rbpF;
   60::106     5e-05  40%  383 aa  RBMS2_MOUSE RecName: Full=RNA-binding motif,
   58::104     5e-05  40%  407 aa  RBMS2_HUMAN RecName: Full=RNA-binding motif,
  237::286     5e-05  40%  815 aa  RBM5_RAT RecName: Full=RNA-binding protein 5;AltName:
  237::286     5e-05  40%  815 aa  RBM5_MOUSE RecName: Full=RNA-binding protein 5;AltName:
  237::286     5e-05  40%  815 aa  RBM5_HUMAN RecName: Full=RNA-binding protein 5;AltName:
  237::286     5e-05  40%  815 aa  RBM5_BOVIN RecName: Full=RNA-binding protein 5;AltName:
   33::108     5e-05  30%  471 aa  RB97D_DROME RecName: Full=Ribonucleoprotein RB97D;
    8::67      5e-05  37%  301 aa  PPIE_PONAB RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    8::67      5e-05  37%  301 aa  PPIE_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    8::67      5e-05  37%  301 aa  PPIE_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    8::67      5e-05  37%  301 aa  PPIE_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
  365::429     5e-05  35%  559 aa  NOP12_GIBZE RecName: Full=Nucleolar protein 12;
   47::112     5e-05  35%  269 aa  MK67I_DANRE RecName: Full=MKI67 FHA domain-interacting nucleolar
  229::286     5e-05  29%  303 aa  EIF3G_MAGGR RecName: Full=Eukaryotic translation initiation factor
  182::237     5e-05  38%  256 aa  EIF3G_CAEEL RecName: Full=Eukaryotic translation initiation factor
  239::335     6e-05  33%  435 aa  SYY_BIFAA RecName: Full=Tyrosyl-tRNA synthetase;       
   66::143     6e-05  24%  250 aa  SGN1_YEAST RecName: Full=RNA-binding protein SGN1;
  134::209     6e-05  28%  283 aa  RNPS1_DANRE RecName: Full=RNA-binding protein with serine-rich
    3::47      6e-05  33%  101 aa  RBPA_SYNY3 RecName: Full=Putative RNA-binding protein rbpA;
   80::149     6e-05  31%  520 aa  PSPC1_BOVIN RecName: Full=Paraspeckle component 1;
   49::112     6e-05  28%  317 aa  MK67I_MOUSE RecName: Full=MKI67 FHA domain-interacting nucleolar
  163::234     6e-05  29%  454 aa  HRB1_YEAST RecName: Full=Protein HRB1;AltName: Full=Protein TOM34;
   42::177     6e-05  24%  350 aa  FOX1C_HUMAN RecName: Full=Fox-1 homolog C;
   42::92      6e-05  39%  296 aa  DAZL_CALJA RecName: Full=Deleted in azoospermia-like;AltName:
  157::257     6e-05  29%  579 aa  DAZ4_HUMAN RecName: Full=Deleted in azoospermia protein 4;
  157::257     6e-05  29%  744 aa  DAZ1_HUMAN RecName: Full=Deleted in azoospermia protein 1;
   53::124     8e-05  25%  244 aa  U1SBP_RAT RecName: Full=U11/U12 small nuclear ribonucleoprotein 35
   53::124     8e-05  26%  246 aa  U1SBP_HUMAN RecName: Full=U11/U12 small nuclear ribonucleoprotein
   83::179     8e-05  28%  471 aa  RU17_XENLA RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
   62::108     8e-05  38%  436 aa  RBMS3_PONAB RecName: Full=RNA-binding motif,
   58::104     8e-05  38%  431 aa  RBMS3_MOUSE RecName: Full=RNA-binding motif,
   63::109     8e-05  38%  437 aa  RBMS3_HUMAN RecName: Full=RNA-binding motif,
  223::292     8e-05  26%  564 aa  PUF60_RAT RecName: Full=Poly(U)-binding-splicing factor
  217::286     8e-05  26%  558 aa  PUF60_PONAB RecName: Full=Poly(U)-binding-splicing factor
  223::292     8e-05  26%  564 aa  PUF60_MOUSE RecName: Full=Poly(U)-binding-splicing factor
  218::287     8e-05  26%  559 aa  PUF60_HUMAN RecName: Full=Poly(U)-binding-splicing factor
  189::258     8e-05  26%  530 aa  PUF60_BOVIN RecName: Full=Poly(U)-binding-splicing factor
   45::119     8e-05  35%  476 aa  NONO_RAT RecName: Full=Non-POU domain-containing octamer-binding
   42::116     8e-05  35%  473 aa  NONO_MOUSE RecName: Full=Non-POU domain-containing octamer-binding
  346::406     8e-05  31%  887 aa  MRD1_YEAST RecName: Full=Multiple RNA-binding domain-containing
   87::160     8e-05  27%  352 aa  LARK_DROME RecName: Full=RNA-binding protein lark;
   95::162     8e-05  29%  353 aa  HNRPD_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein D0;
   97::164     8e-05  29%  355 aa  HNRPD_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   97::164     8e-05  29%  355 aa  HNRPD_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  308::402     8e-05  33%  465 aa  G3BP1_BOVIN RecName: Full=Ras GTPase-activating protein-binding
  208::268     8e-05  34%  279 aa  EIF3G_LODEL RecName: Full=Eukaryotic translation initiation factor
  209::269     8e-05  34%  279 aa  EIF3G_CANAL RecName: Full=Eukaryotic translation initiation factor
   42::92      8e-05  37%  486 aa  DAZ3_HUMAN RecName: Full=Deleted in azoospermia protein 3;
   42::92      8e-05  37%  558 aa  DAZ2_HUMAN RecName: Full=Deleted in azoospermia protein 2;
  165::243     1e-04  28%  309 aa  RNPS1_XENTR RecName: Full=RNA-binding protein with serine-rich
  139::217     1e-04  28%  283 aa  RNP1B_XENLA RecName: Full=RNA-binding protein with serine-rich
  139::217     1e-04  28%  283 aa  RNP1A_XENLA RecName: Full=RNA-binding protein with serine-rich
  125::199     1e-04  25%  606 aa  RAVR1_HUMAN RecName: Full=Ribonucleoprotein PTB-binding 1;AltName:
  242::319     1e-04  31%  494 aa  PPIL4_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  104::165     1e-04  29%  220 aa  NOP15_YEAST RecName: Full=Ribosome biogenesis protein 15;AltName:
  417::497     1e-04  33%  609 aa  MUG28_SCHPO RecName: Full=Meiotically up-regulated gene 28 protein;
  307::417     1e-04  31%  555 aa  U2A2A_NICPL RecName: Full=Splicing factor U2af large subunit
   20::64      1e-04  38%  221 aa  SFRS2_RAT RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_PIG RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_PANTR RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_MOUSE RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_CHICK RecName: Full=Splicing factor, arginine/serine-rich
   20::64      1e-04  38%  221 aa  SFRS2_BOVIN RecName: Full=Splicing factor, arginine/serine-rich
   20::77      1e-04  34%  282 aa  SFR2B_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
   85::155     1e-04  25%  260 aa  RRP2_SPIOL RecName: Full=30S ribosomal protein 2,
  251::324     1e-04  32%  551 aa  PPIL4_USTMA RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  267::317     1e-04  39%  454 aa  NOP12_CANAL RecName: Full=Nucleolar protein 12;
  114::183     1e-04  29%  535 aa  HRP65_CHITE RecName: Full=Hrp65 protein;AltName: Full=Ct-Hrp65;
  309::403     1e-04  33%  466 aa  G3BP1_PONAB RecName: Full=Ras GTPase-activating protein-binding
  309::403     1e-04  33%  466 aa  G3BP1_HUMAN RecName: Full=Ras GTPase-activating protein-binding
  222::286     1e-04  32%  290 aa  EIF3G_CRYNE RecName: Full=Eukaryotic translation initiation factor
  229::295     1e-04  27%  303 aa  EIF3G_CHAGB RecName: Full=Eukaryotic translation initiation factor
  207::253     1e-04  34%  269 aa  EIF3G_ASHGO RecName: Full=Eukaryotic translation initiation factor
   32::82      1e-04  41%  286 aa  DAZL_XENTR RecName: Full=Deleted in azoospermia-like;       
  644::725     2e-04  30% 5560 aa  SPEN_DROME RecName: Full=Protein split ends;
  164::241     2e-04  26%  432 aa  RBM9_RAT RecName: Full=RNA-binding protein 9;AltName:
  181::258     2e-04  26%  449 aa  RBM9_MOUSE RecName: Full=RNA-binding protein 9;AltName:
  122::199     2e-04  26%  390 aa  RBM9_HUMAN RecName: Full=RNA-binding protein 9;AltName:
  130::207     2e-04  26%  394 aa  RBM9_BOVIN RecName: Full=RNA-binding protein 9;AltName:
  175::244     2e-04  23%  516 aa  PU60B_DANRE RecName: Full=Poly(U)-binding-splicing factor PUF60-B;
   82::151     2e-04  30%  522 aa  PSPC1_RAT RecName: Full=Paraspeckle component 1;
   82::151     2e-04  30%  523 aa  PSPC1_MOUSE RecName: Full=Paraspeckle component 1;AltName:
   83::152     2e-04  30%  523 aa  PSPC1_HUMAN RecName: Full=Paraspeckle component 1;AltName:
   82::151     2e-04  30%  523 aa  PSPC1_CHICK RecName: Full=Paraspeckle component 1;
  246::310     2e-04  34%  432 aa  PPIL4_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp6;
  242::306     2e-04  34%  492 aa  PPIL4_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  242::306     2e-04  34%  492 aa  PPIL4_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   36::105     2e-04  27%  257 aa  NCBP2_ARATH RecName: Full=Nuclear cap-binding protein subunit
  118::195     2e-04  26%  382 aa  FOX1A_PONAB RecName: Full=Fox-1 homolog A;AltName:
  117::194     2e-04  26%  396 aa  FOX1A_MOUSE RecName: Full=Fox-1 homolog A;AltName:
  120::197     2e-04  26%  376 aa  FOX1A_MACFA RecName: Full=Fox-1 homolog A;AltName:
  118::195     2e-04  26%  397 aa  FOX1A_HUMAN RecName: Full=Fox-1 homolog A;AltName:
  223::289     2e-04  28%  297 aa  EIF3G_NEUCR RecName: Full=Eukaryotic translation initiation factor
  218::275     2e-04  31%  294 aa  EIF3G_NEMVE RecName: Full=Eukaryotic translation initiation factor
  208::283     2e-04  22%  416 aa  U2AF2_DROME RecName: Full=Splicing factor U2AF 50 kDa
   53::124     2e-04  25%  244 aa  U1SBP_MOUSE RecName: Full=U11/U12 small nuclear ribonucleoprotein
  505::549     2e-04  42%  651 aa  NUCL_XENLA RecName: Full=Nucleolin;AltName: Full=Protein C23;
  250::404     2e-04  31%  465 aa  G3BP1_MOUSE RecName: Full=Ras GTPase-activating protein-binding
    7::76      2e-04  27%  262 aa  FUSIP_MOUSE RecName: Full=FUS-interacting serine-arginine-rich
    7::76      2e-04  27%  262 aa  FUSIP_HUMAN RecName: Full=FUS-interacting serine-arginine-rich
  154::231     2e-04  29%  415 aa  FOX1_CAEEL RecName: Full=Sex determination protein fox-1;AltName:
  120::197     2e-04  26%  373 aa  FOX1A_DANRE RecName: Full=Fox-1 homolog A;AltName:
   49::99      2e-04  39%  229 aa  DAZL_DANRE RecName: Full=Deleted in azoospermia-like;       
  125::199     3e-04  25%  748 aa  RAVR1_RAT RecName: Full=Ribonucleoprotein PTB-binding 1;AltName:
  125::199     3e-04  25%  748 aa  RAVR1_MOUSE RecName: Full=Ribonucleoprotein PTB-binding 1;AltName:
  577::621     3e-04  38%  713 aa  NUCL_RAT RecName: Full=Nucleolin;AltName: Full=Protein C23;
  576::620     3e-04  38%  712 aa  NUCL_PONAB RecName: Full=Nucleolin;
  571::615     3e-04  38%  707 aa  NUCL_MOUSE RecName: Full=Nucleolin;AltName: Full=Protein C23;
  574::618     3e-04  38%  714 aa  NUCL_MESAU RecName: Full=Nucleolin;AltName: Full=Protein C23;
  575::619     3e-04  38%  711 aa  NUCL_MACFA RecName: Full=Nucleolin;
  574::618     3e-04  38%  710 aa  NUCL_HUMAN RecName: Full=Nucleolin;AltName: Full=Protein C23;
  555::599     3e-04  42%  694 aa  NUCL_CHICK RecName: Full=Nucleolin;AltName: Full=Protein C23;
  268::318     3e-04  39%  462 aa  NOP12_DEBHA RecName: Full=Nucleolar protein 12;
   43::93      3e-04  31%  276 aa  MK67I_XENTR RecName: Full=MKI67 FHA domain-interacting nucleolar
   57::134     4e-04  26%  191 aa  YQO4_CAEEL RecName: Full=Putative RNA-binding protein EEED8.4;
  325::435     4e-04  33%  573 aa  U2A2B_NICPL RecName: Full=Splicing factor U2af large subunit
  376::452     4e-04  25%  589 aa  U2A2B_ARATH RecName: Full=Splicing factor U2af large subunit
  325::435     4e-04  31%  573 aa  U2A2A_ARATH RecName: Full=Splicing factor U2af large subunit
  130::197     4e-04  24%  288 aa  TRA2B_RAT RecName: Full=Transformer-2 protein homolog beta;        
  130::197     4e-04  24%  288 aa  TRA2B_MOUSE RecName: Full=Transformer-2 protein homolog beta;      
  130::197     4e-04  24%  288 aa  TRA2B_HUMAN RecName: Full=Transformer-2 protein homolog beta;      
  130::197     4e-04  24%  288 aa  TRA2B_BOVIN RecName: Full=Transformer-2 protein homolog beta;      
  129::196     4e-04  26%  281 aa  TRA2A_MOUSE RecName: Full=Transformer-2 protein homolog alpha;     
  131::198     4e-04  26%  282 aa  TRA2A_HUMAN RecName: Full=Transformer-2 protein homolog alpha;     
  158::233     4e-04  25%  305 aa  RNPS1_RAT RecName: Full=RNA-binding protein with serine-rich domain
  158::233     4e-04  25%  305 aa  RNPS1_PONAB RecName: Full=RNA-binding protein with serine-rich
  158::233     4e-04  25%  305 aa  RNPS1_MOUSE RecName: Full=RNA-binding protein with serine-rich
  158::233     4e-04  25%  305 aa  RNPS1_MACFA RecName: Full=RNA-binding protein with serine-rich
  158::233     4e-04  25%  305 aa  RNPS1_HUMAN RecName: Full=RNA-binding protein with serine-rich
  158::233     4e-04  25%  305 aa  RNPS1_BOVIN RecName: Full=RNA-binding protein with serine-rich
   26::109     4e-04  28%  190 aa  RBM18_PONAB RecName: Full=Probable RNA-binding protein 18;AltName:
   26::109     4e-04  28%  190 aa  RBM18_MOUSE RecName: Full=Probable RNA-binding protein 18;AltName:
   26::109     4e-04  28%  190 aa  RBM18_HUMAN RecName: Full=Probable RNA-binding protein 18;AltName:
   46::109     4e-04  25%  271 aa  MK67I_RAT RecName: Full=MKI67 FHA domain-interacting nucleolar
  205::267     4e-04  30%  276 aa  EIF3G_DEBHA RecName: Full=Eukaryotic translation initiation factor
  111::156     5e-04  39%  414 aa  TADBP_CHICK RecName: Full=TAR DNA-binding protein 43;       
   76::125     5e-04  30%  285 aa  ROAA_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   70::119     5e-04  30%  332 aa  ROAA_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    6::69      5e-04  34%  144 aa  RBP1_DROME RecName: Full=RNA-binding protein 1;
   41::114     5e-04  34%  471 aa  NONO_PONAB RecName: Full=Non-POU domain-containing octamer-binding
   41::114     5e-04  34%  471 aa  NONO_HUMAN RecName: Full=Non-POU domain-containing octamer-binding
  302::365     5e-04  28%  828 aa  MRD1_YARLI RecName: Full=Multiple RNA-binding domain-containing
  120::171     5e-04  25%  291 aa  HNDLB_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein
  214::271     5e-04  26%  288 aa  EIF3G_SCLS1 RecName: Full=Eukaryotic translation initiation factor
  214::271     5e-04  26%  288 aa  EIF3G_BOTFB RecName: Full=Eukaryotic translation initiation factor
  112::157     7e-04  39%  409 aa  TADBP_XENTR RecName: Full=TAR DNA-binding protein 43;       
    3::70      7e-04  31%  344 aa  SFRS6_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
   42::144     7e-04  30%  388 aa  SCE3_SCHPO RecName: Full=Probable RNA-binding protein sce3;
    4::68      7e-04  29%  312 aa  RSP1_CAEEL RecName: Full=Probable splicing factor,
    3::64      7e-04  26%   94 aa  RBPD_ANASP RecName: Full=Putative RNA-binding protein rbpD;
   26::109     7e-04  30%  190 aa  RBM18_XENLA RecName: Full=Probable RNA-binding protein 18;AltName:
   26::109     7e-04  27%  190 aa  RBM18_BOVIN RecName: Full=Probable RNA-binding protein 18;AltName:
    8::67      7e-04  27%  300 aa  PPIE_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
   44::124     0.001  30%  348 aa  TCG1_SCHPO RecName: Full=Single-stranded TG1-3 DNA-binding
  275::329     0.001  36%  699 aa  SFPQ_MOUSE RecName: Full=Splicing factor, proline- and
  283::337     0.001  36%  707 aa  SFPQ_HUMAN RecName: Full=Splicing factor, proline- and
  107::188     0.001  24%  380 aa  RBM9_XENTR RecName: Full=RNA-binding protein 9;AltName:
    4::131     0.001  28%  590 aa  RBM47_MOUSE RecName: Full=RNA-binding protein 47;AltName:
  240::317     0.001  29%  605 aa  PPIL4_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  174::242     0.001  37%  280 aa  NELFE_DROME RecName: Full=Negative elongation factor E;
   43::93      0.001  27%  278 aa  MK67I_XENLA RecName: Full=MKI67 FHA domain-interacting nucleolar
   42::101     0.001  33%  322 aa  HNRDL_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein
  148::225     0.001  24%  382 aa  FOX1L_DANRE RecName: Full=Fox-1 homolog-like protein 1;AltName:
  127::256     0.001  26%  274 aa  EIF3G_YEAS7 RecName: Full=Eukaryotic translation initiation factor
   68::131     0.001  30%  499 aa  DAZ1_CAEEL RecName: Full=DAZ protein 1;
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSATGANTGPLGNIQRLQDGSTISTPPSVA
RBM42_XENLA     ----------------------------------------------------------------------
RBM42_RAT       ----------------------------------------------------------------------
RBM42_MOUSE     ----------------------------------------------------------------------
RBM42_HUMAN     ----------------------------------------------------------------------
RBM42_BOVIN     ----------------------------------------------------------------------
YDB2_SCHPO      ----------------------------------------------------------------------
RBM42_XENTR     ----------------------------------------------------------------------
RBM42_DANRE     ----------------------------------------------------------------------
TIA1_MOUSE      ----------------------------------------------------------------------
TIA1_HUMAN      ----------------------------------------------------------------------
TIAR_MOUSE      ----------------------------------------------------------------------
TIAR_HUMAN      ----------------------------------------------------------------------
PUB1_YEAST      ----------------------------------------------------------------------
YG41_SCHPO      -------------------------------------------------------------------SSA
NSR1_YEAST      ----------------------------------------------------------------------
RMXL3_PANTR     ----------------------------------------------------------------------
CIRBP_XENLA     ----------------------------------------------------------------------
GRPA_MAIZE      ----------------------------------------------------------------------
CIRBP_PONAB     ----------------------------------------------------------------------
CIRBP_HUMAN     ----------------------------------------------------------------------
MIP6_YEAST      ----------------------------------------------------------------------
GRP1_DAUCA      ----------------------------------------------------------------------
RMXL3_HUMAN     ----------------------------------------------------------------------
NAM8_YEAST      ----------------------------------------------------------------------
PABP_MAGGR      ----------------------------------------------------------------------
GRP8_ARATH      ----------------------------------------------------------------------
CIRBP_RAT       ----------------------------------------------------------------------
CIRBP_MOUSE     ----------------------------------------------------------------------
CIRBP_CRIGR     ----------------------------------------------------------------------
PABP4_HUMAN     ----------------------------------------------------------------------
GRP2_SORBI      ----------------------------------------------------------------------
GRP10_BRANA     ----------------------------------------------------------------------
CSTFT_MOUSE     ----------------------------------------------------------------------
CSTFT_HUMAN     ----------------------------------------------------------------------
ROC3_ARATH      ----------------------------------------------------------------------
RBM24_DANRE     ----------------------------------------------------------------------
GRP1_SINAL      ----------------------------------------------------------------------
TSAP1_PONAB     ----------------------------------------------------------------------
TSAP1_HUMAN     ----------------------------------------------------------------------
TSAP1_BOVIN     ----------------------------------------------------------------------
RBM39_PONAB     ----------------------------------------------------------------------
RBM39_MOUSE     ----------------------------------------------------------------------
RBM39_HUMAN     ----------------------------------------------------------------------
RBM38_XENLA     ----------------------------------------------------------------------
PABP3_ARATH     ----------------------------------------------------------------------
NGR1_YEAST      ---------------------------------------------------------------------A
HNRPG_PANTR     ----------------------------------------------------------------------
HNRPG_HUMAN     ----------------------------------------------------------------------
RBM38_XENTR     ----------------------------------------------------------------------
RBM23_HUMAN     ----------------------------------------------------------------------
PAP1L_HUMAN     ----------------------------------------------------------------------
RBM24_XENTR     ----------------------------------------------------------------------
RBM24_CHICK     ----------------------------------------------------------------------
RB24B_XENLA     ----------------------------------------------------------------------
RB24A_XENLA     ----------------------------------------------------------------------
PAB4L_HUMAN     ----------------------------------------------------------------------
HNRPG_BOVIN     ----------------------------------------------------------------------
GRP2_ARATH      ----------------------------------------------------------------------
RBM24_HUMAN     ----------------------------------------------------------------------
PABP5_ARATH     ----------------------------------------------------------------------
HNRGT_HUMAN     ----------------------------------------------------------------------
TSAP1_RAT       ----------------------------------------------------------------------
RBM38_CHICK     ----------------------------------------------------------------------
HNRPG_RAT       ----------------------------------------------------------------------
GRP7_ARATH      ----------------------------------------------------------------------
CSTF2_PONAB     ----------------------------------------------------------------------
CSTF2_MOUSE     ----------------------------------------------------------------------
CSTF2_HUMAN     ----------------------------------------------------------------------
CSTF2_BOVIN     ----------------------------------------------------------------------
RU17_YEAST      ----------------------------------------------------------------------
ROA3_RAT        ----------------------------------------------------------------------
ROA3_MOUSE      ----------------------------------------------------------------------
ROA3_HUMAN      ----------------------------------------------------------------------
TSAP1_MOUSE     ----------------------------------------------------------------------
ROC2_ARATH      ----------------------------------------------------------------------
RBM38_HUMAN     ----------------------------------------------------------------------
PABP3_HUMAN     ----------------------------------------------------------------------
MSIR6_DROME     ----------------------------------------------------------------------
GRP2_SINAL      ----------------------------------------------------------------------
EPAB_XENTR      ----------------------------------------------------------------------
ZCRB1_RAT       ----------------------------------------------------------------------
ZCRB1_MOUSE     ----------------------------------------------------------------------
YOCE_SCHPO      ----------------------------------------------------------------------
ROC1_NICSY      ----------------------------------------------------------------------
ROC1_ARATH      ----------------------------------------------------------------------
PABP_ASPNC      ----------------------------------------------------------------------
PABP2_ARATH     ----------------------------------------------------------------------
MSI2H_MOUSE     ----------------------------------------------------------------------
MSI2H_HUMAN     ----------------------------------------------------------------------
HNRPG_MOUSE     ----------------------------------------------------------------------
ROA1_CAEEL      ----------------------------------------------------------------------
RO31_XENLA      ----------------------------------------------------------------------
PABP_NEOFI      --------------------------------------------------------------VSTTPAAD
PABP_CRYNE      ----------------------------------------------------------------------
HNRGT_MACFA     ----------------------------------------------------------------------
ROC3_NICSY      ----------------------------------------------------------------------
ELAV_DROVI      ----------------------------------------------------------------------
ELAV_DROME      ----------------------------------------------------------------------
ZCRB1_HUMAN     ----------------------------------------------------------------------
RO32_XENLA      ----------------------------------------------------------------------
EPABB_XENLA     ----------------------------------------------------------------------
ZCRB1_XENLA     ----------------------------------------------------------------------
ZCRB1_DANRE     ----------------------------------------------------------------------
RBY1E_HUMAN     ----------------------------------------------------------------------
RBY1D_HUMAN     ----------------------------------------------------------------------
RBY1B_HUMAN     ----------------------------------------------------------------------
RBY1A_HUMAN     ----------------------------------------------------------------------
PABP_KLULA      ----------------------------------------------------------------------
PABPB_XENLA     ----------------------------------------------------------------------
PABPA_XENLA     ----------------------------------------------------------------------
PABP5_PONPY     ----------------------------------------------------------------------
PABP5_PANTR     ----------------------------------------------------------------------
PABP5_MACMU     ----------------------------------------------------------------------
PABP5_HYLLA     ----------------------------------------------------------------------
PABP5_HUMAN     ----------------------------------------------------------------------
PABP5_GORGO     ----------------------------------------------------------------------
PABP1_RAT       ----------------------------------------------------------------------
PABP1_PONAB     ----------------------------------------------------------------------
PABP1_MOUSE     ----------------------------------------------------------------------
PABP1_HUMAN     ----------------------------------------------------------------------
PABP1_BOVIN     ----------------------------------------------------------------------
U1SBP_XENLA     ----------------------------------------------------------------------
TSP1L_DANRE     ----------------------------------------------------------------------
ROC1_SPIOL      ------------------------------------------------------------STVEEAEKAV
ROC1_NICPL      ----------------------------------------------------------------------
PABP_SCHPO      ----------------------------------------------------------------------
GRP1_SORBI      ----------------------------------------------------------------------
GAR2_SCHPO      ----------------------------------------------------------------------
EPABA_XENLA     ----------------------------------------------------------------------
ZCRB1_BOVIN     ----------------------------------------------------------------------
TSAP1_DANRE     ----------------------------------------------------------------------
RBM45_RAT       ----------------------------------------------------------------------
PABP_DEBHA      ----------------------------------------------------------------------
RBM45_HUMAN     ----------------------------------------------------------------------
PAP1A_DICDI     ----------------------------------------------------------------------
SF3B4_RAT       ----------------------------------------------------------------------
SF3B4_MOUSE     ----------------------------------------------------------------------
SF3B4_HUMAN     ----------------------------------------------------------------------
ROA1_DROME      ----------------------------------------------------------------------
RBM3_MOUSE      ----------------------------------------------------------------------
PABP_EMENI      ----------------------------------------------------------------------
HRP1_YEAST      ----------------------------------------------------------------------
RT19_ARATH      ----------------------------------------------------------------------
ROC5_NICSY      ----------------------------------------------------------------------
ROA1_RAT        ----------------------------------------------------------------------
ROA1_PANTR      ----------------------------------------------------------------------
ROA1_MOUSE      ----------------------------------------------------------------------
ROA1_HUMAN      ----------------------------------------------------------------------
ROA1_BOVIN      ----------------------------------------------------------------------
RBM3_HUMAN      ----------------------------------------------------------------------
RBM38_MOUSE     ----------------------------------------------------------------------
RA1L3_HUMAN     ----------------------------------------------------------------------
RA1L2_HUMAN     ----------------------------------------------------------------------
PPIL4_ASPOR     ----------------------------------------------------------------------
MSI1H_RAT       ----------------------------------------------------------------------
MSI1H_MOUSE     ----------------------------------------------------------------------
MSI1H_HUMAN     ----------------------------------------------------------------------
CSX1_SCHPO      ----------------------------------------------------------------------
BOLL_MOUSE      ----------------------------------------------------------------------
BOLL_MACFA      ----------------------------------------------------------------------
BOLL_HUMAN      ----------------------------------------------------------------------
YDC1_SCHPO      ----------------------------------------------------------------------
SXL_CHRRU       ----------------------------------------------------------------------
RU17_SCHPO      ----------------------------------------------------------------------
ROC4_NICSY      ----------------------------------------------------------------------
RBY1F_HUMAN     ----------------------------------------------------------------------
PPIL4_ASPFU     ----------------------------------------------------------------------
PABP_YEAST      ----------------------------------------------------------------------
PABP_ASPFU      ----------------------------------------------------------------------
PABP_ASHGO      ----------------------------------------------------------------------
MRD1_CANAL      ----------------------------------------------------------------------
CELF1_XENTR     ----------------------------------------------------------------------
CELF1_RAT       ----------------------------------------------------------------------
CELF1_PONAB     ----------------------------------------------------------------------
CELF1_MOUSE     ----------------------------------------------------------------------
CELF1_HUMAN     ----------------------------------------------------------------------
CELF1_CHICK     ----------------------------------------------------------------------
C3H42_ARATH     ----------------------------------------------------------------------
BOULE_DROME     ----------------------------------------------------------------------
ROA1_MACMU      ----------------------------------------------------------------------
PSPC1_DANRE     ----------------------------------------------------------------------
PPIL4_EMENI     ----------------------------------------------------------------------
MRD1_USTMA      ----------------------------------------------------------------------
CELF1_DANRE     ----------------------------------------------------------------------
C3H25_ORYSJ     ----------------------------------------------------------------------
YHKF_SCHPO      ----------------------------------------------------------------------
ROA1_SCHAM      ----------------------------------------------------------------------
RBPE_ANASP      ----------------------------------------------------------------------
RBMX2_HUMAN     ----------------------------------------------------------------------
PABP_YARLI      ----------------------------------------------------------------------
PABP_NEUCR      ----------------------------------------------------------------------
PABP_CHAGB      ----------------------------------------------------------------------
DAZP1_XENLA     ----------------------------------------------------------------------
DAZP1_MOUSE     ----------------------------------------------------------------------
DAZP1_HUMAN     ----------------------------------------------------------------------
CELF3_DANRE     ----------------------------------------------------------------------
CEL3B_XENLA     ----------------------------------------------------------------------
CEL1B_XENLA     ----------------------------------------------------------------------
SXL_MUSDO       ----------------------------------------------------------------------
ROC2_NICSY      ----------------------------------------------------------------------
RBMX2_MOUSE     ----------------------------------------------------------------------
RBM45_MOUSE     ----------------------------------------------------------------------
PABP_PICST      ----------------------------------------------------------------------
CELF2_DANRE     ----------------------------------------------------------------------
CEL3A_XENLA     ----------------------------------------------------------------------
CEL1A_XENLA     ----------------------------------------------------------------------
RU17_DROME      ----------------------------------------------------------------------
ROC2_NICPL      ----------------------------------------------------------------------
RO22_XENLA      ----------------------------------------------------------------------
PES4_YEAST      ----------------------------------------------------------------------
PABP_PICGU      ----------------------------------------------------------------------
PABP_PHANO      ----------------------------------------------------------------------
MRD1_SCHPO      ----------------------------------------------------------------------
MK67I_BOVIN     ----------------------------------------------------------------------
CELF2_XENTR     ----------------------------------------------------------------------
CELF2_XENLA     ----------------------------------------------------------------------
CELF2_RAT       ----------------------------------------------------------------------
CELF2_PONAB     ----------------------------------------------------------------------
CELF2_MOUSE     ----------------------------------------------------------------------
CELF2_HUMAN     ----------------------------------------------------------------------
CELF2_CHICK     ----------------------------------------------------------------------
RBY1B_MOUSE     ----------------------------------------------------------------------
RBM19_HUMAN     ----------------------------------------------------------------------
RB87F_DROME     ----------------------------------------------------------------------
NOP12_KLULA     ----------------------------------------------------------------------
MRD1_ASPFU      ----------------------------------------------------------------------
ELAV3_MOUSE     ----------------------------------------------------------------------
ELAV3_HUMAN     ----------------------------------------------------------------------
CTF1_SCHPO      ----------------------------------------------------------------------
CELF3_MOUSE     ----------------------------------------------------------------------
CELF3_HUMAN     ----------------------------------------------------------------------
CELF3_BOVIN     ----------------------------------------------------------------------
ROA1_XENLA      ----------------------------------------------------------------------
RBPB_ANASP      ----------------------------------------------------------------------
PAP1M_HUMAN     ----------------------------------------------------------------------
PABP_USTMA      ----------------------------------------------------------------------
NOP12_CANGA     ----------------------------------------------------------------------
ELAV1_HUMAN     ----------------------------------------------------------------------
SXL_DROSU       ----------------------------------------------------------------------
SXL_DROME       ----------------------------------------------------------------------
RU17_XENTR      ----------------------------------------------------------------------
RSP4_CAEEL      ----------------------------------------------------------------------
RO21_XENLA      ----------------------------------------------------------------------
RBY1A_MOUSE     ----------------------------------------------------------------------
PABP_ASPCL      --------------------------------------------------------------VSTTPAAD
NOP12_YEAST     ----------------------------------------------------------------------
HNRPQ_HUMAN     ----------------------------------------------------------------------
ELAV2_RAT       ----------------------------------------------------------------------
ELAV2_PONAB     ----------------------------------------------------------------------
ELAV2_MOUSE     ----------------------------------------------------------------------
ELAV2_HUMAN     ----------------------------------------------------------------------
CELF6_MOUSE     ----------------------------------------------------------------------
CELF6_HUMAN     ----------------------------------------------------------------------
ROA2_BOVIN      ----------------------------------------------------------------------
RB27C_DROME     ----------------------------------------------------------------------
PABP_CANAL      ----------------------------------------------------------------------
PABP_ASPOR      ----------------------------------------------------------------------
PABPX_ARATH     ----------------------------------------------------------------------
NOP13_YEAST     ----------------------------------------------------------------------
EIF3G_NEOFI     ----------------------------------------------------------------------
EIF3G_ASPOR     ----------------------------------------------------------------------
EIF3G_ASPNC     ----------------------------------------------------------------------
EIF3G_ASPFU     ----------------------------------------------------------------------
EIF3G_ASPFC     ----------------------------------------------------------------------
SXL_CERCA       ----------------------------------------------------------------------
RU17_MOUSE      ----------------------------------------------------------------------
RU17_HUMAN      ----------------------------------------------------------------------
RU17_BOVIN      ----------------------------------------------------------------------
ROA0_HUMAN      ----------------------------------------------------------------------
RBPA_ANASP      ----------------------------------------------------------------------
PABP_LODEL      ----------------------------------------------------------------------
PABP_DROME      ----------------------------------------------------------------------
NOP12_ASHGO     ----------------------------------------------------------------------
MRD1_EMENI      ----------------------------------------------------------------------
MRD1_CANGA      ----------------------------------------------------------------------
IST3_SCHPO      ----------------------------------------------------------------------
ELAV1_MOUSE     ----------------------------------------------------------------------
EIF3G_PICST     ----------------------------------------------------------------------
EIF3G_EMENI     ----------------------------------------------------------------------
EIF3G_ASPCL     ----------------------------------------------------------------------
RSD1_SCHPO      ----------------------------------------------------------------------
RNP24_SCHPO     ----------------------------------------------------------------------
PABP_COCIM      ----------------------------------------------------------------------
PABP_CANGA      ----------------------------------------------------------------------
NOP4_YEAST      ----------------------------------------------------------------------
NOP12_SCHPO     ----------------------------------------------------------------------
MRD1_ASHGO      ----------------------------------------------------------------------
HNRPQ_RAT       ----------------------------------------------------------------------
HNRPQ_MOUSE     ----------------------------------------------------------------------
FCA_ARATH       ----------------------------------------------------------------------
YKX5_SCHPO      ----------------------------------------------------------------------
ROA2_SAGOE      ----------------------------------------------------------------------
ROA2_RAT        ----------------------------------------------------------------------
ROA2_PONAB      ----------------------------------------------------------------------
ROA2_MOUSE      ----------------------------------------------------------------------
ROA2_HUMAN      ----------------------------------------------------------------------
RNA15_YEAST     ----------------------------------------------------------------------
RBM28_MOUSE     ----------------------------------------------------------------------
PABP_ASPTN      ----------------------------------------------------------------------
NOP12_YARLI     ----------------------------------------------------------------------
MRD1_KLULA      ----------------------------------------------------------------------
ELAV4_RAT       ----------------------------------------------------------------------
ELAV4_MOUSE     ----------------------------------------------------------------------
ELAV4_HUMAN     ----------------------------------------------------------------------
EIF3G_ASPTN     ----------------------------------------------------------------------
CELF4_DANRE     ----------------------------------------------------------------------
SYY_BIFLO       ----------------------------------------------------------------------
SYY_BIFLI       ----------------------------------------------------------------------
SYY_BIFLD       ----------------------------------------------------------------------
SQD_DROME       ----------------------------------------------------------------------
SHEP_DROYA      ----------------------------------------------------------------------
SHEP_DROSE      ----------------------------------------------------------------------
SHEP_DROME      ----------------------------------------------------------------------
SHEP_DROER      ----------------------------------------------------------------------
RBM34_HUMAN     ----------------------------------------------------------------------
RBM15_HUMAN     ----------------------------------------------------------------------
PAB1L_HUMAN     ----------------------------------------------------------------------
MRD1_DICDI      ----------------------------------------------------------------------
HNRPR_HUMAN     ----------------------------------------------------------------------
CELF5_XENTR     ----------------------------------------------------------------------
U2AF2_MOUSE     ----------------------------------------------------------------------
U2AF2_HUMAN     ----------------------------------------------------------------------
U2A2A_WHEAT     ----------------------------------------------------------------------
SXL_MEGSC       ----------------------------------------------------------------------
RBMS1_RAT       ----------------------------------------------------------------------
RBMS1_MOUSE     ----------------------------------------------------------------------
RBMS1_HUMAN     ----------------------------------------------------------------------
RBMS1_BOVIN     ----------------------------------------------------------------------
RBM19_MOUSE     ----------------------------------------------------------------------
RB15B_MOUSE     ----------------------------------------------------------------------
RB15B_HUMAN     ----------------------------------------------------------------------
EIF3G_YARLI     ----------------------------------------------------------------------
EIF3G_PHANO     ----------------------------------------------------------------------
EIF3G_DANRE     ----------------------------------------------------------------------
DAZLB_XENLA     ----------------------------------------------------------------------
DAZLA_XENLA     ----------------------------------------------------------------------
YG5B_YEAST      ----------------------------------------------------------------------
TRA2_DICDI      ----------------------------------------------------------------------
RBMS2_BOVIN     ----------------------------------------------------------------------
PUF68_DROME     ----------------------------------------------------------------------
FOX1C_MOUSE     ---------------------------------------------------------EHGMTLYTPAQTH
EIF3G_COCIM     ----------------------------------------------------------------------
SR140_PONAB     ----------------------------------------------------------------------
SR140_HUMAN     ----------------------------------------------------------------------
SHEP_DROWI      ----------------------------------------------------------------------
SAP49_SCHPO     ----------------------------------------------------------------------
RBM28_HUMAN     ----------------------------------------------------------------------
PPIL4_RHIOR     ----------------------------------------------------------------------
PAP1B_DICDI     ----------------------------------------------------------------------
EIF3G_XENTR     ----------------------------------------------------------------------
EIF3G_RAT       ----------------------------------------------------------------------
EIF3G_MOUSE     ----------------------------------------------------------------------
EIF3G_HUMAN     ----------------------------------------------------------------------
EIF3G_BOVIN     ----------------------------------------------------------------------
EI3GB_XENLA     ----------------------------------------------------------------------
EI3GA_XENLA     ----------------------------------------------------------------------
CELF5_HUMAN     ----------------------------------------------------------------------
SR140_MOUSE     ----------------------------------------------------------------------
SHEP_DROVI      ----------------------------------------------------------------------
SHEP_DROMO      ----------------------------------------------------------------------
SHEP_DROGR      ----------------------------------------------------------------------
MK67I_HUMAN     ----------------------------------------------------------------------
IST3_YEAST      ----------------------------------------------------------------------
DAZL_MOUSE      ----------------------------------------------------------------------
DAZL_MACFA      ----------------------------------------------------------------------
DAZL_HUMAN      ----------------------------------------------------------------------
DAZL_CHICK      ----------------------------------------------------------------------
U1SBP_BOVIN     ----------------------------------------------------------------------
SF3B4_CAEEL     ----------------------------------------------------------------------
RBPF_ANASP      ----------------------------------------------------------------------
RBMS2_MOUSE     ----------------------------------------------------------------------
RBMS2_HUMAN     ----------------------------------------------------------------------
RBM5_RAT        ----------------------------------------------------------------------
RBM5_MOUSE      ----------------------------------------------------------------------
RBM5_HUMAN      ----------------------------------------------------------------------
RBM5_BOVIN      ----------------------------------------------------------------------
RB97D_DROME     ----------------------------------------------------------------------
PPIE_PONAB      ----------------------------------------------------------------------
PPIE_MOUSE      ----------------------------------------------------------------------
PPIE_HUMAN      ----------------------------------------------------------------------
PPIE_BOVIN      ----------------------------------------------------------------------
NOP12_GIBZE     ----------------------------------------------------------------------
MK67I_DANRE     ----------------------------------------------------------------------
EIF3G_MAGGR     ----------------------------------------------------------------------
EIF3G_CAEEL     ----------------------------------------------------------------------
SYY_BIFAA       ----------------------------------------------------------------------
SGN1_YEAST      ----------------------------------------------------------------------
RNPS1_DANRE     ----------------------------------------------------------------------
RBPA_SYNY3      ----------------------------------------------------------------------
PSPC1_BOVIN     ----------------------------------------------------------------------
MK67I_MOUSE     ----------------------------------------------------------------------
HRB1_YEAST      ----------------------------------------------------------------------
FOX1C_HUMAN     ---------------------------------------------------------EHGMTLYTPAQTH
DAZL_CALJA      ----------------------------------------------------------------------
DAZ4_HUMAN      ----------------------------------------------------------------TPNPVT
DAZ1_HUMAN      ----------------------------------------------------------------TPNPVT
U1SBP_RAT       ----------------------------------------------------------------------
U1SBP_HUMAN     ----------------------------------------------------------------------
RU17_XENLA      ----------------------------------------------------------------------
RBMS3_PONAB     ----------------------------------------------------------------------
RBMS3_MOUSE     ----------------------------------------------------------------------
RBMS3_HUMAN     ----------------------------------------------------------------------
PUF60_RAT       ----------------------------------------------------------------------
PUF60_PONAB     ----------------------------------------------------------------------
PUF60_MOUSE     ----------------------------------------------------------------------
PUF60_HUMAN     ----------------------------------------------------------------------
PUF60_BOVIN     ----------------------------------------------------------------------
NONO_RAT        ----------------------------------------------------------------------
NONO_MOUSE      ----------------------------------------------------------------------
MRD1_YEAST      ----------------------------------------------------------------------
LARK_DROME      ----------------------------------------------------------------------
HNRPD_RAT       ----------------------------------------------------------------------
HNRPD_MOUSE     ----------------------------------------------------------------------
HNRPD_HUMAN     ----------------------------------------------------------------------
G3BP1_BOVIN     ----------------------------------------------------------------------
EIF3G_LODEL     ----------------------------------------------------------------------
EIF3G_CANAL     ----------------------------------------------------------------------
DAZ3_HUMAN      ----------------------------------------------------------------------
DAZ2_HUMAN      ----------------------------------------------------------------------
RNPS1_XENTR     ----------------------------------------------------------------------
RNP1B_XENLA     ----------------------------------------------------------------------
RNP1A_XENLA     ----------------------------------------------------------------------
RAVR1_HUMAN     ----------------------------------------------------------------------
PPIL4_NEUCR     ----------------------------------------------------------------------
NOP15_YEAST     ----------------------------------------------------------------------
MUG28_SCHPO     ----------------------------------------------------------------------
U2A2A_NICPL     ------------------------------------------------------------------PSLA
SFRS2_RAT       ----------------------------------------------------------------------
SFRS2_PIG       ----------------------------------------------------------------------
SFRS2_PANTR     ----------------------------------------------------------------------
SFRS2_MOUSE     ----------------------------------------------------------------------
SFRS2_HUMAN     ----------------------------------------------------------------------
SFRS2_CHICK     ----------------------------------------------------------------------
SFRS2_BOVIN     ----------------------------------------------------------------------
SFR2B_HUMAN     ----------------------------------------------------------------------
RRP2_SPIOL      ----------------------------------------------------------------------
PPIL4_USTMA     ----------------------------------------------------------------------
NOP12_CANAL     ----------------------------------------------------------------------
HRP65_CHITE     ----------------------------------------------------------------------
G3BP1_PONAB     ----------------------------------------------------------------------
G3BP1_HUMAN     ----------------------------------------------------------------------
EIF3G_CRYNE     ----------------------------------------------------------------------
EIF3G_CHAGB     ----------------------------------------------------------------------
EIF3G_ASHGO     ----------------------------------------------------------------------
DAZL_XENTR      ----------------------------------------------------------------------
SPEN_DROME      ----------------------------------------------------------------------
RBM9_RAT        ----------------------------------------------------------------------
RBM9_MOUSE      ----------------------------------------------------------------------
RBM9_HUMAN      ----------------------------------------------------------------------
RBM9_BOVIN      ----------------------------------------------------------------------
PU60B_DANRE     ----------------------------------------------------------------------
PSPC1_RAT       ----------------------------------------------------------------------
PSPC1_MOUSE     ----------------------------------------------------------------------
PSPC1_HUMAN     ----------------------------------------------------------------------
PSPC1_CHICK     ----------------------------------------------------------------------
PPIL4_SCHPO     ----------------------------------------------------------------------
PPIL4_MOUSE     ----------------------------------------------------------------------
PPIL4_HUMAN     ----------------------------------------------------------------------
NCBP2_ARATH     ----------------------------------------------------------------------
FOX1A_PONAB     ----------------------------------------------------------------------
FOX1A_MOUSE     ----------------------------------------------------------------------
FOX1A_MACFA     ----------------------------------------------------------------------
FOX1A_HUMAN     ----------------------------------------------------------------------
EIF3G_NEUCR     ----------------------------------------------------------------------
EIF3G_NEMVE     ----------------------------------------------------------------------
U2AF2_DROME     ----------------------------------------------------------------------
U1SBP_MOUSE     ----------------------------------------------------------------------
NUCL_XENLA      ----------------------------------------------------------------------
G3BP1_MOUSE     ----------------------------------------ASVTSKNLPPSGAVP------VTGTPPHVV
FUSIP_MOUSE     ----------------------------------------------------------------------
FUSIP_HUMAN     ----------------------------------------------------------------------
FOX1_CAEEL      ----------------------------------------------------------------------
FOX1A_DANRE     ----------------------------------------------------------------------
DAZL_DANRE      ----------------------------------------------------------------------
RAVR1_RAT       ----------------------------------------------------------------------
RAVR1_MOUSE     ----------------------------------------------------------------------
NUCL_RAT        ----------------------------------------------------------------------
NUCL_PONAB      ----------------------------------------------------------------------
NUCL_MOUSE      ----------------------------------------------------------------------
NUCL_MESAU      ----------------------------------------------------------------------
NUCL_MACFA      ----------------------------------------------------------------------
NUCL_HUMAN      ----------------------------------------------------------------------
NUCL_CHICK      ----------------------------------------------------------------------
NOP12_DEBHA     ----------------------------------------------------------------------
MK67I_XENTR     ----------------------------------------------------------------------
YQO4_CAEEL      ----------------------------------------------------------------------
U2A2B_NICPL     ------------------------------------------------------------------PSLA
U2A2B_ARATH     ----------------------------------------------------------------------
U2A2A_ARATH     ------------------------------------------------------------------PSLA
TRA2B_RAT       ----------------------------------------------------------------------
TRA2B_MOUSE     ----------------------------------------------------------------------
TRA2B_HUMAN     ----------------------------------------------------------------------
TRA2B_BOVIN     ----------------------------------------------------------------------
TRA2A_MOUSE     ----------------------------------------------------------------------
TRA2A_HUMAN     ----------------------------------------------------------------------
RNPS1_RAT       ----------------------------------------------------------------------
RNPS1_PONAB     ----------------------------------------------------------------------
RNPS1_MOUSE     ----------------------------------------------------------------------
RNPS1_MACFA     ----------------------------------------------------------------------
RNPS1_HUMAN     ----------------------------------------------------------------------
RNPS1_BOVIN     ----------------------------------------------------------------------
RBM18_PONAB     ----------------------------------------------------------------------
RBM18_MOUSE     ----------------------------------------------------------------------
RBM18_HUMAN     ----------------------------------------------------------------------
MK67I_RAT       ----------------------------------------------------------------------
EIF3G_DEBHA     ----------------------------------------------------------------------
TADBP_CHICK     ----------------------------------------------------------------------
ROAA_MOUSE      ----------------------------------------------------------------------
ROAA_HUMAN      ----------------------------------------------------------------------
RBP1_DROME      ----------------------------------------------------------------------
NONO_PONAB      ----------------------------------------------------------------------
NONO_HUMAN      ----------------------------------------------------------------------
MRD1_YARLI      ----------------------------------------------------------------------
HNDLB_XENLA     ----------------------------------------------------------------------
EIF3G_SCLS1     ----------------------------------------------------------------------
EIF3G_BOTFB     ----------------------------------------------------------------------
TADBP_XENTR     ----------------------------------------------------------------------
SFRS6_HUMAN     ----------------------------------------------------------------------
SCE3_SCHPO      ------------------------------------------------------------STYRATPSSA
RSP1_CAEEL      ----------------------------------------------------------------------
RBPD_ANASP      ----------------------------------------------------------------------
RBM18_XENLA     ----------------------------------------------------------------------
RBM18_BOVIN     ----------------------------------------------------------------------
PPIE_DROME      ----------------------------------------------------------------------
TCG1_SCHPO      ----------------------------------------------------------------------
SFPQ_MOUSE      ----------------------------------------------------------------------
SFPQ_HUMAN      ----------------------------------------------------------------------
RBM9_XENTR      ----------------------------------------------------------------------
RBM47_MOUSE     ---------------------------------------------------------EDSATMNSDPTVG
PPIL4_GIBZE     ----------------------------------------------------------------------
NELFE_DROME     ----------------------------------------------------------------------
MK67I_XENLA     ----------------------------------------------------------------------
HNRDL_RAT       ----------------------------------------------------------------------
FOX1L_DANRE     ----------------------------------------------------------------------
EIF3G_YEAS7     --------------------------------------------------LSELSALEDPATSEGGVEAA
DAZ1_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QTTSTTPIPGQPNAPNQSGPGKTVMRSGGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
RBM42_XENLA     ------------------------IRTAAGTSWEDQSLLEWEPDDFRIFCGDLGNEVNDDILARAFSRYP
RBM42_RAT       ------------------------IRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFP
RBM42_MOUSE     ------------------------IRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFP
RBM42_HUMAN     ------------------------IRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFP
RBM42_BOVIN     ------------------------IRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFP
YDB2_SCHPO      ----------------------TVVRKAGGQVWEDPTLLEWDPNHFRLFVGNLGNDVNDESLYQAFSEYP
RBM42_XENTR     ------------------------IRTAAGTSWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYP
RBM42_DANRE     ------------------------IRVAAGVSWEDTSLLEWETDDFRIFCGDLGNEVNDDILARAFSRYP
TIA1_MOUSE      --------------------------------------------HFHVFVGDLSPEITTEDIKAAFAPFG
TIA1_HUMAN      --------------------------------------------HFHVFVGDLSPEITTEDIKAAFAPFG
TIAR_MOUSE      --------------------------------------------HFHVFVGDLSPEITTEDIKSAFAPFG
TIAR_HUMAN      --------------------------------------------HFHVFVGDLSPEITTEDIKSAFAPFG
PUB1_YEAST      ---------------------------------------------FNLFVGDLNVNVDDETLRNAFKDFP
YG41_SCHPO      MSMNNKPIPGTNHL------FKLNWASGGGLREKSIS----KASEYSIFVGDLSPNVNEFDVYSLFSRYN
NSR1_YEAST      -----------------------------------------------LFLGNLSFNADRDAIFELFAKHG
RMXL3_PANTR     ----------------------------------------------KLFVGGLNLKTDEKALKAEFGKYG
CIRBP_XENLA     ----------------------------------------------KLFIGGLNFETNEDCLEQAFTKYG
GRPA_MAIZE      ---------------------------------------------YRCFVGGLAWATSNESLENAFASYG
CIRBP_PONAB     ----------------------------------------------KLFVGGLSFDTNEQSLEQVFSKYG
CIRBP_HUMAN     ----------------------------------------------KLFVGGLSFDTNEQSLEQVFSKYG
MIP6_YEAST      -----------------------------------------------LFIGNLKSTVTEEMLRKIFKRYQ
GRP1_DAUCA      ---------------------------------------------YRCFVGGLAWATNDESLEQAFSQFG
RMXL3_HUMAN     ----------------------------------------------KLFIGGLNLKTDEKALKAEFGKYG
NAM8_YEAST      -----------------------------------------------IFVGDLAPNVTESQLFELFNRYA
PABP_MAGGR      -----------------------------------------------IYVKNINPEVTDDEFRTLFEKYG
GRP8_ARATH      ---------------------------------------------YRCFVGGLAWATNDEDLQRTFSQFG
CIRBP_RAT       ----------------------------------------------KLFVGGLSFDTNEQALEQVFSKYG
CIRBP_MOUSE     ----------------------------------------------KLFVGGLSFDTNEQALEQVFSKYG
CIRBP_CRIGR     ----------------------------------------------KLFVGGLSFDTNEQALEQVFSKYG
PABP4_HUMAN     -----------------------------------------------VYIKNFGEEVDDESLKELFSQFG
GRP2_SORBI      ---------------------------------------------YRCFVGGLAWATNNETLEQAFANFG
GRP10_BRANA     ---------------------------------------------YRCFVGGLAWATGDAELERTFSQFG
CSTFT_MOUSE     -----------------------------------SSLAVRDPAMDRVFVGNIPYEATEEQLKDIFSEVG
CSTFT_HUMAN     -----------------------------------SSLAVRDPAMDRVFVGNIPYEATEEQLKDIFSEVG
ROC3_ARATH      ----------------------------------------YEPA-FRVYVGNLPWDVDNGRLEQLFSEHG
RBM24_DANRE     -----------------------------------------DTTYTKIFVGGLPYHTTDSSLRKYFEVFG
GRP1_SINAL      ---------------------------------------------YRCFVGGLAWATDDRALETAFSQYG
TSAP1_PONAB     ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
TSAP1_HUMAN     ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
TSAP1_BOVIN     ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
RBM39_PONAB     ----------------------------------------------RLYVGSLHFNITEDMLRGIFEPFG
RBM39_MOUSE     ----------------------------------------------RLYVGSLHFNITEDMLRGIFEPFG
RBM39_HUMAN     ----------------------------------------------RLYVGSLHFNITEDMLRGIFEPFG
RBM38_XENLA     -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEVFG
PABP3_ARATH     -----------------------------------------------LYLKNLDDSVDDEKLKEMFSEYG
NGR1_YEAST      LSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPSEFSLFVGDLSPTATEADLLSLFTRFK
HNRPG_PANTR     ----------------------------------------------KLFIGGLNTETNEKALEAVFGKYG
HNRPG_HUMAN     ----------------------------------------------KLFIGGLNTETNEKALEAVFGKYG
RBM38_XENTR     -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEVFG
RBM23_HUMAN     ----------------------------------------------RLYVGSLHFNITEDMLRGIFEPFG
PAP1L_HUMAN     -----------------------------------------------LYVKNLDDSIDDDKLRKEFSPYG
RBM24_XENTR     -----------------------------------------DTTYTKIFVGGLPYHTTDSSLRKYFEVFG
RBM24_CHICK     -----------------------------------------DTTYTKIFVGGLPYHTTDSSLRKYFEVFG
RB24B_XENLA     -----------------------------------------DTTYTKIFVGGLPYHTTDSSLRKYFEVFG
RB24A_XENLA     -----------------------------------------DTTYTKIFVGGLPYHTTDSSLRKYFEVFG
PAB4L_HUMAN     ----------------------------------------------KLYIKNLDDTIDDEKLRNEFSSFG
HNRPG_BOVIN     ----------------------------------------------KLFIGGLNLETDEKSLEATFGKYG
GRP2_ARATH      ----------------------------------------------KLFIGGLSWGTDDASLRDAFAHFG
RBM24_HUMAN     -----------------------------------------DTTYTKIFVGGLPYHTTDASLRKYFEVFG
PABP5_ARATH     -----------------------------------------------LYLKNLDDSVNDEKLKEMFSEYG
HNRGT_HUMAN     ----------------------------------------------KLFIGGLNLETDEKALEAEFGKYG
TSAP1_RAT       ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
RBM38_CHICK     -----------------------------------------DTTFTKIFVGGLPYHTTDSSLRKYFEVFG
HNRPG_RAT       ----------------------------------------------KLFIGGLNTETNEKALEAVFGKYG
GRP7_ARATH      ---------------------------------------------YRCFVGGLAWATDDRALETAFAQYG
CSTF2_PONAB     -----------------------------------------DPAVDRVFVGNIPYEATEEQLKDIFSEVG
CSTF2_MOUSE     -----------------------------------------DPAVDRVFVGNIPYEATEEQLKDIFSEVG
CSTF2_HUMAN     -----------------------------------------DPAVDRVFVGNIPYEATEEQLKDIFSEVG
CSTF2_BOVIN     -----------------------------------------DPAVDRVFVGNIPYEATEEQLKDIFSEVG
RU17_YEAST      ------------------------------QNWNDPHIKDTDP-YRTIFIGRLPYDLDEIELQKYFVKFG
ROA3_RAT        ----------------------------------------------KLFIGGLSFETTDDSLREHFEKWG
ROA3_MOUSE      ----------------------------------------------KLFIGGLSFETTDDSLREHFEKWG
ROA3_HUMAN      ----------------------------------------------KLFIGGLSFETTDDSLREHFEKWG
TSAP1_MOUSE     ---------------------------------------------YSLFVGDLTPDVDDGMLYEFFVKYP
ROC2_ARATH      ----------------------------------------------RLYVGNLSWGVDDMALENLFNEQG
RBM38_HUMAN     -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEGFG
PABP3_HUMAN     -----------------------------------------------LYVKNLDDGIDDERLRKAFSPFG
MSIR6_DROME     ----------------------------------------------KMFIGGLSWQTSPESLRDYFGRYG
GRP2_SINAL      ---------------------------------------------YRCFVGGLAWATDERSLETAFSQFG
EPAB_XENTR      -----------------------------------------------LYVKNLDDGIDDDRLRKEFSPYG
ZCRB1_RAT       ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
ZCRB1_MOUSE     ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
YOCE_SCHPO      -----------------------------------------------LFVRNLAFQTKQDDLTNFFSDVG
ROC1_NICSY      ----------------------------------------------RVYVGNLAWGVDQDALETLFSEQG
ROC1_ARATH      ----------------------------------------------RVYVGNLSWGVDDMALESLFSEQG
PABP_ASPNC      -----------------------------------------------VYIKNLDSEIDDDEFRKMFEKFG
PABP2_ARATH     -----------------------------------------------LYVGDLDFNVTDSQLFDAFGQMG
MSI2H_MOUSE     ----------------------------------------------KMFIGGLSWQTSPDSLRDYFSKFG
MSI2H_HUMAN     ----------------------------------------------KMFIGGLSWQTSPDSLRDYFSKFG
HNRPG_MOUSE     ----------------------------------------------KLFIGGLNTETNEKALEAVFGKYG
ROA1_CAEEL      ----------------------------------------------RLYVSGVREDHTEDMLTEYFTKYG
RO31_XENLA      -------------------------RGGMDDHWPSSDDQGHDPKERKLFIGGLSFETTDDSLREHFEQWG
PABP_NEOFI      NTVNGTPEATNPAAT--SAPEVTAVESASPSATPSAN----QPHSASLYVGELDPSVTEAMLYELFSSIG
PABP_CRYNE      -------------------------------------------AGVNLYVKNLDDEWDDDRLRAEFEAFG
HNRGT_MACFA     ----------------------------------------------KLFIGGLNLETDEKALEAEFGKYG
ROC3_NICSY      ---------------------------------------------YRIYVGNIPWDIDDARLEQVFSEHG
ELAV_DROVI      ---------------------------------------------YPIFIYNLAPETEEAALWQLFGPFG
ELAV_DROME      ---------------------------------------------YPIFIYNLAPETEEAALWQLFGPFG
ZCRB1_HUMAN     ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
RO32_XENLA      ----------------------------------------------KLFIGGLSFETTDDSLREHFEQWG
EPABB_XENLA     -----------------------------------------------LYVKNLDDGIDDDRLRKEFSPYG
ZCRB1_XENLA     ------------------------------------------PSKSTVYVSNLPFSLTNNDLHRIFSKYG
ZCRB1_DANRE     ------------------------------------------PSKSTVYVSNIPFSLTNSDMHKLCSKYG
RBY1E_HUMAN     ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
RBY1D_HUMAN     ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
RBY1B_HUMAN     ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
RBY1A_HUMAN     ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
PABP_KLULA      -----------------------------------------------LFIKNLDDSIDDEKLKEEFAPYG
PABPB_XENLA     -----------------------------------------------LYVKNLDDGIDDERLRKEFTPFG
PABPA_XENLA     -----------------------------------------------VYIKNFGDDMNDERLKEMFGKYG
PABP5_PONPY     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP5_PANTR     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP5_MACMU     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP5_HYLLA     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP5_HUMAN     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP5_GORGO     ------------------------------------------PPGVPIYIKNLDETINDEKLKEEFSSFG
PABP1_RAT       -----------------------------------------------VYIKNFGEDMDDERLKELFGKFG
PABP1_PONAB     -----------------------------------------------LYVKNLDDGIDDERLRKEFSPFG
PABP1_MOUSE     -----------------------------------------------VYIKNFGEDMDDERLKELFGKFG
PABP1_HUMAN     -----------------------------------------------LYVKNLDDGIDDERLRKEFSPFG
PABP1_BOVIN     -----------------------------------------------LYVKNLDDGIDDERLRKEFSPFG
U1SBP_XENLA     -----------------------------------------DP-HLTLFVSRLSPQTTEEKLKEVFSRYG
TSP1L_DANRE     ---------------------------------------------FSVFVGDLTSEVDDYQLHQFFKKFP
ROC1_SPIOL      ELLNGYDMDGRQLTVNKAAPRGSPERAPRG---------DFEPS-CRVYVGNLPWDVDTSRLEQLFSEHG
ROC1_NICPL      -----------------------------------------------VYVGNLAWGVDQDALETLFSEQG
PABP_SCHPO      -----------------------------------------------LFIKNLQDEVDDERLKAEFSAFG
GRP1_SORBI      -----------------------------------------------------------NSLHSAFSTYG
GAR2_SCHPO      -----------------------------------------------VFVGNLSFNATEDDLSTAFGGCG
EPABA_XENLA     -----------------------------------------------LYVKNLDDGIDDDRLRKEFLPYG
ZCRB1_BOVIN     ------------------------------------------PSKSTVYVSNLPFSLTNNDLYRIFSKYG
TSAP1_DANRE     -----------------------------------------------LWMGNLEPYMDEDFICRAFAQME
RBM45_RAT       -----------------------------------------EPPNSRIFL--VISKYTSESVLREFSPFG
PABP_DEBHA      -----------------------------------------------LFIKNLDDTIDSEKLEEEFKPFG
RBM45_HUMAN     -----------------------------------------EPPNSRIFL--VISKYTPESVLREFSPFG
PAP1A_DICDI     -------------------------------------------------------------LREVFSQFG
SF3B4_RAT       -----------------------------------------------IFIGNLDPEIDEKLLYDTFSAFG
SF3B4_MOUSE     -----------------------------------------------IFIGNLDPEIDEKLLYDTFSAFG
SF3B4_HUMAN     -----------------------------------------------IFIGNLDPEIDEKLLYDTFSAFG
ROA1_DROME      -----------------------------------------EPEHMRLFIGGLDYRTTDENLKAHFEKWG
RBM3_MOUSE      ----------------------------------------------KLFVGGLNFNTDEQALEDHFSSFG
PABP_EMENI      -----------------------------------------------IYIKNIDPEVEDEEFRKLFEKFG
HRP1_YEAST      ----------------------------------------------KMFIGGLNWDTTEDNLREYFGKYG
RT19_ARATH      ----------------------------------------------KLYIGGLSPGTDEHSLKDAFSSFN
ROC5_NICSY      ----------------------------------------------KLYVANLSWALTSQGLRDAFADQP
ROA1_RAT        ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
ROA1_PANTR      ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
ROA1_MOUSE      ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
ROA1_HUMAN      ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
ROA1_BOVIN      ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
RBM3_HUMAN      ----------------------------------------------KLFVGGLNFNTDEQALEDHFSSFG
RBM38_MOUSE     -----------------------------------------DTTFTKIFVGGLPYHTTDASLRKYFEGFG
RA1L3_HUMAN     ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
RA1L2_HUMAN     ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
PPIL4_ASPOR     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTQDEDLHLIFSRFG
MSI1H_RAT       ----------------------------------------------KMFIGGLSWQTTQEGLREYFGQFG
MSI1H_MOUSE     ----------------------------------------------KMFIGGLSWQTTQEGLREYFGQFG
MSI1H_HUMAN     ----------------------------------------------KMFIGGLSWQTTQEGLREYFGQFG
CSX1_SCHPO      -----------------------------------------DP-EFSIFVGDLLPTTEDSDLFMTFSIYP
BOLL_MOUSE      ----------------------------------------------RIFVGGIDFKTNENDLRKFFSQYG
BOLL_MACFA      ----------------------------------------------RIFVGGIDFKTNESDLRKFFSQYG
BOLL_HUMAN      ----------------------------------------------RIFVGGIDFKTNESDLRKFFSQYG
YDC1_SCHPO      -----------------------------------------------LFVSGIASRMQEDELQQIFSKFG
SXL_CHRRU       -----------------------------------------------LYVTNLPRTITDDELEKIFGKYG
RU17_SCHPO      -----------------------------------SMIKVWDPDHDRMFLSRLSYDTKESDIEREFTRYG
ROC4_NICSY      ---------------------------------------------YRIYVGNIPWGIDDARLEQLFSEHG
RBY1F_HUMAN     ----------------------------------------------KLFIGGLNRETNEKMLKAVFGKHG
PPIL4_ASPFU     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTQDEDLQLIFSRFG
PABP_YEAST      -----------------------------------------------LFVKNLDDSVDDEKLEEEFAPYG
PABP_ASPFU      -----------------------------------------------VYIKNIDQEVTDEEFRKMFEKFG
PABP_ASHGO      -----------------------------------------------LFVKNLDDSIDDEKLKEEFAPFG
MRD1_CANAL      ----------------------------------------------RLFIRNISYEASEEDFRSLFSQYG
CELF1_XENTR     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
CELF1_RAT       ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
CELF1_PONAB     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
CELF1_MOUSE     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
CELF1_HUMAN     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
CELF1_CHICK     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
C3H42_ARATH     -----------------------------------------------VYVGGIPFDLTEGDLLAVFSQYG
BOULE_DROME     ----------------------------------------------RIFVGGISGDTTEADLTRVFSAYG
ROA1_MACMU      ----------------------------------------------KLFIGGLSFETTDESLRSHFEQWG
PSPC1_DANRE     ---AVAPSPQDPSSANSEPQEMTVFRRPGEKTFTQRC---------RLFVGNLPSDMADEDFKKLFFKYG
PPIL4_EMENI     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTQDEDLELIFSRFG
MRD1_USTMA      ----------------------------------------------RLFIRNLPFAASGDEILAFFESFG
CELF1_DANRE     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
C3H25_ORYSJ     -----------------------------------------------VFVGGIPYDLTEGDLLAVFAQYG
YHKF_SCHPO      ----------------------------------------------KMFIGGLNWETTDDSLRDYFEQFG
ROA1_SCHAM      -----------------------------------------EPEHVRLFIGGLDYRTTDESLKQHFEQWG
RBPE_ANASP      -----------------------------------------------IYVGNLSYSVTQDDLTKVFSEYG
RBMX2_HUMAN     -----------------------------------------------IFLGGLPYELTEGDIICVFSQYG
PABP_YARLI      -----------------------------------------------LYIKNLDDTIDDDKLRAEFAPHG
PABP_NEUCR      -----------------------------------------------VYVKNINNEVTDEEFRELFAKFG
PABP_CHAGB      -----------------------------------------------IYVKNISLEATDEEFRDLFAKYG
DAZP1_XENLA     ----------------------------------------------KLFVGGLDWSTTQETLRSYFSQYG
DAZP1_MOUSE     ----------------------------------------------KLFVGGLDWSTTQETLRSYFSQYG
DAZP1_HUMAN     ----------------------------------------------KLFVGGLDWSTTQETLRSYFSQYG
CELF3_DANRE     ------------------------------------------PEGCNIFIYHLPQEFTDSEMLQMFLPFG
CEL3B_XENLA     ------------------------------------------PEGCNIFIYHLPQEFTDSEILQMFLPFG
CEL1B_XENLA     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
SXL_MUSDO       -----------------------------------------------LYVTNLPRTITDDELEKIFGKYG
ROC2_NICSY      ----------------------------------------------KLFVGNLPFSVDSAALAGLFERAG
RBMX2_MOUSE     -----------------------------------------------IFVGGLPYELTEGDIICVFSQYG
RBM45_MOUSE     -----------------------------------------EPPNSRIFLV-ISKHTSELVLRERFSPFG
PABP_PICST      -----------------------------------------------LFIKNLDDTIDSEKLEEEFKPFG
CELF2_DANRE     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CEL3A_XENLA     ------------------------------------------PEGCNIFIYHLPQEFTDSEILQMFLPFG
CEL1A_XENLA     ------------------------------------------PEGANLFIYHLPQEFGDQDLLQMFMPFG
RU17_DROME      ----------------------------------------WDPTEIKLFIARINYDTSESKLRREFEFYG
ROC2_NICPL      ----------------------------------------------RVYVGNLSWGVDDLALKELFSEQG
RO22_XENLA      ----------------------------------------------KLFVGGIKEDTEEHHLREYFEEYG
PES4_YEAST      -----------------------------------------------LFIGDLHETVTEETLKGIFKKYP
PABP_PICGU      -----------------------------------------------LFVKNLDDSIDSEKLEEEFKPFG
PABP_PHANO      -----------------------------------------------LYVGELDPSVTEAMLFELFSSIG
MRD1_SCHPO      ----------------------------------------------RLFLRNLTYSCAEDDLKSLFGPFG
MK67I_BOVIN     -----------------------------------------------IYVGHLPPTLYETQIRAYFSQFG
CELF2_XENTR     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_XENLA     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_RAT       ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_PONAB     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_MOUSE     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_HUMAN     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
CELF2_CHICK     ------------------------------------------PEGANLFIYHLPQEFGDQDILQMFMPFG
RBY1B_MOUSE     ----------------------------------------------KIFIGGLNIKTRQKTLQEIFGRFG
RBM19_HUMAN     ----------EKNVPTTKGAPKNTTKSWQGRILGXXXXXXDLAESGRLFVRNLPYTSTEEDLEKLFSKYG
RB87F_DROME     ----------------------------------------------KLFIGGLDYRTTDDGLKAHFEKWG
NOP12_KLULA     -----------------------------------------------VFVGNLDFEEVEESLWKHFEPCG
MRD1_ASPFU      ----------------------------------------------RLFVRNLPYDASESDLEPVFSKFG
ELAV3_MOUSE     -----------------------------------------DDSKTNLIVNYLPQNMTQDEFKSLFGSIG
ELAV3_HUMAN     -----------------------------------------DDSKTNLIVNYLPQNMTQDEFKSLFGSIG
CTF1_SCHPO      -----------------------------------------------VFVGNIPYDVSEQQMTEIFNQVG
CELF3_MOUSE     ------------------------------------------PDGCNIFIYHLPQEFTDSEILQMFVPFG
CELF3_HUMAN     ------------------------------------------PDGCNIFIYHLPQEFTDSEILQMFVPFG
CELF3_BOVIN     ------------------------------------------PDGCNIFIYHLPQEFTDSEILQMFVPFG
ROA1_XENLA      ----------------------------------------------KLFIGGLSFETTDESLREHFEQWG
RBPB_ANASP      -----------------------------------------------IYVGNLSYDVTEESLNAVFAEYG
PAP1M_HUMAN     -----------------------------------------------LYVGDLHPEVTEAMLYEKFSPAG
PABP_USTMA      -----------------------------------------------LYVGELDPSVTEAMLFEIFSMIG
NOP12_CANGA     -----------------------------------------------VFVGNLDFEEDEESLWKHFGACG
ELAV1_HUMAN     -----------------------------------------DIGRTNLIVNYLPQNMTQDELRSLFSSIG
SXL_DROSU       -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
SXL_DROME       -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
RU17_XENTR      ----------------------------------ENELKIWDPAFKTLFVARVNYDTTESKLRREFEVYG
RSP4_CAEEL      ---------------------------------------------------NLSYQTTPNDLRRTFERYG
RO21_XENLA      --------------------------------------MEREKEQFRLFIGGLSFETTEESLRNYYEQWG
RBY1A_MOUSE     ----------------------------------------------KIFIGGLNIKTRQKTLQEIFGRFG
PABP_ASPCL      NVNGT---PEATNAAATSAPEVTAVEXXXXXXXXXXX----QPHSASLYVGELDPSVTEAMLYELFSSIG
NOP12_YEAST     -----------------------------------------------IFVGNLDFEEIEESLWKHFEPCG
HNRPQ_HUMAN     ------------------------LMSGKVKVWGNVGTVEWDPEVMALFVRNLANTVTEEILEKAFSQFG
ELAV2_RAT       -----------------------------------------------IFVYNLAPDADESILWQMFGPFG
ELAV2_PONAB     -----------------------------------------------IFVYNLAPDADESILWQMFGPFG
ELAV2_MOUSE     -----------------------------------------------IFVYNLAPDADESILWQMFGPFG
ELAV2_HUMAN     -----------------------------------------------IFVYNLAPDADESILWQMFGPFG
CELF6_MOUSE     ------------------------------------------PEGCNLFIYHLPQEFGDAELIQTFLPFG
CELF6_HUMAN     ------------------------------------------PEGCNLFIYHLPQEFGDAELIQTFLPFG
ROA2_BOVIN      --------------------------------------MEREKEQFRLFIGGLSFETTEESLRNYYEQWG
RB27C_DROME     ---------------------------------------------YKVFLGGLPSNVTETDLRTFFNRYG
PABP_CANAL      -----------------------------------------------LFVKNLDDTIDSEKLEEEFKPFG
PABP_ASPOR      -----------------------------------------------VYIKNIDQDVTEEEFRELFEKFG
PABPX_ARATH     -----------------------------------------------LYMKNLDADVSEDLLREKFAEFG
NOP13_YEAST     ----------------------------------DLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCG
EIF3G_NEOFI     -------------------------------------------------------ELAEESELRLFERFG
EIF3G_ASPOR     ---------------------------------------------------NVSELAEEGELRDLFERFG
EIF3G_ASPNC     ---------------------------------------------------NVSELAEEGELRDLFERFG
EIF3G_ASPFU     -------------------------------------------------------ELAEESELRLFERFG
EIF3G_ASPFC     -------------------------------------------------------ELAEESELRLFERFG
SXL_CERCA       -----------------------------------------------LYVTNLPRTITDDQLDTIFGKYG
RU17_MOUSE      ----------------------------------------WDPAFKTLFVARVNYDTTESKLRREFEVYG
RU17_HUMAN      ----------------------------------------WDPAFKTLFVARVNYDTTESKLRREFEVYG
RU17_BOVIN      ----------------------------------------WDPAFKTLFVARVNYDTTESKLRREFEVYG
ROA0_HUMAN      -------------------------------------------------------DVAEGDLIEHFSQFG
RBPA_ANASP      -----------------------------------------------IYVGNLSYEVTQDTLSAVFAEYG
PABP_LODEL      -----------------------------------------------LFVKNLDEQIDSEKLEEEFKPFG
PABP_DROME      ----------------------------------------------------------------AFSPYG
NOP12_ASHGO     -----------------------------------------------VFVGNLDFEESEESLWKHFMSCG
MRD1_EMENI      ----------------------------------------------RLFVRNLSYETKESELEPVFSPFG
MRD1_CANGA      ----------------------------------------------RLFLRNILYSSTEDDFKKLFSPYG
IST3_SCHPO      -----------------------------------------------IYIGNLDFDLNEDDILCVFSEFG
ELAV1_MOUSE     -----------------------------------------------IFIYNLGQDADEGILWQMFGPFG
EIF3G_PICST     ---ATTSSPAAESGAGDNGPGKYVPRHLRADANGNLPLKEGRDDSTTLKVSQLNSFVDEDMLRELFARFG
EIF3G_EMENI     ---------------------------------------------------NVSELAEEQELRDLFERFG
EIF3G_ASPCL     -------------------------------------------------------ELAEESEIRLFERFG
RSD1_SCHPO      -----------------------------------------------VFVSQLANRLTSRELYDFFEQAG
RNP24_SCHPO     -----------------------------------------------LFVGNLDFETTDADLKEHFGQVG
PABP_COCIM      -----------------------------------------------LYVGELDPSVTEAMLFELFSSIG
PABP_CANGA      -----------------------------------------------LFIKNLDDSIDDKKLEEEFAPYG
NOP4_YEAST      ---------------------------------------------FSVFVRNVPYDATEESLAPHFSKFG
NOP12_SCHPO     -----------------------------------------------VFVGNLAFEAEEEPLWRYFGDCG
MRD1_ASHGO      ----------------------------------------------RLFLRNILYDATEEDFKQLFSPYG
HNRPQ_RAT       ------------------------LMSGKVKVWGNVGTVEWDPEVMALFVRNLANTVTEEILEKSFSQFG
HNRPQ_MOUSE     ------------------------LMSGKVKVWGNVGTVEWDPEVMALFVRNLANTVTEEILEKSFSQFG
FCA_ARATH       ----------------------------------------------KLFVGSVPRTATEEEIRPYFEQHG
YKX5_SCHPO      -----------------------------------------------IYVGNLPWATSDRNLLDLFTDIG
ROA2_SAGOE      --------------------------------------MEREKEQFRLFIGGLSFQTTEESLRNYYEQWG
ROA2_RAT        -----------------------------------------------LFIGGLSFETTEESLRNYYEQWG
ROA2_PONAB      -----------------------------------------------LFIGGLSFETTEESLRNYYEQWG
ROA2_MOUSE      -----------------------------------------------LFIGGLSFETTEESLRNYYEQWG
ROA2_HUMAN      -----------------------------------------------LFIGGLSFETTEESLRNYYEQWG
RNA15_YEAST     -----------------------------------------------VYLGSIPYDQTEEQILDLCSNVG
RBM28_MOUSE     -------------------------------------------AGLTLFVGRLPPSARSDQLEELFSQVG
PABP_ASPTN      ------------------------------------------PHSASLYVGELDPSVTEAMLYELFSSIG
NOP12_YARLI     -----------------------------------------------VFVGALDFEEQEESLWEAFSSCG
MRD1_KLULA      ----------------------------------------------RLFLRNILYTATEDDFRKLFSPYG
ELAV4_RAT       -----------------------------------------------IFVYNLSPDSDESVLWQLFGPFG
ELAV4_MOUSE     -----------------------------------------------IFVYNLSPDSDESVLWQLFGPFG
ELAV4_HUMAN     -----------------------------------------------IFVYNLSPDSDESVLWQLFGPFG
EIF3G_ASPTN     ---------------------------------------------------NVSELAEEGELRDLFERFG
CELF4_DANRE     ------------------------------------------PEGCNLFIYHLPQEFGDGELMQMFLPFG
SYY_BIFLO       --------------------GKKFGKSEGNAVWLDATMLS--PYKFYQFWINRP-DVEMESLLKAFTFLP
SYY_BIFLI       --------------------GKKFGKSEGNAVWLDATMLS--PYKFYQFWINRP-DVEMESLLKAFTFLP
SYY_BIFLD       --------------------GKKFGKSEGNAVWLDATMLS--PYKFYQFWINRP-DVEMESLLKAFTFLP
SQD_DROME       ----------------------------------------------KLFVGGLSWETTEKELRDHFGKYG
SHEP_DROYA      -----------------------------------------------LYIRGLQQGTTDKDLVNMCAQYG
SHEP_DROSE      -----------------------------------------------LYIRGLQQGTTDKDLVNMCAQYG
SHEP_DROME      -----------------------------------------------LYIRGLQQGTTDKDLVNMCAQYG
SHEP_DROER      -----------------------------------------------LYIRGLQQGTTDKDLVNMCAQYG
RBM34_HUMAN     -----------------------------------------------VFVGNLPYKVEESAIEKHFLDCG
RBM15_HUMAN     -------------------------------------------ANRTLFLGNLDITVTESDLRRAFDRFG
PAB1L_HUMAN     ---------------------------------------------------NLDESIDDERLQKEFSPFG
MRD1_DICDI      ----------------------------------------------RIFVRNLSYSTKEEDLEKVFSKFG
HNRPR_HUMAN     ------------------------LMSGKVKVWGNVVTVEWDPEVMALFVRNLATTVTEEILEKSFSEFG
CELF5_XENTR     ------------------------------------------PEGCNLFIYHLPQEFGDNELTQMFLPFG
U2AF2_MOUSE     ----------------------------------------------KLFIGGLPNYLNDDQVKELLTSFG
U2AF2_HUMAN     ----------------------------------------------KLFIGGLPNYLNDDQVKELLTSFG
U2A2A_WHEAT     ----------------------------------------------RIFVGGLPYYFTEAQVRELLETFG
SXL_MEGSC       -----------------------------------------------LYVTNLSRSITDEQLETIFGKYG
RBMS1_RAT       ----------------------------------------WDQSKTNLYIRGLPPNTTDQDLVKLCQPYG
RBMS1_MOUSE     ----------------------------------------WDQSKTNLYIRGLPPNTTDQDLVKLCQPYG
RBMS1_HUMAN     ----------------------------------------WDQSKTNLYIRGLPPHTTDQDLVKLCQPYG
RBMS1_BOVIN     ----------------------------------------WDQSKTNLYIRGLPPNTTDQDLVKLCQPYG
RBM19_MOUSE     ----------EKQAPTARGPPKSTT------PWQGRTLGENEEEEDRLFVRNLSYTSSEEDLEKLFSAYG
RB15B_MOUSE     -----------------------------------------------LFIGNLDHSVSEVELRRAFEKYG
RB15B_HUMAN     -----------------------------------------------LFIGNLDHSVSEVELRRAFEKYG
EIF3G_YARLI     ---------------------------------------------------NLSEEATDDDLRRMFGKYG
EIF3G_PHANO     ---------------------------------------------------NVSEFAEEQDLRDMFSRYG
EIF3G_DANRE     --------------PVQNKTGKYVLRDGGGESMQPNRRAD-DNATIRVT--NLSEDTRETDLQELFRPFG
DAZLB_XENLA     -----------------------------------------------VFVGGIDITMDEIEIRDFFTRFG
DAZLA_XENLA     -----------------------------------------------VFVGGIDITMDEIEIRDFFTRFG
YG5B_YEAST      -----------------------------------------------IFVGGIAKSLSIGELSFLFSKYG
TRA2_DICDI      ----------------------------------------------------LAPQTEERDLKDEFSRFG
RBMS2_BOVIN     -----------------------------------------------LYIRGLQPSTTDQDLVKLCQSYG
PUF68_DROME     ----------------------------------------------RVYVGSISFELKEDTIRVAFTPFG
FOX1C_MOUSE     PEQPGTEASTQPIAGTQTVPQADEAAQTDNQQLHPSDPTEKQQPK-RLHVSNIPFRFRDPDLRQMFGQFG
EIF3G_COCIM     ---------------------------------------------------NVSELAEEGELRDMFGRFG
SR140_PONAB     -----------------------------------------DPSTTNLYLGNINPQMNEEMLCQEFGRFG
SR140_HUMAN     -----------------------------------------DPSTTNLYLGNINPQMNEEMLCQEFGRFG
SHEP_DROWI      -----------------------------------------------LYIRGLQQGTTDKDLVNMCAQYG
SAP49_SCHPO     -----------------------------------------------LFVGNLDPLVDERVLYDTFSALG
RBM28_HUMAN     -------------------------------------------AGLTLFVGRLPPSARSEQLEELFSQVG
PPIL4_RHIOR     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTRDEDLEMIFSRFG
PAP1B_DICDI     -----------------------------------------------LFINNIDESIDRDLIKEEFAKHG
EIF3G_XENTR     ---------------------------------------------------NLSEDTRETDLQELFRPFG
EIF3G_RAT       ---------------------------------------------------NLSEDTRETDLQELFRPFG
EIF3G_MOUSE     ---------------------------------------------------NLSEDTRETDLQELFRPFG
EIF3G_HUMAN     ---------------------------------------------------NLSEDTRETDLQELFRPFG
EIF3G_BOVIN     ---------------------------------------------------NLSEDTRETDLQELFRPFG
EI3GB_XENLA     ---------------------------------------------------NLSEDTRETDLQELFRPFG
EI3GA_XENLA     ---------------------------------------------------NLSEDTRETDLQELFRPFG
CELF5_HUMAN     ------------------------------------------PEGCNLFIYHLPQEFGDTELTQMFLPFG
SR140_MOUSE     -----------------------------------------DPSTTNLYLGNINPQMNEEMLCQEFGRFG
SHEP_DROVI      -----------------------------------------------LYIRGLQQGTTDKDLINMCAQYG
SHEP_DROMO      -----------------------------------------------LYIRGLQQGTTDKDLINMCAQYG
SHEP_DROGR      -----------------------------------------------LYIRGLQQGTTDKDLINMCAQYG
MK67I_HUMAN     -----------------------------------------------VYVRHLPNLLDETQIFSYFSQFG
IST3_YEAST      -----------------------------------------------IYIGNLNRELTEGDILTVFSEYG
DAZL_MOUSE      -----------------------------------------------VFVGGIDVRMDETEIRSFFARYG
DAZL_MACFA      -----------------------------------------------VFVGGIDVRMDETEIRSFFARYG
DAZL_HUMAN      -----------------------------------------------VFVGGIDVRMDETEIRSFFARYG
DAZL_CHICK      -----------------------------------------------VFVGGIDIRMNEAEIRSYFEQYG
U1SBP_BOVIN     -----------------------------------------------LFVARLNLQTKEEKLKEVFSRYG
SF3B4_CAEEL     -----------------------------------------------IFVGNLDPEVDEKLLYDTFSAFG
RBPF_ANASP      -----------------------------------------------IYVGNLSYEVTQEDISNVFAEYG
RBMS2_MOUSE     -----------------------------------------------LYIRGLQPGTTDQDLVKLCQPYG
RBMS2_HUMAN     -----------------------------------------------LYIRGLQPGTTDQDLVKLCQPYG
RBM5_RAT        ---------------------------------------------------NIAPHTVVDSIMTALSPYA
RBM5_MOUSE      ---------------------------------------------------NIAPHTVVDSIMTALSPYA
RBM5_HUMAN      ---------------------------------------------------NIAPHTVVDSIMTALSPYA
RBM5_BOVIN      ---------------------------------------------------NIAPHTVVDSIMTALSPYA
RB97D_DROME     ----------------------------------------------KLFIGGLAPYTTEENLKLFYGQWG
PPIE_PONAB      -----------------------------------------------LYVGGLAEEVDDKVLHAAFIPFG
PPIE_MOUSE      -----------------------------------------------LYVGGLAEEVDDKVLHAAFIPFG
PPIE_HUMAN      -----------------------------------------------LYVGGLAEEVDDKVLHAAFIPFG
PPIE_BOVIN      -----------------------------------------------LYVGGLAEEVDDKVLHAAFIPFG
NOP12_GIBZE     ----------------------------------------------------------EEGLWRTFSTQG
MK67I_DANRE     -----------------------------------------------LYVGHLPRGLFEPQLKSYFEQFG
EIF3G_MAGGR     ---------------------------------------------------NVSEMAEEQELRDMFERFG
EIF3G_CAEEL     ---------------------------------------------------NLPQEMNEDELRDLFGKIG
SYY_BIFAA       --------------------GKKFGKSEGNAVWLDGTMLS--PYKFYQFWFNRPDSEMEN-LLKAFTFLP
SGN1_YEAST      -----------------------------------------------IFVGNITPDVTPEQIEDHFKDCG
RNPS1_DANRE     ------------------------------------------PKPTKLYLGRLTRNVTKDHIQEIFATYG
RBPA_SYNY3      -----------------------------------------------IYVGNLSYDVSEADLTAVFAEYG
PSPC1_BOVIN     ----------------------------------------------RLFVGNLPTDITEDDFKRLFERYG
MK67I_MOUSE     -----------------------------------------------VYLGHLPSTLSESHIYNYCAQFG
HRB1_YEAST      -----------------------------------------------IFVGNLTYDSTPEDLTEFFSQIG
FOX1C_HUMAN     PEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPK-RLHVSNIPFRFRDPDLRQMFGQFG
DAZL_CALJA      -----------------------------------------------VFVGGIDVRMDETEIRGFFARYG
DAZ4_HUMAN      QHVQSAANPETPNXXXXXXXXXXXXXXXXXXGWV---LPEGKIVPNTVFVGGIDARMDETEIGSCFGRYG
DAZ1_HUMAN      QHVQSAANPETPNXXXXXXXXXXXXXXXXXXGWV---LPEGKIVPNTVFVGGIDARMDETEIGSCFGRYG
U1SBP_RAT       -----------------------------------------------LFVARLNSQTKEEKLKEVFSRYG
U1SBP_HUMAN     -----------------------------------------------LFVARLNLQTKEDKLKEVFSRYG
RU17_XENLA      ----------------------------------ENELKIWDPAFKTLFVARVNYDTTESKLRREFEVYG
RBMS3_PONAB     -----------------------------------------------LYIRGLPPGTTDQDLIKLCQPYG
RBMS3_MOUSE     -----------------------------------------------LYIRGLPPGTTDQDLIKLCQPYG
RBMS3_HUMAN     -----------------------------------------------LYIRGLPPGTTDQDLIKLCQPYG
PUF60_RAT       -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
PUF60_PONAB     -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
PUF60_MOUSE     -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
PUF60_HUMAN     -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
PUF60_BOVIN     -------------------------------------LAEEARAFNRIYVASVHQDLSDDDIKSVFEAFG
NONO_RAT        ------PIPANGQQASSQNEGLTIFRKPGEKTFTQRS---------RLFVGNLPPDITEEEMRKLFEKYG
NONO_MOUSE      ------PIPANGQQASSQNEGLTIFRKPGEKTFTQRS---------RLFVGNLPPDITEEEMRKLFEKYG
MRD1_YEAST      ----------------------------------------------RLFLRNILYTSKEEDFRKLFSPFG
LARK_DROME      ----------------------------------------------KIFVGNLTDKTRAPEVRELFQKYG
HNRPD_RAT       ---------------------------------------------WKMFIGGLSWDTTKKDLKDYFSKFG
HNRPD_MOUSE     ---------------------------------------------WKMFIGGLSWDTTKKDLKDYFSKFG
HNRPD_HUMAN     ---------------------------------------------WKMFIGGLSWDTTKKDLKDYFSKFG
G3BP1_BOVIN     ------------NVPPQRGPRP--VREAGEQGDVEPRRIVRHPDSHQLFIGNLPHEVDKSELKDFFQNYG
EIF3G_LODEL     ----------------------------------------------------------DEDMLRLFARFG
EIF3G_CANAL     ----------------------------------------------------------DEDMLRLFAKFG
DAZ3_HUMAN      -----------------------------------------------VFVGGIDARMDETEIGSCFGRYG
DAZ2_HUMAN      -----------------------------------------------VFVGGIDARMDETEIGSCFGRYG
RNPS1_XENTR     ----------------------------------------------KVHIGRLTRNVTKDHILEIFSTYG
RNP1B_XENLA     ----------------------------------------------KVHIGRLTRNVTKDHILEIFSTYG
RNP1A_XENLA     ----------------------------------------------KVHIGRLTRNVTKDHILEIFSTYG
RAVR1_HUMAN     --------------------------------------VQLQPTDALLCVANLPPSLTQQQFEELVRPFG
PPIL4_NEUCR     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTTDEDLELIFSRFG
NOP15_YEAST     ----------------------------------------------------------EKELSKYFAQFG
MUG28_SCHPO     -----------------------------------------DPCN--LFVKNLDDNIVGNTLEELFSKFG
U2A2A_NICPL     ATLG----PSQPSPNNLAAVGSTPGSSGG---------LEGPD---RIFVGGLPYYFTESQIRELLESFG
SFRS2_RAT       ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_PIG       ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_PANTR     ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_MOUSE     ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_HUMAN     ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_CHICK     ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFRS2_BOVIN     ---------------------------------------------------NLTYRTSPDTLRRVFEKYG
SFR2B_HUMAN     ---------------------------------------------------NLTYRTSPDSLRRVFEKYG
RRP2_SPIOL      ----------------------------------------------RLYVGNIPRNLNNDELRTIVEEHG
PPIL4_USTMA     ----------------------------------DLPFAEIRPPENILFVCKLNPVTRSDDLELIFSRFG
NOP12_CANAL     -----------------------------------------------IFVGNLDFEEKEETLWKYFNSKQ
HRP65_CHITE     ----------------------------------------------RLYIGNLTSDVTEEELKELFSPYG
G3BP1_PONAB     ------------NIPPQRGPRP--IREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYG
G3BP1_HUMAN     ------------NIPPQRGPRP--IREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYG
EIF3G_CRYNE     ------------------------------------------------------------ALFQPFAKNG
EIF3G_CHAGB     ---------------------------------------------------NVSEMAEEQELRDMFERFG
EIF3G_ASHGO     ---------------------------------------------------------------KLLSPFP
DAZL_XENTR      -----------------------------------------------VFVGGIDITMDEMAIGNLFEKYG
SPEN_DROME      ----------------------------------EAELDEYHPKSTRLFIGNLEKDITAGELRSHFEAFG
RBM9_RAT        ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
RBM9_MOUSE      ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
RBM9_HUMAN      ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
RBM9_BOVIN      ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
PU60B_DANRE     -------------------------------------LAEEARAYNRIYVASIHPDLSDDDIKSVFEAFG
PSPC1_RAT       ----------------------------------------------RLFVGNLPTDITEEDFKRLFERYG
PSPC1_MOUSE     ----------------------------------------------RLFVGNLPTDITEEDFKRLFERYG
PSPC1_HUMAN     ----------------------------------------------RLFVGNLPTDITEEDFKRLFERYG
PSPC1_CHICK     ----------------------------------------------RLFVGNLPTDITEEDFKRLFERYG
PPIL4_SCHPO     -----------------------------------------------LFVCKLNPVTQDEDLELIFSRFG
PPIL4_MOUSE     -----------------------------------------------LFVCKLNPVTTDEDLEIIFSRFG
PPIL4_HUMAN     -----------------------------------------------LFVCKLNPVTTDEDLEIIFSRFG
NCBP2_ARATH     -----------------------------------------------VYIGNVSFYTTEEQLYELFSRAG
FOX1A_PONAB     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
FOX1A_MOUSE     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
FOX1A_MACFA     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
FOX1A_HUMAN     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
EIF3G_NEUCR     ---------------------------------------------------NVSEMAEEQELRDMFERFG
EIF3G_NEMVE     ---------------------------------------------------NLSEETRESDLQELFRPLG
U2AF2_DROME     ----------------------------------------------KIFIGGLPNYLNDDQVKELLLSFG
U1SBP_MOUSE     -----------------------------------------------LFVARLNLQTKEEKLKEVFSRYG
NUCL_XENLA      -----------------------------------------------LFVRGLSEDTTEETLKEAFD---
G3BP1_MOUSE     KVPASQPRPESKNIPPQRGPRP--IREAGEPGDVEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQNFG
FUSIP_MOUSE     ------------------------------------------PPNTSLFVRNVADDTRSEDLRREFGRYG
FUSIP_HUMAN     ------------------------------------------PPNTSLFVRNVADDTRSEDLRREFGRYG
FOX1_CAEEL      ----------------------------------------------RLHVSNIPFRFRDPDLKTMFEKFG
FOX1A_DANRE     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
DAZL_DANRE      -----------------------------------------------LFVGGIDMKVDENEIREFFAKYG
RAVR1_RAT       --------------------------------------VQLQPTDALLCVANLPPSLTQAQFEELVRPFG
RAVR1_MOUSE     --------------------------------------VQLQPTDALLCVANLPPSLTQAQFEELVRPFG
NUCL_RAT        -----------------------------------------------LFVKGLSEDTTEETLKESFE---
NUCL_PONAB      -----------------------------------------------LFVKGLSEDTTEETLKESFD---
NUCL_MOUSE      -----------------------------------------------LFVKGLSEDTTEETLKESFE---
NUCL_MESAU      -----------------------------------------------LFVKGLSEDTTEETLKESFE---
NUCL_MACFA      -----------------------------------------------LFVKGLSEDTTEETLKESFD---
NUCL_HUMAN      -----------------------------------------------LFVKGLSEDTTEETLKESFD---
NUCL_CHICK      -----------------------------------------------LFVRGLSEDTTEETLRESFEGSI
NOP12_DEBHA     -----------------------------------------------IFVGNLDFEEKEETLWRYFNSKT
MK67I_XENTR     -----------------------------------------------IYIGHIPRALYEPQLREYFSQFG
YQO4_CAEEL      -----------------------------------------------VFIGNVDFNSTIEEIEEHFKGCG
U2A2B_NICPL     ATLG----PSQPN-PNLNSPG-----SAGGLEGPD-----------RIFVGGLPYYFTEAQIRELLESFG
U2A2B_ARATH     ----------------------------------------------RIFVGGLPYYFTEVQIRELLESFG
U2A2A_ARATH     ATLG----PSQPSPHNLAAVGLTPGASGG---------LEGPD---RIFVGGLPYYFTESQVRELLESFG
TRA2B_RAT       ---------------------------------------------------------TERDLREVFSKYG
TRA2B_MOUSE     ---------------------------------------------------------TERDLREVFSKYG
TRA2B_HUMAN     ---------------------------------------------------------TERDLREVFSKYG
TRA2B_BOVIN     ---------------------------------------------------------TERDLREVFSKYG
TRA2A_MOUSE     ---------------------------------------------------------TERDLREVFSRYG
TRA2A_HUMAN     ---------------------------------------------------------TERDLREVFSRYG
RNPS1_RAT       ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RNPS1_PONAB     ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RNPS1_MOUSE     ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RNPS1_MACFA     ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RNPS1_HUMAN     ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RNPS1_BOVIN     ------------------------------------------PKPTKVHIGRLTRNVTKDHIMEIFSTYG
RBM18_PONAB     ----------------------------------------------RLWIGNLDPKITEYHLLKLLQKFG
RBM18_MOUSE     ----------------------------------------------RLWIGNLDPKITEYHLLKLLQKFG
RBM18_HUMAN     ----------------------------------------------RLWIGNLDPKITEYHLLKLLQKFG
MK67I_RAT       -----------------------------------------------VYLGHLPSTLSESHIYDYCAQFG
EIF3G_DEBHA     --------------------------------------------------------IVDEDMLRLLGRYG
TADBP_CHICK     ----------------------------------------------------LPWKTTEQDLKEYFSTFG
ROAA_MOUSE      ----------------------------------------------KMFVGGLSWDTSKKDLKDYFTKFG
ROAA_HUMAN      ----------------------------------------------KMFVGGLSWDTSKKDLKDYFTKFG
RBP1_DROME      ---------------------------------------EWDLA-CKVYVGNLGSSASKHEIEGAFAKYG
NONO_PONAB      -------IPANGQQASSQNEGLTIFRKPGEKTFTQRS---------RLFVGNLPPDITEEEMRKLFEKYG
NONO_HUMAN      -------IPANGQQASSQNEGLTIFRKPGEKTFTQRS---------RLFVGNLPPDITEEEMRKLFEKYG
MRD1_YARLI      ----------------------------------------------RLFLRNLLYTAKEEDFRQLFSQYG
HNDLB_XENLA     ----------------------------------------------KVFVGGLSPETTEEQIKQYFGGFG
EIF3G_SCLS1     ---------------------------------------------------NVSEMAEEQELRDMFERFG
EIF3G_BOTFB     ---------------------------------------------------NVSEMAEEQELRDMFERFG
TADBP_XENTR     ----------------------------------------------------LPWKTTEQDLKDYFSTFG
SFRS6_HUMAN     ----------------------------------------------RVYIGRLSYNVREKDIQRFFSGYG
SCE3_SCHPO      DAGYNAPVRSPPESRREGGMGSGYQR--------DAIPIPSEPP-FTAHVGNLSFDLTENDLGDFFGE--
RSP1_CAEEL      ----------------------------------------------RIYIGRLTSRVSEKDIEHFFRGYG
RBPD_ANASP      -----------------------------------------------IYVGNLSYRATEADLKAVFADYG
RBM18_XENLA     ----------------------------------------------RLWIGNVDPKITEYHLLKLLQKFG
RBM18_BOVIN     ----------------------------------------------RLWIGNLDPKITEYHLLRLLQKFG
PPIE_DROME      -----------------------------------------------IYVGGLADEVTERLLNNAFIPFG
TCG1_SCHPO      ---------------------------------------------FRVFVGRLSTSTKKSEIRSLFETVG
SFPQ_MOUSE      ----------------------SLLRRPGEKTYTQRC---------RLFVGNLPADITEDEFKRLFAKYG
SFPQ_HUMAN      ----------------------SLLRRPGEKTYTQRC---------RLFVGNLPADITEDEFKRLFAKYG
RBM9_XENTR      ------------------------------------------PTPKRLHVSNIPFRFRDPDLRQMFGQFG
RBM47_MOUSE     ---SSTKVPGVAGAPNEAATGYTMVQENGQRKYXXXXXXXXXXXXQRVFVGKIPRDVYEDELVPVFETVG
PPIL4_GIBZE     ----------------------------------DLPFAEVKPPENVLFVCKLNPVTGDEDLELIFGRFG
NELFE_DROME     -------------------------------------------------------KVTEDFLKKTFNDYG
MK67I_XENLA     -----------------------------------------------IYIGHIPKSLIEPQLQEYFNQFG
HNRDL_RAT       -----------------------------------------DPSSFKMFIGGLSWDTSKKDLTEYLSRFG
FOX1L_DANRE     ----------------------------------------------RLHVSNIPFRFRDPDLRQMFGQFG
EIF3G_YEAS7     SEEKAGQVGGAGSIPGQYVPPRAGARDPSSDAYRDSRERD-DMCTLKIMQVN---ENADENSLREELLFP
DAZ1_CAEEL      ----------------------------------------------RIFVGGFPTSTTETELREHFEKFF


                         +         .         .         .         .         *         .:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPxxxxxxxxxxxx
RBM42_XENLA     SFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRATREMNGKYVGSRPIKLRKSQWKDR-------------
RBM42_RAT       SFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDR-------------
RBM42_MOUSE     SFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDR-------------
RBM42_HUMAN     SFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDR-------------
RBM42_BOVIN     SFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDR-------------
YDB2_SCHPO      SLVKTKVVRD-REGKTRGFGFVSFKDSDQFLKAWREKNGKYIGSRPVKLSRATSDVKP------------
RBM42_XENTR     SFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSQWKDR-------------
RBM42_DANRE     SFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGRYVGSRPIKLRKS------------------
TIA1_MOUSE      RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQI-----------------------
TIA1_HUMAN      RISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQI-----------------------
TIAR_MOUSE      KISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQI-----------------------
TIAR_HUMAN      KISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQI-----------------------
PUB1_YEAST      SYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA------------------
YG41_SCHPO      SCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQICGDRPI-----------------------
NSR1_YEAST      EVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL---------------------
RMXL3_PANTR     HIIKVFLIKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYLDGKAIMVAQTI-----------------
CIRBP_XENLA     RISEVVVVKDRETKRSRGFGFVTFENVDDAKDAMMAMNGKSVDGRQIRVDQA------------------
GRPA_MAIZE      EILDSKVITDRETGRSRGFGFVTFSSENSMLDAIENMNGKELDGRNITVNQAQS----------------
CIRBP_PONAB     QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
CIRBP_HUMAN     QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
MIP6_YEAST      SFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKE----------------------------------
GRP1_DAUCA      DITDSKIINDRETGRSRGFGFVTFKDEKSMRDAIEGMNGQELDGRNITVNEAQS----------------
RMXL3_HUMAN     HIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYLDGKAIMVAQTI-----------------
NAM8_YEAST      STSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAI-----------------------
PABP_MAGGR      DVTSSSLARDQETGKSRGFGFVNFTSHEDASKAVQELNEKEFHGQNLYVGRA------------------
GRP8_ARATH      DVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQS----------------
CIRBP_RAT       QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
CIRBP_MOUSE     QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
CIRBP_CRIGR     QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA------------------
PABP4_HUMAN     KTLSVKVMRDPNG-KSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKV--------------
GRP2_SORBI      QVIDSKVITDRETGRSRGFGFVTFSSEQSMLDAIENMNGKELDGRNITVNQAQS----------------
GRP10_BRANA     EVIDSKIINDRETGRSRGFGFVTFKDEKSMKDAIDEMNGKELDGRTITVNEAQS----------------
CSTFT_MOUSE     SVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
CSTFT_HUMAN     SVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
ROC3_ARATH      KVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAI--RVNVAEERP------------
RBM24_DANRE     EIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDIDGRYLGAKPRVMQPGFT----------------
GRP1_SINAL      EVLDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEA------------------
TSAP1_PONAB     SCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVLGSKPVRLSVAI-----------------
TSAP1_HUMAN     SCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVLGSKPVRLSVAI-----------------
TSAP1_BOVIN     SCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAILGSKPVRLSVAI-----------------
RBM39_PONAB     RIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPM-----------------------
RBM39_MOUSE     RIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPM-----------------------
RBM39_HUMAN     RIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPM-----------------------
RBM38_XENLA     DIDEAVVITDRQTAKSRGYGFVTMSDRAAAERACKDIDGRYLGAKPRNLQSAFT----------------
PABP3_ARATH     NVTSSKVMLNPQG-MSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALA------------------
NGR1_YEAST      SVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIEMSGKW-----------------------------
HNRPG_PANTR     RIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA------------------
HNRPG_HUMAN     RIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA------------------
RBM38_XENTR     DIDEAVVITDRQTGKSRGYGFVTMSDRAAAERACKDIDGRYLGAKPRNLQSAFT----------------
RBM23_HUMAN     KIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPM-----------------------
PAP1L_HUMAN     VITSAKVMTEGG--HSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALA------------------
RBM24_XENTR     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
RBM24_CHICK     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
RB24B_XENLA     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
RB24A_XENLA     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
PAB4L_HUMAN     SISRVKVMQEEG--QSKGFGLICFSSPEDATKAMTEMNGRILGSKPLSIALA------------------
HNRPG_BOVIN     RISEVLLMKDRETNKSRGFAFITFESPADAKAAVRDMNGKSLDGKAIKVAQA------------------
GRP2_ARATH      DVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA------------------
RBM24_HUMAN     EIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
PABP5_ARATH     NVTSCKVMMNSQG-LSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALA------------------
HNRGT_HUMAN     RIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQA------------------
TSAP1_RAT       SCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKRALTECQGAVLGCKPVRLSVAI-----------------
RBM38_CHICK     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
HNRPG_RAT       RIVEILLMKDRETNKSRGFAFVTFESPADAKDVARDMNGKSLDGKAIKVEQA------------------
GRP7_ARATH      DVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA------------------
CSTF2_PONAB     PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
CSTF2_MOUSE     PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
CSTF2_HUMAN     PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
CSTF2_BOVIN     PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASE---------------
RU17_YEAST      EIEKIRIVKDKITQKSKGYAFIVFKD-----PISSKMAFKEIGVH-------------------------
ROA3_RAT        TLTDCVVMRDPQTKRSRGFGFVTYSCVEE-----------------------------------------
ROA3_MOUSE      TLTDCVVMRDPQTKRSRGFGFVTYSCVEE-----------------------------------------
ROA3_HUMAN      TLTDCVVMRDPQTKRSRGFGFVTYSCVEE-----------------------------------------
TSAP1_MOUSE     SCRGGKVVLDP-TGVSKGYGFVKFTDELEQKRALTECQGAVLGCKPVRLSVAI-----------------
ROC2_ARATH      KVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA--EARP------------
RBM38_HUMAN     DIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD----------------------------------
PABP3_HUMAN     TITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
MSIR6_DROME     DISEAMVMKDPTTRRSRGFGFVTFSDPNSLTQGTHELDGKKVDPKVAFPRRA------------------
GRP2_SINAL      ELVDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEA------------------
EPAB_XENTR      TITSAKVMTEGG--HSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALA------------------
ZCRB1_RAT       KVVKVTIMKDKDTRKSKGVAFILFLDKDSALNCTRAINNKQL----------------------------
ZCRB1_MOUSE     KVVKVTIMKDKDTRKSKGVAFILFLDKDSALNCTRAINNKQL----------------------------
YOCE_SCHPO      PIKHAVVVTNPETGENRGYGFVTFSMLEDAQRAAKELKNKKL--HGRILR--------------------
ROC1_NICSY      KVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAI--RVSPAEARP------------
ROC1_ARATH      KVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA--EARP------------
PABP_ASPNC      EITSATLSRDQEG-KSRGFGFVNFSTHESAQAAVEEMNDKEIRSQKLYVGRA------------------
PABP2_ARATH     TVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQEL---------------------------------
MSI2H_MOUSE     EIRECMVMRDPTTKRSRGFGFVTFAD--------------------------------------------
MSI2H_HUMAN     EIRECMVMRDPTTKRSRGFGFVTFAD--------------------------------------------
HNRPG_MOUSE     RIVEIILMKDRETNKSRGFAFVTLESPADAKDAARDMNGKSLDGKAIKVEQA------------------
ROA1_CAEEL      TVTKSEIILDKATQKPRGFGFVTFDD--------------------------------------------
RO31_XENLA      KLTDCVVMRDPQTKRSRGFGFVTYSCVEE-----------------------------------------
PABP_NEOFI      QVASIRVCRDAVTRRSLGYAYVNYNNTADGERALEDLNYTLIKGKP------------------------
PABP_CRYNE      TITSSKVMRDD-SGVSRGFGFVCYSSPDEATKAVSEMNGKMIGTKPLYVALA------------------
HNRGT_MACFA     RIVEVLLMKDRETNKSRGFAFVTFESPANAKAAARDMNGKSLDGKAIKVAQA------------------
ROC3_NICSY      KVVSARVVFDRESGRSRGFGFVTMSSEAEMSEAIANLDGQTLDGRTIRVNAA--EERP------------
ELAV_DROVI      AVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGYTMGN--------------------------
ELAV_DROME      AVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGYTMGN--------------------------
ZCRB1_HUMAN     KVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQL----------------------------
RO32_XENLA      KLTDCVVMRDPQTKRSRGFGFVTYSCVEE-----------------------------------------
EPABB_XENLA     TITSTKVMTEGG--HSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALA------------------
ZCRB1_XENLA     KVVKVTILKDKDSRKSKGVSFVLFLDKESAQNCVRGLNNKQL----------------------------
ZCRB1_DANRE     KVVKVTIVKDKHTRMSKGVAFVLFLDRESAYNCSRSLNNKQL----------------------------
RBY1E_HUMAN     PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQA------------------
RBY1D_HUMAN     PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQA------------------
RBY1B_HUMAN     PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQA------------------
RBY1A_HUMAN     PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQA------------------
PABP_KLULA      TITSARVMRDQE-GNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPL-----------------------
PABPB_XENLA     SITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
PABPA_XENLA     PALSVKVMTDDNG-KSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRAQKKV--------------
PABP5_PONPY     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPL-----------------------
PABP5_PANTR     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPL-----------------------
PABP5_MACMU     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRVVGSKPL-----------------------
PABP5_HYLLA     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPL-----------------------
PABP5_HUMAN     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPL-----------------------
PABP5_GORGO     SISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPL-----------------------
PABP1_RAT       PALSVKVMTDE-SGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKV--------------
PABP1_PONAB     TITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
PABP1_MOUSE     PALSVKVMTDE-SGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKV--------------
PABP1_HUMAN     TITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
PABP1_BOVIN     TITSAKVMMEGG--RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA------------------
U1SBP_XENLA     DIKRIRLVRDFITGFSKGYAFIEYKQENAIMKAHRDANKLVIDQREVFV---------------------
TSP1L_DANRE     SCKGAKVVTDPYGN-SRGYGFVKFSDENEQKKALEEFQASGLGGKPIRISIAVNK---------------
ROC1_SPIOL      KVVSARVVSDRETGRSRGFGFVTMSSESEVNDAIAALDGQTLDGRAV--RVNVAEERP------------
ROC1_NICPL      KVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAI--RVSPAEARP------------
PABP_SCHPO      TITSAKIMTDEQG-KSKGFGFVCYTTPEEANKAVTEMNQRMLAGKPLYVALA------------------
GRP1_SORBI      EVLESKIILDRETQRSRGFGFVTFSTEEAMRSAIEGMNGKELDGRNITVNEAQS----------------
GAR2_SCHPO      DIQSIRLPTDPQSGRLKGFGYVTFSD-IDSAKKCVEMNGHFIAGRPCRL---------------------
EPABA_XENLA     TITSAKVMTEGG--HSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALA------------------
ZCRB1_BOVIN     KVVKVTIMKDKDTRRSKGVAFILFLDKDSAQNCTRAINNKQL----------------------------
TSAP1_DANRE     TVVKIRLIRDKITGKNAGYGFVELADDTAVERCLRKVNGK------------------------------
RBM45_RAT       DIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLG---------------------------
PABP_DEBHA      SITSARVMVDE-TGKSKGFGFVCFSSPEEATKAITEMNQRMIYGKPLYVALA------------------
RBM45_HUMAN     DIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLG---------------------------
PAP1A_DICDI     TITSAIVMKDDKATTSKGFGFVCYTAPDEATRAVTEMNGRMIGTKPLYIRRAQLEMQ-------------
SF3B4_RAT       VIQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYA------------------
SF3B4_MOUSE     VIQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYA------------------
SF3B4_HUMAN     VIQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYA------------------
ROA1_DROME      NIVDVVVMKDPRTKRSRGFGFITYS---------------------------------------------
RBM3_MOUSE      PISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGESLDGRQI-----------------------
PABP_EMENI      EITSATLSRDSEG-KSRGFGFVNFSTHESAQAAVEEMNDKEVRSQKLYVGRA------------------
HRP1_YEAST      TVTDLKIMKDPATGRSRGFGFLSFSSVDEVVKTQHILDGKVI----------------------------
RT19_ARATH      GVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQ------------------------------
ROC5_NICSY      GFMSAKVIYDRSSGRSRGFGFITFSSAEAMNSALDTMNEVELEGRPLRLNVA------------------
ROA1_RAT        TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
ROA1_PANTR      TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
ROA1_MOUSE      TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
ROA1_HUMAN      TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
ROA1_BOVIN      TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
RBM3_HUMAN      PISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI-----------------------
RBM38_MOUSE     DIEEAVVITDRQTGKSRGYGFVT-----------------------------------------------
RA1L3_HUMAN     TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
RA1L2_HUMAN     TLTDCVVMRDPNTKRSRGFGFVTYATVEE-----------------------------------------
PPIL4_ASPOR     TILSCEVIRDKRTGDSLQYAFIEFENQKDCEQAYFKMQGVLIDDHRI-----------------------
MSI1H_RAT       EVKECLVMRDPLTKRSRGFGFVTFMDGVDLAQSRHELDSKTIDPKVAFPRRAQPKM--------------
MSI1H_MOUSE     EVKECLVMRDPLTKRSRGFGFVTFMDGVDLAQSRHELDSKTIDPKVAFPRRAQPKM--------------
MSI1H_HUMAN     EVKECLVMRDPLTKRSRGFGFVTFMDGVDLAQSRHELDSKTIDPKVAFPRRAQPKM--------------
CSX1_SCHPO      SCTSAKIIVDPVTGLSRKYGFVRFSSEKEQQHALMHMQGYLCQGRPLRISVASPKSR-------------
BOLL_MOUSE      SVKEVKIVND-RAGVSKGYGFITFETQEDAQKILQEAE--------------------------------
BOLL_MACFA      SVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQEAE--------------------------------
BOLL_HUMAN      SVKEVKIVND-RAGVSKGYGFVTFETQEDAQKILQEAE--------------------------------
YDC1_SCHPO      TVTHVRIMREPVTKASRGFGFLSFSTVEE-----------------------------------------
SXL_CHRRU       NIVQKNILRDKLTGKPRGVAFVRFNKREE-----------------------------------------
RU17_SCHPO      PIERIRVVRNKVTGKSMGYAFVVFERERDLKVAYKASAGLMLNGRRIVV---------------------
ROC4_NICSY      KVVSARVVYDRETGRSRGFGFVTMASEAEMSDAIANLDGQSLDGRTI-----------------------
RBY1F_HUMAN     PISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGTSLHGKAIKVEQA------------------
PPIL4_ASPFU     PILSCEVIRDKRTGDSLQYAFIEFENQKDCEQAYFKMQGVLIDDHRI-----------------------
PABP_YEAST      TITSAKVMRTENG-KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL-----------------------
PABP_ASPFU      EITSATLSRDQEG-KSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRA------------------
PABP_ASHGO      TITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL-----------------------
MRD1_CANAL      ALEEVHIAIDTRTGKSKGFLYVQFLKKEDATRAYRSL---------------------------------
CELF1_XENTR     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
CELF1_RAT       NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
CELF1_PONAB     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
CELF1_MOUSE     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
CELF1_HUMAN     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
CELF1_CHICK     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
C3H42_ARATH     EIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGALV----------------------------
BOULE_DROME     TVKSTKIIVD-RAGVSKGYGFVTFETEQE-----------------------------------------
ROA1_MACMU      TLTDCVVMRDPNTKRSRGFGFVTYATVE------------------------------------------
PSPC1_DANRE     DAKEVFINRD------RGFGFIRLETRTLAEIAKAELDGTVLGNRPIRIRFA------------------
PPIL4_EMENI     KILSCEVIRDKRTGDSLQYAFIEFESQKDCEQAYFKMQGVLIDDHRI-----------------------
MRD1_USTMA      TVKQVHIPLDKQTKASKGLAFVSFSDPAHALAAYRTFQGRLLHLLPAVNKDALAE---------------
CELF1_DANRE     NVISAKVFIDKQTNLSKCFGFVSYDNPVSSQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
C3H25_ORYSJ     EVVDVNLVRDKGTGKSKGFAFLAYEDQRSTILAVDNLNG-------------------------------
YHKF_SCHPO      EVLDCTVMRDSTTGRSRGFGFLTFKN--------------------------------------------
ROA1_SCHAM      EIVDVVVMKDPKTKRSRGFGFITYS---------------------------------------------
RBPE_ANASP      SVTRVQLPTDRETGRVRGFGFVEMESSAAEDAAIQALDG-------------------------------
RBMX2_HUMAN     EIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNG-------------------------------
PABP_YARLI      TITSAKVMVDE-AGKSKGFGFVCYSSPEEATKAVTEMNHRLVAGKPL-----------------------
PABP_NEUCR      EVTSSSLARDQEG-KSRGFGFVNFTTHEAAAQAVDELNGKDFRGQDLYVGRA------------------
PABP_CHAGB      DVTSSSLARDSEG-KSRGFGFVNFTTHECAAKAVEELNGKEFRGQDLYVGRA------------------
DAZP1_XENLA     EVVDCVIMKDKTTNQSRGFGFVKFKD--------------------------------------------
DAZP1_MOUSE     EVVDCVIMKDKTTNQSRGFGFVKFKD--------------------------------------------
DAZP1_HUMAN     EVVDCVIMKDKTTNQSRGFGFVKFKD--------------------------------------------
CELF3_DANRE     NVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKKVQLKRPKDANRP------------
CEL3B_XENLA     NVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKKVQLKRPKDANRP------------
CEL1B_XENLA     NIVSAKVFIDKQTNLSKCFGFISYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
SXL_MUSDO       NIVQKNILRDKLTGRPRGVAFVRFNKREE-----------------------------------------
ROC2_NICSY      NVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAI-----------------------
RBMX2_MOUSE     EIVNINLVRDKKTGKSKGFCFLCYEDQRSTVLAVDNFNG-------------------------------
RBM45_MOUSE     DIQDIWVVRDKHTKESKGVAFVKFARSSQACRAMEEMHGQCLG---------------------------
PABP_PICST      TITSARVMVDE-TGKSKGFGFVCFSSPEEATKAITEMNQRMFFGKPLYVALA------------------
CELF2_DANRE     NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CEL3A_XENLA     NVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKKVQLKRPKDANRP------------
CEL1A_XENLA     NVVSSKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKKVQLKRSKNDSKP------------
RU17_DROME      PIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLV---------------------
ROC2_NICPL      NVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNG-------------------------------
RO22_XENLA      KIESTEIITDKQSGKKRGFGFVTFNDHDPVDKIVLQ---KYINGHNAEVRKALSK---------------
PES4_YEAST      SFVSAKVCLDSVTKKSLGHGYLNF----------------------------------------------
PABP_PICGU      TITSARVMVDD-AGKSKGFGFVCFSSPEEATKAITEMNQRMIQGKPLYVALA------------------
PABP_PHANO      QVASIRVCRDAVTRRSLGYAYVNYNSSEDGEKALEELNYTVIKGKP------------------------
MRD1_SCHPO      QLEQVHMPIDKKTNNPKGFAYIDFHDADDAVRAYLELDAK------------------------------
MK67I_BOVIN     TVTRFRLSRSKKTGNSKGYGFVEF-ESEDVAKIAAETMNNYL----------------------------
CELF2_XENTR     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_XENLA     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_RAT       NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_PONAB     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_MOUSE     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_HUMAN     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
CELF2_CHICK     NVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKKVQLKRSKNDSKP------------
RBY1B_MOUSE     PVARVILMRDRETKKSRGFAFLTFRRPADAKNAVKEMNGVILDGKRIKVKQA------------------
RBM19_HUMAN     PLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQ------------------------------
RB87F_DROME     NIVDVVVMKDPKTKRSRGFGFITYS---------------------------------------------
NOP12_KLULA     DIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKA-------------------------------------
MRD1_ASPFU      KIEEIHVAFDTRSTTSKGFAYVQYIEPDAAVQAYKELDGKH-----------------------------
ELAV3_MOUSE     DIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNG-------------------------------
ELAV3_HUMAN     DIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNG-------------------------------
CTF1_SCHPO      PVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRKLNNSELGPRKI-----------------------
CELF3_MOUSE     HVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKKVQLKRPKDANRP------------
CELF3_HUMAN     HVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKKVQLKRPKDANRP------------
CELF3_BOVIN     HVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKKVQLKRPKDANRP------------
ROA1_XENLA      TLTDCVVMRDPNSKRSRGFGFVTY----------------------------------------------
RBPB_ANASP      SVKRVQLPVDRETGRVRGFGFVEMSDAEE-----------------------------------------
PAP1M_HUMAN     PILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPV-----------------------
PABP_USTMA      TVASIRVCRDAVTRRSLGYAYVNFLNAADGERAMEQLNYSLIRNRP------------------------
NOP12_CANGA     SIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALLLNEKPMISQNEHLKKRKLRVTR-------------
ELAV1_HUMAN     EVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTI-----------------------
SXL_DROSU       SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPGSQPLSVRLA------------------
SXL_DROME       SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPGSQPLSVRLA------------------
RU17_XENTR      PIKRIHMVYNKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV---------------------
RSP4_CAEEL      DIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLV----------------------------
RO21_XENLA      TLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
RBY1A_MOUSE     PVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEMNGVILDGKRIKVKQA------------------
PABP_ASPCL      QVASIRVCRDAVTRRSLGYAYVNYNNTADGERALEDLNYTLIKGKP------------------------
NOP12_YEAST     DIEYVRIIRDSKTNMGKGFAYVQFKD--------------------------------------------
HNRPQ_HUMAN     KLE--------RVKKLKDYAFIHFDERDGAVKAMEEMNGK------------------------------
ELAV2_RAT       AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
ELAV2_PONAB     AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
ELAV2_MOUSE     AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
ELAV2_HUMAN     AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
CELF6_MOUSE     AVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKKVQLKRPKDANRP------------
CELF6_HUMAN     AVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKKVQLKRPKDANRP------------
ROA2_BOVIN      KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
RB27C_DROME     KVTEVVIMYDQEKKKSRGFGFLSFEE--------------------------------------------
PABP_CANAL      TITSAKVMVDE-AGKSKGFGFVCFTTPEEATKAITEMNTRMINGKPLYVALA------------------
PABP_ASPOR      EITSATLSRDQEG-KSRGFGFVNFSTHESAQAAVDEMNEKEIRTQKLYVGRA------------------
PABPX_ARATH     KIVSLAIAKDEN-RLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRA------------------
NOP13_YEAST     DIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDKSCRKIAGRPL-----------------------
EIF3G_NEOFI     RVTRVFLARDRETQRAKGFAFISFADRTDAARACEKMDG--FGYRHLILR--------------------
EIF3G_ASPOR     RVTRVFLARDRETQRAKGFAFISFADRSDAARACEKMDG--FGYRHLILR--------------------
EIF3G_ASPNC     RVTRVFLARDRETQRAKGFAFISFADRSDAARACEKMDG--FGYRHLILR--------------------
EIF3G_ASPFU     RVTRVFLARDRETQRAKGFAFISFADRTDAARACEKMDG--FGYRHLILR--------------------
EIF3G_ASPFC     RVTRVFLARDRETQRAKGFAFISFADRTDAARACEKMDG--FGYRHLILR--------------------
SXL_CERCA       MIVQKNILRDKLTGKPRGVAFVRFNKREE-----------------------------------------
RU17_MOUSE      PIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV---------------------
RU17_HUMAN      PIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV---------------------
RU17_BOVIN      PIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV---------------------
ROA0_HUMAN      TVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAA------------------------------------
RBPA_ANASP      TVKRVQLPTDRETGQPRGFGFV------------------------------------------------
PABP_LODEL      TITSSKVMVDD-AGKSKGFGFVCFSTPEEATKAITEMNQRMVNGKPLYVALA------------------
PABP_DROME      NITSAKVMTDEEG-RSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALA------------------
NOP12_ASHGO     PIEYVRIVRDPKTNVGKGFAYVQFAD--------------------------------------------
MRD1_EMENI      KIEEIHVAFDTRFTTSKGFAYVQYADPDAAVEAYRNLDGK------------------------------
MRD1_CANGA      ELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL---------------------------------
IST3_SCHPO      EPVDINLVRDKETGKSKGFAFLKYED--------------------------------------------
ELAV1_MOUSE     AVTNVKVIRDFNTNKCKGFGFVTMTNYEESAMAIASLNGYRLG---------------------------
EIF3G_PICST     PLQRVTLVRNRETGDSRGFAYVSFITEDMAQRALDALNGK--GYHSLIL---------------------
EIF3G_EMENI     RVTRVFLARDRETQRAKGFAFISFADRSDAARACDKMDG--FGYRHLILR--------------------
EIF3G_ASPCL     RVTRVFLARDRETQRAKGFAFISFADRSDAARACEKMDG--FGYRHLILR--------------------
RSD1_SCHPO      PVRDAQIVRDKISGRSKGVAYVEFCH-EDSVQAAIALSGKRLLGLPVIVQ--------------------
RNP24_SCHPO     QIRRVRLMTFEDTGKCKGFGFVDFPDIDTCMKA-------------------------------------
PABP_COCIM      QVASIRVCRDAVTRRSLGYAYVNYNNTADGERALEDLNYTLIKGRP------------------------
PABP_CANGA      TITSAKVMTTENG-KSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL-----------------------
NOP4_YEAST      SVKYALPVIDKSTGLAKGTAFVAFKDQYTY----------------------------------------
NOP12_SCHPO     SIDYVRIVRDPKTNLGKGFAYIQFKD--------------------------------------------
MRD1_ASHGO      ELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL---------------------------------
HNRPQ_RAT       KLE--------RVKKLKDYAFIHFDERDGAVKAMEEMNGK------------------------------
HNRPQ_MOUSE     KLE--------RVKKLKDYAFIHFDERDGAVKAMEEMNGK------------------------------
FCA_ARATH       NVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITGTGPVQVRYA------------------
YKX5_SCHPO      SVIRARIAYEP-TGRSKGFGVVQFENENDAASSIEKLNGYRYGGRPLQLSYA------------------
ROA2_SAGOE      KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
ROA2_RAT        KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
ROA2_PONAB      KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
ROA2_MOUSE      KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
ROA2_HUMAN      KLTDCVVMRDPASKRSRGFGFVTFS---------------------------------------------
RNA15_YEAST     PVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGS--------------------------
RBM28_MOUSE     PVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEI---------------------------------
PABP_ASPTN      QVASIRVCRDAVTRRSLGYAYVNYNNTADGERALEDLNYTLIKGKP------------------------
NOP12_YARLI     DVEYVRIVRDPKTNVGKGFAYVQFKD--------------------------------------------
MRD1_KLULA      ELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL---------------------------------
ELAV4_RAT       AVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
ELAV4_MOUSE     AVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
ELAV4_HUMAN     AVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLG---------------------------
EIF3G_ASPTN     RVTRVFLARDRETQRAKGFAFISFADRTDAARACDKMDG--FGYRHLILR--------------------
CELF4_DANRE     NVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKKVQLKRPKDANRP------------
SYY_BIFLO       KAEIERLVEESKTQKTLAWEVTSFVHGEAATQAAIDASGALFG---------------------------
SYY_BIFLI       KAEIERLVEESKTQKTLAWEVTSFVHGEAATQAAIDASGALFG---------------------------
SYY_BIFLD       KAEIERLVEESKTQKTLAWEVTSFVHGEAATQAAIDASGALFG---------------------------
SQD_DROME       EIESINVKTDPQTGRSRGFAFIVFTNTE------------------------------------------
SHEP_DROYA      TIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK------------------------------
SHEP_DROSE      TIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK------------------------------
SHEP_DROME      TIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK------------------------------
SHEP_DROER      TIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK------------------------------
RBM34_HUMAN     SIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMGRKLRVMRSVNKE---------------
RBM15_HUMAN     VITEVDIKRPSRGQTST-YGFLKFENLDMSHRAKLAMSGKIIIRNPI-----------------------
PAB1L_HUMAN     IINSANVMMEGGC--SKRFGFVCFSSPEEVAKAVTAMNGKIVASKPL-----------------------
MRD1_DICDI      KISEIHIPIDYDSKKSKGIAFILYLIPENAVQALNDMDGK------------------------------
HNRPR_HUMAN     KLE--------RVKKLKDYAFVHFEDRGAAVKAMDEMNGK------------------------------
CELF5_XENTR     NIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIG---------------------------
U2AF2_MOUSE     PLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA------------------
U2AF2_HUMAN     PLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA------------------
U2A2A_WHEAT     PLRGFDIVKDKETGNSKGYAFCLYKDGTVTDIACAALNGIQLGDRTLTVRRANQGAEP------------
SXL_MEGSC       QIVQKNILRDKHTGTPRGVAFIRFNKREE-----------------------------------------
RBMS1_RAT       KIVSTKAILDKATNKCKGYGFVDF----------------------------------------------
RBMS1_MOUSE     KIVSTKAILDKATNKCKGYGFVDF----------------------------------------------
RBMS1_HUMAN     KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
RBMS1_BOVIN     KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
RBM19_MOUSE     PLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQ------------------------------
RB15B_MOUSE     IIEEVVIKRPARGQ-GGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPI-----------------------
RB15B_HUMAN     IIEEVVIKRPARGQ-GGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPI-----------------------
EIF3G_YARLI     MINRVYVAKDRDTGRPRGFAFVTYT---------------------------------------------
EIF3G_PHANO     HVTRVFLAKDRETGRAKGFAFVSYADRTDAAKACEKMDG-------------------------------
EIF3G_DANRE     SISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
DAZLB_XENLA     NVKEVKIITD-RTGVSKGYGFISFSDEVDIQKIVKSFHGKKLKLGPA-IRKICTYVQP------------
DAZLA_XENLA     NVKEVKIITD-RTGVSKGYGFISFSDEVDVQKIVKSFHGKKLKLGPA-IRKICTYVQP------------
YG5B_YEAST      PILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKELNGRTVNGSTLFI---------------------
TRA2_DICDI      KIDHVDLIMDRKTGRSKCFGFVYFENKEDAVRAKEECQ--------------------------------
RBMS2_BOVIN     KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
PUF68_DROME     PIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKVGR-------------------
FOX1C_MOUSE     KILDVEIIFNERG--SKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARV--------------
EIF3G_COCIM     HVTRVFLAKDKETNMAKGFAFISFADRADAARACEKMDG--FGYRHLILR--------------------
SR140_PONAB     PLASVKIMTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKL---------------------
SR140_HUMAN     PLASVKIMTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKL---------------------
SHEP_DROWI      TIISTKAILDKTTNKCKGYGFVDFEQPAYAENAVKGLQAK------------------------------
SAP49_SCHPO     QLVKAPQVARDENGRSKGYGFVSYDSFETADAAIEAMNNQFLMNKPITVSYA------------------
RBM28_HUMAN     PVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEI---------------------------------
PPIL4_RHIOR     LIHSCEIIRDRQTGDSLSYAFVEFENKEDAEEAYFKMQSVLI----------------------------
PAP1B_DICDI     TIIGIKIVQDENA-RNKGFGFISFSEIQEAQKALDSLNGFTFGSKQI-----------------------
EIF3G_XENTR     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EIF3G_RAT       SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EIF3G_MOUSE     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EIF3G_HUMAN     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EIF3G_BOVIN     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EI3GB_XENLA     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
EI3GA_XENLA     SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSG-------------------------------
CELF5_HUMAN     NIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIG---------------------------
SR140_MOUSE     PLASVKIMTDEERARERNCGFVAFMSRRDAERALKNLNGKMIMSFEMKL---------------------
SHEP_DROVI      TIISTKAILDKTTNKCKGYGFVDFEQPAYAEGAVKGLQAK------------------------------
SHEP_DROMO      TIISTKAILDKTTNKCKGYGFVDFEQPAYAEGAVKGLQAK------------------------------
SHEP_DROGR      TIISTKAILDKTTNKCKGYGFVDFEQPAYAEGAVKGLQAK------------------------------
MK67I_HUMAN     TVTRFRLSRSKRTGNSKGYAFVEF-ESEDVAKIVAETMNNYL----------------------------
IST3_YEAST      VPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIG---------------------------
DAZL_MOUSE      SVKEVKIITD-RTGVSKGYGFVSFYNDVD-----------------------------------------
DAZL_MACFA      SVKEVKIITD-RTGVSKGYGFVSFFNDVD-----------------------------------------
DAZL_HUMAN      SVKEVKIITD-RTGVSKGYGFVSFFNDVD-----------------------------------------
DAZL_CHICK      TVKEVKIITD-RTGVSKGYGFVSFLDNVD-----------------------------------------
U1SBP_BOVIN     DIXXXXXXXXXXTGFSKGYAFIEYKDERSLLKAYRDADGLVIDQHEIFV---------------------
SF3B4_CAEEL     VIQVPKIMRDVDSGTSKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYA------------------
RBPF_ANASP      SVKRVVLPTDRETGRLRGFAFVEMSDAEE-----------------------------------------
RBMS2_MOUSE     KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
RBMS2_HUMAN     KIVSTKAILDKTTNKCKGYGFVDF----------------------------------------------
RBM5_RAT        SVNNIRLIKDKQTQQNRGFAFVQLSSAMD-----------------------------------------
RBM5_MOUSE      SVNNIRLIKDKQTQQNRGFAFVQLSSAMD-----------------------------------------
RBM5_HUMAN      SVNNIRLIKDKQTQQNRGFAFVQLSSAMD-----------------------------------------
RBM5_BOVIN      SVNNIRLIKDKQTQQNRGFAFVQLSSAMD-----------------------------------------
RB97D_DROME     KVVDVVVMRDAATKRSRGFGFITYTKSLMVDR-AQENRPHIIDGKTVEAKRAL-----------------
PPIE_PONAB      DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNM---------------------------------
PPIE_MOUSE      DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNM---------------------------------
PPIE_HUMAN      DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNM---------------------------------
PPIE_BOVIN      DITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNM---------------------------------
NOP12_GIBZE     KVENVRVVRDSKTRVGKGFAYVQFYDAND-VEAALLLDGK---KFPPMLPRKLRVTR-------------
MK67I_DANRE     KVLRLRVSRSKKTGGSKGYGFVEFECDEVAKIVAETMNNYLMG---------------------------
EIF3G_MAGGR     RVTRVFLAKDRDTGLAKGFAFISFADREDAVKACNKMDG-------------------------------
EIF3G_CAEEL     RVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAEL---------------------------------
SYY_BIFAA       KAEIERLIEESKTQRTLAWEVTSFVHGEEATRQAIEAAGALFG---------------------------
SGN1_YEAST      QIKRITLLYDRNTGTPKGYGYIEF-ESPAYREKALQLNGGELKGKKIAVSRKRTNI--------------
RNPS1_DANRE     KIKMIDMPSDRHPNVSKGYAYVEYESPEDAQKALKHMDGGQIDGQEI-----------------------
RBPA_SYNY3      SVKRVQLPTDRETGRMRGFGFV------------------------------------------------
PSPC1_BOVIN     EPSEVFINRD------RGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFA------------------
MK67I_MOUSE     DISRFRLSRSKRTGNSKGYAFVEF-ESEDVAKIVAETMDNYL----------------------------
HRB1_YEAST      KVVRADIITSR--GHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQ-------------------
FOX1C_HUMAN     KILDVEIIFNERG--SKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARV--------------
DAZL_CALJA      SVKEVKIITD-RTGVSKGYGFVSFFNDVD-----------------------------------------
DAZ4_HUMAN      SVKEVKIITN-RTGVSKGYGFVSFVNDVD-----------------------------------------
DAZ1_HUMAN      SVKEVKIITN-RTGVSKGYGFVSFVNDVD-----------------------------------------
U1SBP_RAT       DIXXXXXXXXXXTGFSKGYAFIEYKEERALLKAYRDADGLVIDQHEIFV---------------------
U1SBP_HUMAN     DIXXXXXXXXXXTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFV---------------------
RU17_XENLA      PIKRIHIVYNKGSEKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLV---------------------
RBMS3_PONAB     KIVSTKAILDKNTNQCKGYGFVDF----------------------------------------------
RBMS3_MOUSE     KIVSTKAILDKNTNQCKGYGFVDF----------------------------------------------
RBMS3_HUMAN     KIVSTKAILDKNTNQCKGYGFVDF----------------------------------------------
PUF60_RAT       KIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM---------------------------------
PUF60_PONAB     KIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM---------------------------------
PUF60_MOUSE     KIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM---------------------------------
PUF60_HUMAN     KIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM---------------------------------
PUF60_BOVIN     KIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSM---------------------------------
NONO_RAT        KAGEVFI------HKDKGFGFI------------------------------------------------
NONO_MOUSE      KAGEVFI------HKDKGFGFI------------------------------------------------
MRD1_YEAST      ELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL---------------------------------
LARK_DROME      TVVECDIVRN--------YGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRP------------
HNRPD_RAT       DVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNG---------------------------
HNRPD_MOUSE     EVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNG---------------------------
HNRPD_HUMAN     EVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNG---------------------------
G3BP1_BOVIN     NVVELRI---NSGGKLPNFGFVVFDDSEPV--------QKVLSNRPIMFR--------------------
EIF3G_LODEL     PLQRVTVVRDRETGESRGFAYVSFATEEIAQKALDLLNGK--GYHSLIL---------------------
EIF3G_CANAL     PLQRVTIVRNRETGESRGFAYVSFATEEIAQRALDTFNGK--GYHSLIL---------------------
DAZ3_HUMAN      SVKEVKIITN-RTGVSKGYGFVSFVNDVD-----------------------------------------
DAZ2_HUMAN      SVKEVKIITN-RTGVSKGYGFVSFVNDVD-----------------------------------------
RNPS1_XENTR     KIKMIDMPVDRHPHLSKGYAYVEFEAPEEAEKALKHMDGGQIDGQEITASAVLT----------------
RNP1B_XENLA     KIKMIDMPVDRHPHLSKGYAYVEFEAPEEAEKALKHMDGGQIDGQEITASAVLT----------------
RNP1A_XENLA     KIKMIDMPVDRHPHLSKGYAYVEFEAPEEAEKALKHMDGGQIDGQEITASAVLT----------------
RAVR1_HUMAN     SLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLG---------------------------
PPIL4_NEUCR     KILSCEVIRDQKTGDSLQYAFIEFEDKKSCEEAYSKMDSVLI----------------------------
NOP15_YEAST     DLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVR--------------------
MUG28_SCHPO     RIKSCTLASYPSTEISKGYGFVSFSHPFEAVQAINTLNGVLFGKKRLFVNYA------------------
U2A2A_NICPL     QLRGFDLVKDRETGNSKGYAFCVYQDVSVTDIACAALNGIKMGDKTLTVRRA------------------
SFRS2_RAT       RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_PIG       RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_PANTR     RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_MOUSE     RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_HUMAN     RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_CHICK     RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFRS2_BOVIN     RVGDVYIPRDRYTKESRGFAFVRFHD--------------------------------------------
SFR2B_HUMAN     RVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDG-------------------------------
RRP2_SPIOL      AIEIAEVMYDKYSGRSRRFGFVTMKTVEDANAVIEKLNDTEIGGRKI-----------------------
PPIL4_USTMA     KILSCEVIKDKKTGDSLQYAFIEFDKKDDAERAYFKMQ--------------------------------
NOP12_CANAL     DVESVRIIRDSKTNLGKGFALVQFKD--------------------------------------------
HRP65_CHITE     EISEAFI------NAEKNFAFLKIDYRANAERAKKDLDGRMRKNKPIRIRFA------------------
G3BP1_PONAB     NVVELRI---NSGGKLPNFGFVVFDDSEPV--------QKVLSNRPIMFR--------------------
G3BP1_HUMAN     NVVELRI---NSGGKLPNFGFVVFDDSEPV--------QKVLSNRPIMFR--------------------
EIF3G_CRYNE     KLGRANIVRDRNTRVSKGLAFVSFESKRDAEAAMAHLNGR--GYDSLILEVAWSQPR-------------
EIF3G_CHAGB     RVTRVFLAKDRDTGMAKGFAFISYADRDDAVKACNKMDG--FGFRHLILR--------------------
EIF3G_ASHGO     NVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGR------------------------------
DAZL_XENTR      KVKDLKIITD-RTGVSKGYGFVSFYDEVD-----------------------------------------
SPEN_DROME      EIIEI----DIKKQGLNAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKL---------------------
RBM9_RAT        KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
RBM9_MOUSE      KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
RBM9_HUMAN      KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
RBM9_BOVIN      KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
PU60B_DANRE     KIKSCMLAREPTTGKHKGFGFIEYEKPQSSLDAVSSM---------------------------------
PSPC1_RAT       EPSEVFINRD------RGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFA------------------
PSPC1_MOUSE     EPSEVFINRD------RGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFA------------------
PSPC1_HUMAN     EPSEVFINRD------RGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFA------------------
PSPC1_CHICK     EPSEVFINRD------RGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFA------------------
PPIL4_SCHPO     KIISCQVIRDKETGDSLQYAFIEFDNKESVEKAYFKMQNVLI----------------------------
PPIL4_MOUSE     PIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLI----------------------------
PPIL4_HUMAN     PIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLI----------------------------
NCBP2_ARATH     EIKKIIMGLDKNTKTPCGFCFVLFYSREDTEDAVKYISGTILDDRPI-----------------------
FOX1A_PONAB     KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
FOX1A_MOUSE     KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
FOX1A_MACFA     KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
FOX1A_HUMAN     KILDVEIIFNERG--SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV--------------
EIF3G_NEUCR     RVTRVFLAKDRDTGLAKGFAFISFADRSDAVKACAKMDG--FGFRHLILR--------------------
EIF3G_NEMVE     PISRIFLAKDKFTNQSKGFAFINFVHREDAARAIEVLSG-------------------------------
U2AF2_DROME     KLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRA------------------
U1SBP_MOUSE     DIXXXXXXXXXXTGFSKGYAFIEYKEERALMKAYRDADGLVIDQHEIFV---------------------
NUCL_XENLA      GSVNARIVTDRDTGASKGFGFVDFS---------------------------------------------
G3BP1_MOUSE     NVVELRI---NSGGKLPNFGFVVFDDSEPV--------QKVLSNRPIMFRGAV-----------------
FUSIP_MOUSE     PIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWI----------------------------
FUSIP_HUMAN     PIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWI----------------------------
FOX1_CAEEL      VVSDVEIIFNERG--SKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARV--------------
FOX1A_DANRE     KILDVEIIFNERG--SKGFGFVTFESSADADRAREKLHGTVVEGRKIEVNNATARV--------------
DAZL_DANRE      SVKEVKII-TYRGGICKGYGFVYFSEDVD-----------------------------------------
RAVR1_RAT       SLERCFLVYSERTGHSKGYGFAEYMKKDSAARAKSDLLGKPLG---------------------------
RAVR1_MOUSE     SLERCFLVYSERTGHSKGYGFAEYMKKDSAARAKSDLLGKPLG---------------------------
NUCL_RAT        GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_PONAB      GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_MOUSE      GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_MESAU      GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_MACFA      GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_HUMAN      GSVRARIVTDRETGSSKGFGFVDFN---------------------------------------------
NUCL_CHICK      S---ARIVTDRDTGSSKGFGFVDFS---------------------------------------------
NOP12_DEBHA     DVESVRVIRDAKTNVGKGFALVQFKD--------------------------------------------
MK67I_XENTR     TVTRLRLSRSKKTGNSKGYAYVEFECDE------------------------------------------
YQO4_CAEEL      QIVKTTIPKDKFTKKQKNFAYIEFDDSSS-IENALVMNGSLFRSRPIVVTAKRTNI--------------
U2A2B_NICPL     PLRGFDLVKDRETGNSKGYAFCVYQDVSVTDIACAALNGIKMGDKTLTVRRA------------------
U2A2B_ARATH     PLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAALNGIKMGDKTLTVRRAI-----------------
U2A2A_ARATH     GLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRA------------------
TRA2B_RAT       PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITK---------------
TRA2B_MOUSE     PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITK---------------
TRA2B_HUMAN     PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITK---------------
TRA2B_BOVIN     PIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITK---------------
TRA2A_MOUSE     PLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITK---------------
TRA2A_HUMAN     PLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITK---------------
RNPS1_RAT       KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RNPS1_PONAB     KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RNPS1_MOUSE     KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RNPS1_MACFA     KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RNPS1_HUMAN     KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RNPS1_BOVIN     KIKMIDMVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI-----------------------
RBM18_PONAB     KVKQFDFLFHKSEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVK-------------
RBM18_MOUSE     KVKQFDFLFHKSEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVK-------------
RBM18_HUMAN     KVKQFDFLFHKSEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVK-------------
MK67I_RAT       DIRRFRLSRSKRTGNSRGFAFVEF-ESEDVAKIVAETMDNYL----------------------------
EIF3G_DEBHA     PFQRAIVVRNRETGESRGFAYVTFATESKAEEALNDLNGK--GYHSLIL---------------------
TADBP_CHICK     EVLMVQVKKDIKTGHSKGFGFVRFTDYE------------------------------------------
ROAA_MOUSE      EVVDCTIKMDPNTGRSRGFGFILFKD--------------------------------------------
ROAA_HUMAN      EVVDCTIKMDPNTGRSRGFGFILFKD--------------------------------------------
RBP1_DROME      PLRNVWVARN-----PPGFAFVEFEDRRDAEDATRALDG-------------------------------
NONO_PONAB      KAGEVFI------HKDKGFGFI------------------------------------------------
NONO_HUMAN      KAGEVFI------HKDKGFGFI------------------------------------------------
MRD1_YARLI      ELEEVHLPINTKTGQCKGFAHVQFEDPENAIAAYEAQDGK------------------------------
HNDLB_XENLA     EIENIELPMDTKTNERRGFCFVTYTDEE------------------------------------------
EIF3G_SCLS1     RVTRVFLAKDRETGLAKGFAFISFQERSDAAKACEKMDG-------------------------------
EIF3G_BOTFB     RVTRVFLAKDRETGLAKGFAFISFQERSDAAKACEKMDG-------------------------------
TADBP_XENTR     EVIMVQVKKDAKTGHSKGFGFVRFADYE------------------------------------------
SFRS6_HUMAN     RLLEV--------DLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHA------------------
SCE3_SCHPO      GVTSIRLVIDPLTERSRGFGYVEFETAD------------------------------------------
RSP1_CAEEL      QIRDVLL--------KNGFGFVEFDDKRDAEDAVHDLNGKELGGERVIL---------------------
RBPD_ANASP      EVKRVVLPTDRETGRMRGFAFVEMNEDAQEDAAITELDG-------------------------------
RBM18_XENLA     KVKQFDFLFHKSGPQPRGYCFVNFETKAEAERAIHCLNGKMALSKKLVVRWAHAQIK-------------
RBM18_BOVIN     TVKQFDFLFHKSGAQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVK-------------
PPIE_DROME      DIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNM---------------------------------
TCG1_SCHPO      TVRKVRVRRGTRLVPS-GIAFVTFNNQEDVDKAIETLNGKTLDDREIVVQKA------------------
SFPQ_MOUSE      EPGEVFI------NKGKGFGFI------------------------------------------------
SFPQ_HUMAN      EPGEVFI------NKGKGFGFI------------------------------------------------
RBM9_XENTR      KILDVEIIFNERG--SKGFGFVTFETSADADRAREKLHSTVVEGRKIEVNNATARV--------------
RBM47_MOUSE     RIYELRLMMDF-DGKNRGYAFVMYCHKHEAKRAVREL---------------------------------
PPIL4_GIBZE     KILSCEVIRDQKTGDSLQYAFIEYEDKASCEAAYFKMQGVLI----------------------------
NELFE_DROME     TIVNVSM------EIEKSRGFVSFAKPESADRAIAEIHGKNVNNLQVQLARRQPQIEP------------
MK67I_XENLA     TVTRLRLSRSKKTGNSKGYAYVEYECDE------------------------------------------
HNRDL_RAT       EVVDCTIKTDPVTGRSRGFGFVLFKD--------------------------------------------
FOX1L_DANRE     KILDVEIIFNERG--SKGFGFVTFESAVEADRAREKLNGTIVEGRKIEVNNATARV--------------
EIF3G_YEAS7     PIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGR------------------------------
DAZ1_CAEEL      AVKDVKMVK-SLDGQSKGYGFITF-ETEDQAEEIRKLTPKQL----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RBM42_XENLA     ------------------------------------------
RBM42_RAT       ------------------------------------------
RBM42_MOUSE     ------------------------------------------
RBM42_HUMAN     ------------------------------------------
RBM42_BOVIN     ------------------------------------------
YDB2_SCHPO      ------------------------------------------
RBM42_XENTR     ------------------------------------------
RBM42_DANRE     ------------------------------------------
TIA1_MOUSE      ------------------------------------------
TIA1_HUMAN      ------------------------------------------
TIAR_MOUSE      ------------------------------------------
TIAR_HUMAN      ------------------------------------------
PUB1_YEAST      ------------------------------------------
YG41_SCHPO      ------------------------------------------
NSR1_YEAST      ------------------------------------------
RMXL3_PANTR     ------------------------------------------
CIRBP_XENLA     ------------------------------------------
GRPA_MAIZE      ------------------------------------------
CIRBP_PONAB     ------------------------------------------
CIRBP_HUMAN     ------------------------------------------
MIP6_YEAST      ------------------------------------------
GRP1_DAUCA      ------------------------------------------
RMXL3_HUMAN     ------------------------------------------
NAM8_YEAST      ------------------------------------------
PABP_MAGGR      ------------------------------------------
GRP8_ARATH      ------------------------------------------
CIRBP_RAT       ------------------------------------------
CIRBP_MOUSE     ------------------------------------------
CIRBP_CRIGR     ------------------------------------------
PABP4_HUMAN     ------------------------------------------
GRP2_SORBI      ------------------------------------------
GRP10_BRANA     ------------------------------------------
CSTFT_MOUSE     ------------------------------------------
CSTFT_HUMAN     ------------------------------------------
ROC3_ARATH      ------------------------------------------
RBM24_DANRE     ------------------------------------------
GRP1_SINAL      ------------------------------------------
TSAP1_PONAB     ------------------------------------------
TSAP1_HUMAN     ------------------------------------------
TSAP1_BOVIN     ------------------------------------------
RBM39_PONAB     ------------------------------------------
RBM39_MOUSE     ------------------------------------------
RBM39_HUMAN     ------------------------------------------
RBM38_XENLA     ------------------------------------------
PABP3_ARATH     ------------------------------------------
NGR1_YEAST      ------------------------------------------
HNRPG_PANTR     ------------------------------------------
HNRPG_HUMAN     ------------------------------------------
RBM38_XENTR     ------------------------------------------
RBM23_HUMAN     ------------------------------------------
PAP1L_HUMAN     ------------------------------------------
RBM24_XENTR     ------------------------------------------
RBM24_CHICK     ------------------------------------------
RB24B_XENLA     ------------------------------------------
RB24A_XENLA     ------------------------------------------
PAB4L_HUMAN     ------------------------------------------
HNRPG_BOVIN     ------------------------------------------
GRP2_ARATH      ------------------------------------------
RBM24_HUMAN     ------------------------------------------
PABP5_ARATH     ------------------------------------------
HNRGT_HUMAN     ------------------------------------------
TSAP1_RAT       ------------------------------------------
RBM38_CHICK     ------------------------------------------
HNRPG_RAT       ------------------------------------------
GRP7_ARATH      ------------------------------------------
CSTF2_PONAB     ------------------------------------------
CSTF2_MOUSE     ------------------------------------------
CSTF2_HUMAN     ------------------------------------------
CSTF2_BOVIN     ------------------------------------------
RU17_YEAST      ------------------------------------------
ROA3_RAT        ------------------------------------------
ROA3_MOUSE      ------------------------------------------
ROA3_HUMAN      ------------------------------------------
TSAP1_MOUSE     ------------------------------------------
ROC2_ARATH      ------------------------------------------
RBM38_HUMAN     ------------------------------------------
PABP3_HUMAN     ------------------------------------------
MSIR6_DROME     ------------------------------------------
GRP2_SINAL      ------------------------------------------
EPAB_XENTR      ------------------------------------------
ZCRB1_RAT       ------------------------------------------
ZCRB1_MOUSE     ------------------------------------------
YOCE_SCHPO      ------------------------------------------
ROC1_NICSY      ------------------------------------------
ROC1_ARATH      ------------------------------------------
PABP_ASPNC      ------------------------------------------
PABP2_ARATH     ------------------------------------------
MSI2H_MOUSE     ------------------------------------------
MSI2H_HUMAN     ------------------------------------------
HNRPG_MOUSE     ------------------------------------------
ROA1_CAEEL      ------------------------------------------
RO31_XENLA      ------------------------------------------
PABP_NEOFI      ------------------------------------------
PABP_CRYNE      ------------------------------------------
HNRGT_MACFA     ------------------------------------------
ROC3_NICSY      ------------------------------------------
ELAV_DROVI      ------------------------------------------
ELAV_DROME      ------------------------------------------
ZCRB1_HUMAN     ------------------------------------------
RO32_XENLA      ------------------------------------------
EPABB_XENLA     ------------------------------------------
ZCRB1_XENLA     ------------------------------------------
ZCRB1_DANRE     ------------------------------------------
RBY1E_HUMAN     ------------------------------------------
RBY1D_HUMAN     ------------------------------------------
RBY1B_HUMAN     ------------------------------------------
RBY1A_HUMAN     ------------------------------------------
PABP_KLULA      ------------------------------------------
PABPB_XENLA     ------------------------------------------
PABPA_XENLA     ------------------------------------------
PABP5_PONPY     ------------------------------------------
PABP5_PANTR     ------------------------------------------
PABP5_MACMU     ------------------------------------------
PABP5_HYLLA     ------------------------------------------
PABP5_HUMAN     ------------------------------------------
PABP5_GORGO     ------------------------------------------
PABP1_RAT       ------------------------------------------
PABP1_PONAB     ------------------------------------------
PABP1_MOUSE     ------------------------------------------
PABP1_HUMAN     ------------------------------------------
PABP1_BOVIN     ------------------------------------------
U1SBP_XENLA     ------------------------------------------
TSP1L_DANRE     ------------------------------------------
ROC1_SPIOL      ------------------------------------------
ROC1_NICPL      ------------------------------------------
PABP_SCHPO      ------------------------------------------
GRP1_SORBI      ------------------------------------------
GAR2_SCHPO      ------------------------------------------
EPABA_XENLA     ------------------------------------------
ZCRB1_BOVIN     ------------------------------------------
TSAP1_DANRE     ------------------------------------------
RBM45_RAT       ------------------------------------------
PABP_DEBHA      ------------------------------------------
RBM45_HUMAN     ------------------------------------------
PAP1A_DICDI     ------------------------------------------
SF3B4_RAT       ------------------------------------------
SF3B4_MOUSE     ------------------------------------------
SF3B4_HUMAN     ------------------------------------------
ROA1_DROME      ------------------------------------------
RBM3_MOUSE      ------------------------------------------
PABP_EMENI      ------------------------------------------
HRP1_YEAST      ------------------------------------------
RT19_ARATH      ------------------------------------------
ROC5_NICSY      ------------------------------------------
ROA1_RAT        ------------------------------------------
ROA1_PANTR      ------------------------------------------
ROA1_MOUSE      ------------------------------------------
ROA1_HUMAN      ------------------------------------------
ROA1_BOVIN      ------------------------------------------
RBM3_HUMAN      ------------------------------------------
RBM38_MOUSE     ------------------------------------------
RA1L3_HUMAN     ------------------------------------------
RA1L2_HUMAN     ------------------------------------------
PPIL4_ASPOR     ------------------------------------------
MSI1H_RAT       ------------------------------------------
MSI1H_MOUSE     ------------------------------------------
MSI1H_HUMAN     ------------------------------------------
CSX1_SCHPO      ------------------------------------------
BOLL_MOUSE      ------------------------------------------
BOLL_MACFA      ------------------------------------------
BOLL_HUMAN      ------------------------------------------
YDC1_SCHPO      ------------------------------------------
SXL_CHRRU       ------------------------------------------
RU17_SCHPO      ------------------------------------------
ROC4_NICSY      ------------------------------------------
RBY1F_HUMAN     ------------------------------------------
PPIL4_ASPFU     ------------------------------------------
PABP_YEAST      ------------------------------------------
PABP_ASPFU      ------------------------------------------
PABP_ASHGO      ------------------------------------------
MRD1_CANAL      ------------------------------------------
CELF1_XENTR     ------------------------------------------
CELF1_RAT       ------------------------------------------
CELF1_PONAB     ------------------------------------------
CELF1_MOUSE     ------------------------------------------
CELF1_HUMAN     ------------------------------------------
CELF1_CHICK     ------------------------------------------
C3H42_ARATH     ------------------------------------------
BOULE_DROME     ------------------------------------------
ROA1_MACMU      ------------------------------------------
PSPC1_DANRE     ------------------------------------------
PPIL4_EMENI     ------------------------------------------
MRD1_USTMA      ------------------------------------------
CELF1_DANRE     ------------------------------------------
C3H25_ORYSJ     ------------------------------------------
YHKF_SCHPO      ------------------------------------------
ROA1_SCHAM      ------------------------------------------
RBPE_ANASP      ------------------------------------------
RBMX2_HUMAN     ------------------------------------------
PABP_YARLI      ------------------------------------------
PABP_NEUCR      ------------------------------------------
PABP_CHAGB      ------------------------------------------
DAZP1_XENLA     ------------------------------------------
DAZP1_MOUSE     ------------------------------------------
DAZP1_HUMAN     ------------------------------------------
CELF3_DANRE     ------------------------------------------
CEL3B_XENLA     ------------------------------------------
CEL1B_XENLA     ------------------------------------------
SXL_MUSDO       ------------------------------------------
ROC2_NICSY      ------------------------------------------
RBMX2_MOUSE     ------------------------------------------
RBM45_MOUSE     ------------------------------------------
PABP_PICST      ------------------------------------------
CELF2_DANRE     ------------------------------------------
CEL3A_XENLA     ------------------------------------------
CEL1A_XENLA     ------------------------------------------
RU17_DROME      ------------------------------------------
ROC2_NICPL      ------------------------------------------
RO22_XENLA      ------------------------------------------
PES4_YEAST      ------------------------------------------
PABP_PICGU      ------------------------------------------
PABP_PHANO      ------------------------------------------
MRD1_SCHPO      ------------------------------------------
MK67I_BOVIN     ------------------------------------------
CELF2_XENTR     ------------------------------------------
CELF2_XENLA     ------------------------------------------
CELF2_RAT       ------------------------------------------
CELF2_PONAB     ------------------------------------------
CELF2_MOUSE     ------------------------------------------
CELF2_HUMAN     ------------------------------------------
CELF2_CHICK     ------------------------------------------
RBY1B_MOUSE     ------------------------------------------
RBM19_HUMAN     ------------------------------------------
RB87F_DROME     ------------------------------------------
NOP12_KLULA     ------------------------------------------
MRD1_ASPFU      ------------------------------------------
ELAV3_MOUSE     ------------------------------------------
ELAV3_HUMAN     ------------------------------------------
CTF1_SCHPO      ------------------------------------------
CELF3_MOUSE     ------------------------------------------
CELF3_HUMAN     ------------------------------------------
CELF3_BOVIN     ------------------------------------------
ROA1_XENLA      ------------------------------------------
RBPB_ANASP      ------------------------------------------
PAP1M_HUMAN     ------------------------------------------
PABP_USTMA      ------------------------------------------
NOP12_CANGA     ------------------------------------------
ELAV1_HUMAN     ------------------------------------------
SXL_DROSU       ------------------------------------------
SXL_DROME       ------------------------------------------
RU17_XENTR      ------------------------------------------
RSP4_CAEEL      ------------------------------------------
RO21_XENLA      ------------------------------------------
RBY1A_MOUSE     ------------------------------------------
PABP_ASPCL      ------------------------------------------
NOP12_YEAST     ------------------------------------------
HNRPQ_HUMAN     ------------------------------------------
ELAV2_RAT       ------------------------------------------
ELAV2_PONAB     ------------------------------------------
ELAV2_MOUSE     ------------------------------------------
ELAV2_HUMAN     ------------------------------------------
CELF6_MOUSE     ------------------------------------------
CELF6_HUMAN     ------------------------------------------
ROA2_BOVIN      ------------------------------------------
RB27C_DROME     ------------------------------------------
PABP_CANAL      ------------------------------------------
PABP_ASPOR      ------------------------------------------
PABPX_ARATH     ------------------------------------------
NOP13_YEAST     ------------------------------------------
EIF3G_NEOFI     ------------------------------------------
EIF3G_ASPOR     ------------------------------------------
EIF3G_ASPNC     ------------------------------------------
EIF3G_ASPFU     ------------------------------------------
EIF3G_ASPFC     ------------------------------------------
SXL_CERCA       ------------------------------------------
RU17_MOUSE      ------------------------------------------
RU17_HUMAN      ------------------------------------------
RU17_BOVIN      ------------------------------------------
ROA0_HUMAN      ------------------------------------------
RBPA_ANASP      ------------------------------------------
PABP_LODEL      ------------------------------------------
PABP_DROME      ------------------------------------------
NOP12_ASHGO     ------------------------------------------
MRD1_EMENI      ------------------------------------------
MRD1_CANGA      ------------------------------------------
IST3_SCHPO      ------------------------------------------
ELAV1_MOUSE     ------------------------------------------
EIF3G_PICST     ------------------------------------------
EIF3G_EMENI     ------------------------------------------
EIF3G_ASPCL     ------------------------------------------
RSD1_SCHPO      ------------------------------------------
RNP24_SCHPO     ------------------------------------------
PABP_COCIM      ------------------------------------------
PABP_CANGA      ------------------------------------------
NOP4_YEAST      ------------------------------------------
NOP12_SCHPO     ------------------------------------------
MRD1_ASHGO      ------------------------------------------
HNRPQ_RAT       ------------------------------------------
HNRPQ_MOUSE     ------------------------------------------
FCA_ARATH       ------------------------------------------
YKX5_SCHPO      ------------------------------------------
ROA2_SAGOE      ------------------------------------------
ROA2_RAT        ------------------------------------------
ROA2_PONAB      ------------------------------------------
ROA2_MOUSE      ------------------------------------------
ROA2_HUMAN      ------------------------------------------
RNA15_YEAST     ------------------------------------------
RBM28_MOUSE     ------------------------------------------
PABP_ASPTN      ------------------------------------------
NOP12_YARLI     ------------------------------------------
MRD1_KLULA      ------------------------------------------
ELAV4_RAT       ------------------------------------------
ELAV4_MOUSE     ------------------------------------------
ELAV4_HUMAN     ------------------------------------------
EIF3G_ASPTN     ------------------------------------------
CELF4_DANRE     ------------------------------------------
SYY_BIFLO       ------------------------------------------
SYY_BIFLI       ------------------------------------------
SYY_BIFLD       ------------------------------------------
SQD_DROME       ------------------------------------------
SHEP_DROYA      ------------------------------------------
SHEP_DROSE      ------------------------------------------
SHEP_DROME      ------------------------------------------
SHEP_DROER      ------------------------------------------
RBM34_HUMAN     ------------------------------------------
RBM15_HUMAN     ------------------------------------------
PAB1L_HUMAN     ------------------------------------------
MRD1_DICDI      ------------------------------------------
HNRPR_HUMAN     ------------------------------------------
CELF5_XENTR     ------------------------------------------
U2AF2_MOUSE     ------------------------------------------
U2AF2_HUMAN     ------------------------------------------
U2A2A_WHEAT     ------------------------------------------
SXL_MEGSC       ------------------------------------------
RBMS1_RAT       ------------------------------------------
RBMS1_MOUSE     ------------------------------------------
RBMS1_HUMAN     ------------------------------------------
RBMS1_BOVIN     ------------------------------------------
RBM19_MOUSE     ------------------------------------------
RB15B_MOUSE     ------------------------------------------
RB15B_HUMAN     ------------------------------------------
EIF3G_YARLI     ------------------------------------------
EIF3G_PHANO     ------------------------------------------
EIF3G_DANRE     ------------------------------------------
DAZLB_XENLA     ------------------------------------------
DAZLA_XENLA     ------------------------------------------
YG5B_YEAST      ------------------------------------------
TRA2_DICDI      ------------------------------------------
RBMS2_BOVIN     ------------------------------------------
PUF68_DROME     ------------------------------------------
FOX1C_MOUSE     ------------------------------------------
EIF3G_COCIM     ------------------------------------------
SR140_PONAB     ------------------------------------------
SR140_HUMAN     ------------------------------------------
SHEP_DROWI      ------------------------------------------
SAP49_SCHPO     ------------------------------------------
RBM28_HUMAN     ------------------------------------------
PPIL4_RHIOR     ------------------------------------------
PAP1B_DICDI     ------------------------------------------
EIF3G_XENTR     ------------------------------------------
EIF3G_RAT       ------------------------------------------
EIF3G_MOUSE     ------------------------------------------
EIF3G_HUMAN     ------------------------------------------
EIF3G_BOVIN     ------------------------------------------
EI3GB_XENLA     ------------------------------------------
EI3GA_XENLA     ------------------------------------------
CELF5_HUMAN     ------------------------------------------
SR140_MOUSE     ------------------------------------------
SHEP_DROVI      ------------------------------------------
SHEP_DROMO      ------------------------------------------
SHEP_DROGR      ------------------------------------------
MK67I_HUMAN     ------------------------------------------
IST3_YEAST      ------------------------------------------
DAZL_MOUSE      ------------------------------------------
DAZL_MACFA      ------------------------------------------
DAZL_HUMAN      ------------------------------------------
DAZL_CHICK      ------------------------------------------
U1SBP_BOVIN     ------------------------------------------
SF3B4_CAEEL     ------------------------------------------
RBPF_ANASP      ------------------------------------------
RBMS2_MOUSE     ------------------------------------------
RBMS2_HUMAN     ------------------------------------------
RBM5_RAT        ------------------------------------------
RBM5_MOUSE      ------------------------------------------
RBM5_HUMAN      ------------------------------------------
RBM5_BOVIN      ------------------------------------------
RB97D_DROME     ------------------------------------------
PPIE_PONAB      ------------------------------------------
PPIE_MOUSE      ------------------------------------------
PPIE_HUMAN      ------------------------------------------
PPIE_BOVIN      ------------------------------------------
NOP12_GIBZE     ------------------------------------------
MK67I_DANRE     ------------------------------------------
EIF3G_MAGGR     ------------------------------------------
EIF3G_CAEEL     ------------------------------------------
SYY_BIFAA       ------------------------------------------
SGN1_YEAST      ------------------------------------------
RNPS1_DANRE     ------------------------------------------
RBPA_SYNY3      ------------------------------------------
PSPC1_BOVIN     ------------------------------------------
MK67I_MOUSE     ------------------------------------------
HRB1_YEAST      ------------------------------------------
FOX1C_HUMAN     ------------------------------------------
DAZL_CALJA      ------------------------------------------
DAZ4_HUMAN      ------------------------------------------
DAZ1_HUMAN      ------------------------------------------
U1SBP_RAT       ------------------------------------------
U1SBP_HUMAN     ------------------------------------------
RU17_XENLA      ------------------------------------------
RBMS3_PONAB     ------------------------------------------
RBMS3_MOUSE     ------------------------------------------
RBMS3_HUMAN     ------------------------------------------
PUF60_RAT       ------------------------------------------
PUF60_PONAB     ------------------------------------------
PUF60_MOUSE     ------------------------------------------
PUF60_HUMAN     ------------------------------------------
PUF60_BOVIN     ------------------------------------------
NONO_RAT        ------------------------------------------
NONO_MOUSE      ------------------------------------------
MRD1_YEAST      ------------------------------------------
LARK_DROME      ------------------------------------------
HNRPD_RAT       ------------------------------------------
HNRPD_MOUSE     ------------------------------------------
HNRPD_HUMAN     ------------------------------------------
G3BP1_BOVIN     ------------------------------------------
EIF3G_LODEL     ------------------------------------------
EIF3G_CANAL     ------------------------------------------
DAZ3_HUMAN      ------------------------------------------
DAZ2_HUMAN      ------------------------------------------
RNPS1_XENTR     ------------------------------------------
RNP1B_XENLA     ------------------------------------------
RNP1A_XENLA     ------------------------------------------
RAVR1_HUMAN     ------------------------------------------
PPIL4_NEUCR     ------------------------------------------
NOP15_YEAST     ------------------------------------------
MUG28_SCHPO     ------------------------------------------
U2A2A_NICPL     ------------------------------------------
SFRS2_RAT       ------------------------------------------
SFRS2_PIG       ------------------------------------------
SFRS2_PANTR     ------------------------------------------
SFRS2_MOUSE     ------------------------------------------
SFRS2_HUMAN     ------------------------------------------
SFRS2_CHICK     ------------------------------------------
SFRS2_BOVIN     ------------------------------------------
SFR2B_HUMAN     ------------------------------------------
RRP2_SPIOL      ------------------------------------------
PPIL4_USTMA     ------------------------------------------
NOP12_CANAL     ------------------------------------------
HRP65_CHITE     ------------------------------------------
G3BP1_PONAB     ------------------------------------------
G3BP1_HUMAN     ------------------------------------------
EIF3G_CRYNE     ------------------------------------------
EIF3G_CHAGB     ------------------------------------------
EIF3G_ASHGO     ------------------------------------------
DAZL_XENTR      ------------------------------------------
SPEN_DROME      ------------------------------------------
RBM9_RAT        ------------------------------------------
RBM9_MOUSE      ------------------------------------------
RBM9_HUMAN      ------------------------------------------
RBM9_BOVIN      ------------------------------------------
PU60B_DANRE     ------------------------------------------
PSPC1_RAT       ------------------------------------------
PSPC1_MOUSE     ------------------------------------------
PSPC1_HUMAN     ------------------------------------------
PSPC1_CHICK     ------------------------------------------
PPIL4_SCHPO     ------------------------------------------
PPIL4_MOUSE     ------------------------------------------
PPIL4_HUMAN     ------------------------------------------
NCBP2_ARATH     ------------------------------------------
FOX1A_PONAB     ------------------------------------------
FOX1A_MOUSE     ------------------------------------------
FOX1A_MACFA     ------------------------------------------
FOX1A_HUMAN     ------------------------------------------
EIF3G_NEUCR     ------------------------------------------
EIF3G_NEMVE     ------------------------------------------
U2AF2_DROME     ------------------------------------------
U1SBP_MOUSE     ------------------------------------------
NUCL_XENLA      ------------------------------------------
G3BP1_MOUSE     ------------------------------------------
FUSIP_MOUSE     ------------------------------------------
FUSIP_HUMAN     ------------------------------------------
FOX1_CAEEL      ------------------------------------------
FOX1A_DANRE     ------------------------------------------
DAZL_DANRE      ------------------------------------------
RAVR1_RAT       ------------------------------------------
RAVR1_MOUSE     ------------------------------------------
NUCL_RAT        ------------------------------------------
NUCL_PONAB      ------------------------------------------
NUCL_MOUSE      ------------------------------------------
NUCL_MESAU      ------------------------------------------
NUCL_MACFA      ------------------------------------------
NUCL_HUMAN      ------------------------------------------
NUCL_CHICK      ------------------------------------------
NOP12_DEBHA     ------------------------------------------
MK67I_XENTR     ------------------------------------------
YQO4_CAEEL      ------------------------------------------
U2A2B_NICPL     ------------------------------------------
U2A2B_ARATH     ------------------------------------------
U2A2A_ARATH     ------------------------------------------
TRA2B_RAT       ------------------------------------------
TRA2B_MOUSE     ------------------------------------------
TRA2B_HUMAN     ------------------------------------------
TRA2B_BOVIN     ------------------------------------------
TRA2A_MOUSE     ------------------------------------------
TRA2A_HUMAN     ------------------------------------------
RNPS1_RAT       ------------------------------------------
RNPS1_PONAB     ------------------------------------------
RNPS1_MOUSE     ------------------------------------------
RNPS1_MACFA     ------------------------------------------
RNPS1_HUMAN     ------------------------------------------
RNPS1_BOVIN     ------------------------------------------
RBM18_PONAB     ------------------------------------------
RBM18_MOUSE     ------------------------------------------
RBM18_HUMAN     ------------------------------------------
MK67I_RAT       ------------------------------------------
EIF3G_DEBHA     ------------------------------------------
TADBP_CHICK     ------------------------------------------
ROAA_MOUSE      ------------------------------------------
ROAA_HUMAN      ------------------------------------------
RBP1_DROME      ------------------------------------------
NONO_PONAB      ------------------------------------------
NONO_HUMAN      ------------------------------------------
MRD1_YARLI      ------------------------------------------
HNDLB_XENLA     ------------------------------------------
EIF3G_SCLS1     ------------------------------------------
EIF3G_BOTFB     ------------------------------------------
TADBP_XENTR     ------------------------------------------
SFRS6_HUMAN     ------------------------------------------
SCE3_SCHPO      ------------------------------------------
RSP1_CAEEL      ------------------------------------------
RBPD_ANASP      ------------------------------------------
RBM18_XENLA     ------------------------------------------
RBM18_BOVIN     ------------------------------------------
PPIE_DROME      ------------------------------------------
TCG1_SCHPO      ------------------------------------------
SFPQ_MOUSE      ------------------------------------------
SFPQ_HUMAN      ------------------------------------------
RBM9_XENTR      ------------------------------------------
RBM47_MOUSE     ------------------------------------------
PPIL4_GIBZE     ------------------------------------------
NELFE_DROME     ------------------------------------------
MK67I_XENLA     ------------------------------------------
HNRDL_RAT       ------------------------------------------
FOX1L_DANRE     ------------------------------------------
EIF3G_YEAS7     ------------------------------------------
DAZ1_CAEEL      ------------------------------------------