[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01234

[Show Plain Result]


## Summary of Sequence Search
    1::388
  123::293     5e-41  53%  297 aa  ALKBH_SCHPO RecName: Full=Alkylated DNA repair protein alkB
  192::393     1e-22  38%  393 aa  ALKB_DICDI RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
  154::354     4e-20  39%  389 aa  ALKB1_HUMAN RecName: Full=Alkylated DNA repair protein alkB homolog
  154::364     1e-19  39%  389 aa  ALKB1_MOUSE RecName: Full=Alkylated DNA repair protein alkB homolog
  171::345     2e-17  35%  345 aa  ALKBH_ARATH RecName: Full=Alkylated DNA repair protein alkB
   54::196     5e-11  35%  220 aa  ALKB_CAUCR RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
   54::196     5e-11  35%  220 aa  ALKB_CAUCN RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
   65::189     3e-08  34%  216 aa  ALKB_ECOLI RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
  115::221     1e-06  29%  225 aa  YLW2_SCHPO RecName: Full=Uncharacterized protein P8A3.02c;
   65::189     2e-06  31%  216 aa  ALKB_SALTY RecName: Full=Alpha-ketoglutarate-dependent dioxygenase
  224::288     1e-05  32%  628 aa  ALKB8_XENTR RecName: Full=Alkylated DNA repair protein alkB homolog
  194::290     1e-05  29%  664 aa  ALKB8_MOUSE RecName: Full=Alkylated DNA repair protein alkB homolog
  194::290     2e-05  27%  664 aa  ALKB8_MACFA RecName: Full=Alkylated DNA repair protein alkB homolog
  194::290     2e-05  29%  664 aa  ALKB8_BOVIN RecName: Full=Alkylated DNA repair protein alkB homolog
  132::275     1e-04  28%  723 aa  ZN750_HUMAN RecName: Full=Protein ZNF750;
  199::290     2e-04  26%  664 aa  ALKB8_HUMAN RecName: Full=Alkylated DNA repair protein alkB homolog
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALKBH_SCHPO     ----------------------------------------------------------------------
ALKB_DICDI      ----------------------------------------------------------------------
ALKB1_HUMAN     ----------------------------------------------------------------------
ALKB1_MOUSE     ----------------------------------------------------------------------
ALKBH_ARATH     ----------------------------------------------------------------------
ALKB_CAUCR      ----------------------------------------------------------------------
ALKB_CAUCN      ----------------------------------------------------------------------
ALKB_ECOLI      ----------------------------------------------------------------------
YLW2_SCHPO      ----------------------------------------------------------------------
ALKB_SALTY      ----------------------------------------------------------------------
ALKB8_XENTR     ----------------------------------------------------------------------
ALKB8_MOUSE     ----------------------------------------------------------------------
ALKB8_MACFA     ----------------------------------------------------------------------
ALKB8_BOVIN     ----------------------------------------------------------------------
ZN750_HUMAN     ----------------------------------------------------------------------
ALKB8_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALKBH_SCHPO     ----------------------------------------------------------------------
ALKB_DICDI      ----------------------------------------------------------------------
ALKB1_HUMAN     ----------------------------------------------------------------------
ALKB1_MOUSE     ----------------------------------------------------------------------
ALKBH_ARATH     ----------------------------------------------------------------------
ALKB_CAUCR      ----------------------------------------------------------------------
ALKB_CAUCN      ----------------------------------------------------------------------
ALKB_ECOLI      ----------------------------------------------------------------------
YLW2_SCHPO      ----------------------------------------------------------------------
ALKB_SALTY      ----------------------------------------------------------------------
ALKB8_XENTR     ----------------------------------------------------------------------
ALKB8_MOUSE     ----------------------------------------------------------------------
ALKB8_MACFA     ----------------------------------------------------------------------
ALKB8_BOVIN     ----------------------------------------------------------------------
ZN750_HUMAN     ----------------------------------------------------------------------
ALKB8_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxLHLHYDVSYPSPSSDANGASALKGTQQEACWSTNSSFFRDDPTRTFSPKDATVHRPLSIQAAL
ALKBH_SCHPO     -------------------------------------------------------------KPLTVDRLV
ALKB_DICDI      ----------------------------------------------EQPTRPLDKNG----EPLPTYRQL
ALKB1_HUMAN     -------------------------------------------------------KEATKRRPRS----L
ALKB1_MOUSE     -------------------------------------------------------KEVTKRRPRS----L
ALKBH_ARATH     -------------------------------------------------------------------SVL
ALKB_CAUCR      ----------------------------------------------------FSNYRTAYGKPMSVAMTA
ALKB_CAUCN      ----------------------------------------------------FSNYRTAYGKPMSVAMTA
ALKB_ECOLI      ----------------------------------------------------------------------
YLW2_SCHPO      ----------------------------------------------------------------------
ALKB_SALTY      ----------------------------------------------------------------------
ALKB8_XENTR     ----------------------------------------------------------------------
ALKB8_MOUSE     ----------------------------------------------------------------------
ALKB8_MACFA     ----------------------------------------------------------------------
ALKB8_BOVIN     ----------------------------------------------------------------------
ZN750_HUMAN     -------LHRASPCKSPAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNPTAKAVSF
ALKB8_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECD
ALKBH_SCHPO     HKKLRWVTLGEQYDWTTKEYPPSKSPGFPKDLGDFVEKVVKESTAEAAIVNFYSPGDTLSAHIDESEEDL
ALKB_DICDI      LDKLAWSTLGYQYQWTPRLYSEEFYEEFPDDLQELVQKIFDPYVAEAATVNFYSEDSIMGGHLDDAEEME
ALKB1_HUMAN     LEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVFEDFRAEAGILNYYRLDSTLGIHVDRSEDHS
ALKB1_MOUSE     LERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVFQGFQAEAGILNYYRLDSTLGIHVDRSEDHS
ALKBH_ARATH     LRKLRWSTLGLQFDWSKRNYDVSPHNNIPDALCQLAHAAIAEFRPEGAIVNYFGIGDTLGGHLDDMEDWS
ALKB_CAUCR      LGSLGWTSDARGYRYVDRHPETGRPPDMPPDLWTVLGD--PETPPDSCLVNLYRDGARMGLHQD-RDEAD
ALKB_CAUCN      LGSLGWTSDARGYRYVDRHPETGRPPDMPPDLWTVLGD--PETPPDSCLVNLYRDGARMGLHQD-RDEAD
ALKB_ECOLI      ----------GHLGWTTHRYSPIDPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEDLR
YLW2_SCHPO      --------------------------------------------AEAIIMQVYNPGDGIIPHKDL-EMFG
ALKB_SALTY      ----------GALGWTTDRHTDKPWPALPLSFASVCRQAYASFQPDACLINRYAPGAKLSLHQDKDEDLR
ALKB8_XENTR     -------------------------------------------------INQYEPGQGIPPHVDTHSAFE
ALKB8_MOUSE     -----------------KPLPGGLPEVCSSILEKLLKEGYIKHKPDQLTINQYEPGHGIPAHIDTHSAFE
ALKB8_MACFA     -----------------KPLPGGLPDICDSFLEKWLREGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFE
ALKB8_BOVIN     -----------------KPLPGGLPDICESILEKWLKEGFIKHKPDQLTINQYEPGHGIPAHIDTHSAFE
ZN750_HUMAN     HTKSAFHTPG--YPW--KAGSPFLPPEFPHKISSYMHPTIPEYPTEHGLATIYSPYLLAGS----SPECD
ALKB8_HUMAN     ----------------------GLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFE


                         .         *         .         .         .         .         +:350
query           TGLISISLGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVP
ALKBH_SCHPO     TPLISLSMGLDCIYLIGESRSEKPSALRLHSGDVVIMTGTSRKAFHAVPKIIPNSTPNYLLT--------
ALKB_DICDI      KPIISISFGSTAVFLMGAETRDIAPVLFIRSGDIVIMGGRSRYCYHGVAKIVENSFDLGLI-----DEND
ALKB1_HUMAN     KPLLSFSFGQSAIFLLGGLQRDEATAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPLPHCLEA-PLPAVLP
ALKB1_MOUSE     KPLLSFSFGQSAIFLLGGLKRDEATAMFMHSGDIMVMSGFSRLLNHAVPRVLPECLPHCLET-PLPAVLP
ALKBH_ARATH     KPIVSMSLGCKAIFLLGKSKDDPPHAMYLRSGDVVLMAGEARECFHGIPRIF--TGEENADIGALESELS
ALKB_CAUCR      PRVLSISLGDTAVFRIGGVNRDPTRSLRLASGDVCRLLGPARLAFHGVDRI-------------------
ALKB_CAUCN      PRVLSISLGDTAVFRIGGVNRDPTRSLRLASGDVCRLLGPARLAFHGVDRI-------------------
ALKB_ECOLI      APIVSVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGI----------------------
YLW2_SCHPO      DGVAIFSFLSNTTMIFTHPELKLKSKIRLEKGSLLLMSGTARYDWF---HEIPFRAGDW---------VM
ALKB_SALTY      APIVSVSLGVPAVFQFGGRRSDPIQRILLEHGDIVVWGGESRLFYHGI----------------------
ALKB8_XENTR     DEILSLSLGAEIVMDFKHPNG-SVVPVMLPQRSLLIMSGESRYLW-------------------------
ALKB8_MOUSE     DEIISLSLGSAIVMDFKHPEGVTVQVM-LPRRSLLVMTGESRYLW-------------------------
ALKB8_MACFA     DEIVSLSLGSEIVMDFKHPDGTAVPVM-LPRRSLLVMTGESRYLW-------------------------
ALKB8_BOVIN     DEIISLSLGSEIVMDFKHPDGMTVPVM-LPCRSLLVMTGESRYLW-------------------------
ZN750_HUMAN     APLLSV----------------------------------------------------------------
ALKB8_HUMAN     DEIVSLSLGSEIVMDFKHPDGIAVPVM-LPRRSLLVMTGESRYLW-------------------------


                         .         .         .         .         *         .         .:420
query           DEDSQRWWGWMAGKRVNLNVRQMFQSPPTNPAALGEND
ALKBH_SCHPO     --GNKAWDGWISRKRVNFNVRQV---------------
ALKB_DICDI      DQDLKYKIQWLKEKRVNINTRQVFKVPKLGGKLINKNE
ALKB1_HUMAN     REDWQVCASYLKTARVNMTVRQVLATDQNFP-------
ALKB1_MOUSE     SEDWQVCATYLRTARVNMTVRQVLQDFPLEPVEETKRD
ALKBH_ARATH     HESGHFFAEYIKTSRININIRQVF--------------
ALKB_CAUCR      --------------------------------------
ALKB_CAUCN      --------------------------------------
ALKB_ECOLI      --------------------------------------
YLW2_SCHPO      NDGEEKWVS--RSQRLSVTMRRIIEN------------
ALKB_SALTY      --------------------------------------
ALKB8_XENTR     --------------------------------------
ALKB8_MOUSE     --------------------------------------
ALKB8_MACFA     --------------------------------------
ALKB8_BOVIN     --------------------------------------
ZN750_HUMAN     --------------------------------------
ALKB8_HUMAN     --------------------------------------