[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01292

[Show Plain Result]


## Summary of Sequence Search
    1::1300
  308::1056    2e-15  23% 1140 aa  CP135_MOUSE RecName: Full=Centrosomal protein of 135 kDa;       
  917::1473    3e-13  23% 1790 aa  USO1_YEAST RecName: Full=Intracellular protein transport protein
  121::732     3e-13  25%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
  371::989     4e-13  22% 1957 aa  SPO15_SCHPO RecName: Full=Sporulation-specific protein 15;
  308::852     2e-12  24% 1140 aa  CP135_HUMAN RecName: Full=Centrosomal protein of 135 kDa;       
  802::1471    3e-12  24% 1955 aa  PUMA_PARUN RecName: Full=227 kDa spindle- and centromere-associated
   34::677     3e-12  23%  697 aa  TSG10_MOUSE RecName: Full=Testis-specific gene 10 protein;
  168::622     6e-12  24%  723 aa  HOOK_BRAFL RecName: Full=Protein Hook homolog;
  156::463     7e-12  27%  707 aa  SGM1_YEAST RecName: Full=Protein SGM1;AltName: Full=Slow growth on
 1248::1770    1e-11  24% 2054 aa  MY18A_HUMAN RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  110::606     2e-11  26%  692 aa  MYSP_DERFA RecName: Full=Paramyosin;AltName: Full=Antigen
  550::1218    2e-11  25% 1391 aa  CLIP1_MOUSE RecName: Full=CAP-Gly domain-containing linker protein
  653::1096    2e-11  24% 3259 aa  GOGB1_HUMAN RecName: Full=Golgin subfamily B member 1;AltName:
  231::743     3e-11  22% 1411 aa  EEA1_HUMAN RecName: Full=Early endosome antigen 1;AltName:
  276::1063    4e-11  23% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein 150;
  564::1325    5e-11  24% 1364 aa  KTN1_CHICK RecName: Full=Kinectin;
  193::751     6e-11  23%  825 aa  ODFP2_RAT RecName: Full=Outer dense fiber protein 2;AltName:
   19::493     6e-11  22% 1583 aa  GCC2_HUMAN RecName: Full=GRIP and coiled-coil domain-containing
  653::1161    8e-11  23% 1411 aa  UACA_MOUSE RecName: Full=Uveal autoantigen with coiled-coil domains
 1248::1773    8e-11  23% 2050 aa  MY18A_MOUSE RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
   34::678     1e-10  22%  698 aa  TSG10_HUMAN RecName: Full=Testis-specific gene 10 protein;AltName:
  561::1251    1e-10  23% 1837 aa  NU211_SCHPO RecName: Full=Nucleoporin nup211;AltName: Full=Nuclear
  573::1283    1e-10  25% 1327 aa  KTN1_MOUSE RecName: Full=Kinectin;
  146::676     2e-10  25%  697 aa  MFP1_SOLLC RecName: Full=MAR-binding filament-like protein 1;
  432::894     3e-10  24%  978 aa  RAI14_RAT RecName: Full=Ankycorbin;AltName: Full=Ankyrin repeat and
  607::1237    3e-10  23% 1455 aa  CCD18_MOUSE RecName: Full=Coiled-coil domain-containing protein 18;
  663::1312    3e-10  21% 1709 aa  ANR26_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
   48::659     4e-10  22% 1468 aa  CE290_BOVIN RecName: Full=Centrosomal protein of 290 kDa;       
  127::594     5e-10  24% 1805 aa  HMW2_MYCGE RecName: Full=Cytadherence high molecular weight protein
  836::1297    5e-10  24% 2479 aa  CE290_HUMAN RecName: Full=Centrosomal protein of 290 kDa;       
  684::1331    7e-10  27% 1415 aa  UACA_CANFA RecName: Full=Uveal autoantigen with coiled-coil domains
  590::998     7e-10  27% 1130 aa  TG278_CAEEL RecName: Full=Putative protein tag-278;
  198::756     7e-10  23%  830 aa  ODFP2_MOUSE RecName: Full=Outer dense fiber protein 2;AltName:
  434::895     9e-10  24%  979 aa  RAI14_MOUSE RecName: Full=Ankycorbin;AltName: Full=Ankyrin repeat
  198::659     9e-10  23%  829 aa  ODFP2_HUMAN RecName: Full=Outer dense fiber protein 2;AltName:
   17::495     9e-10  25%  638 aa  MYSP_OPIFE RecName: Full=Paramyosin;Flags: Fragment;
  982::1289    9e-10  26% 2439 aa  CE290_DANRE RecName: Full=Centrosomal protein of 290 kDa;       
  231::630     1e-09  26%  691 aa  NDC80_YEAST RecName: Full=Kinetochore protein NDC80;AltName:
  863::1169    1e-09  23% 1928 aa  MYO1_YEAST RecName: Full=Myosin-1;AltName: Full=Type II myosin;
  850::1491    1e-09  24% 1774 aa  KI20B_MOUSE RecName: Full=Kinesin-like protein KIF20B;AltName:
   70::706     1e-09  23% 1679 aa  GCC2_MOUSE RecName: Full=GRIP and coiled-coil domain-containing
  740::1384    1e-09  24% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
  436::759     2e-09  22%  848 aa  CC110_MOUSE RecName: Full=Coiled-coil domain-containing protein
   34::692     2e-09  24%  712 aa  TSG10_RAT RecName: Full=Testis-specific gene 10 protein;AltName:
  953::1543    2e-09  24% 1946 aa  MYH15_HUMAN RecName: Full=Myosin-15;AltName: Full=Myosin heavy chain
  830::1559    2e-09  24% 2472 aa  CE290_MOUSE RecName: Full=Centrosomal protein of 290 kDa;       
 1022::1575    3e-09  23% 2363 aa  TPR_HUMAN RecName: Full=Nucleoprotein TPR;
  853::1090    3e-09  26% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
   72::281     3e-09  26%  388 aa  MRP4_STRPY RecName: Full=Fibrinogen- and Ig-binding
 1507::1881    3e-09  23% 2474 aa  CENPE_MOUSE RecName: Full=Centromere-associated protein E;AltName:
  118::719     3e-09  22% 1454 aa  CCD18_HUMAN RecName: Full=Coiled-coil domain-containing protein
  312::933     3e-09  23% 1101 aa  CC150_HUMAN RecName: Full=Coiled-coil domain-containing protein
  779::1433    3e-09  23% 1679 aa  MLP2_YEAST RecName: Full=Protein MLP2;AltName: Full=Myosin-like
 1406::1810    4e-09  21% 1938 aa  MYH13_HUMAN RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
 1198::1865    4e-09  23% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  957::1314    6e-09  23% 1481 aa  Y147_TNAVC RecName: Full=Leucine-rich repeat structural protein
   85::511     6e-09  26%  583 aa  ICR2_ARATH RecName: Full=Interactor of constitutive active ROPs 2,
 2351::2889    6e-09  24% 3210 aa  CENPF_HUMAN RecName: Full=Centromere protein F;AltName:
 1233::1912    1e-08  23% 1939 aa  MYH8_CANFA RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1441::1928    1e-08  25% 1940 aa  MYH3_RAT RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
  205::664     1e-08  21% 1312 aa  RAD50_RAT RecName: Full=DNA repair protein RAD50;       
   72::601     1e-08  22% 1051 aa  APSB_EMENI RecName: Full=Anucleate primary sterigmata protein B;
  112::503     2e-08  23%  564 aa  ICR3_ARATH RecName: Full=Interactor of constitutive active ROPs 3;
  236::604     2e-08  28%  729 aa  GOGA5_MOUSE RecName: Full=Golgin subfamily A member 5;AltName:
 1578::2152    2e-08  25% 2325 aa  CP110_HUMAN RecName: Full=Centriolin;AltName: Full=110 kDa
  316::731     2e-08  23%  875 aa  MYSP_BLOTA RecName: Full=Paramyosin;AltName: Allergen=Blo t 11;
  845::1479    2e-08  26% 1947 aa  MYO2_CAEEL RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain C;
 1441::1928    2e-08  25% 1940 aa  MYH3_MOUSE RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain 3;
   38::582     2e-08  24%  857 aa  MEDB_GIALA RecName: Full=Median body protein;
  379::975     2e-08  22% 2058 aa  DAPLE_XENLA RecName: Full=Daple-like protein;AltName:
  722::1113    2e-08  25% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
   17::535     3e-08  23%  601 aa  TSG10_MACFA RecName: Full=Testis-specific gene 10 protein;
   23::764     3e-08  21%  866 aa  MYSP_SCHJA RecName: Full=Paramyosin;AltName: Full=Antigen Sj97;
  900::1316    3e-08  25% 1966 aa  MYO4_CAEEL RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain B;
  229::597     3e-08  28%  722 aa  GOGA5_XENLA RecName: Full=Golgin subfamily A member 5;AltName:
   71::612     3e-08  21% 1060 aa  F184B_HUMAN RecName: Full=Protein FAM184B;
  293::533     3e-08  31%  703 aa  CEP63_MACFA RecName: Full=Centrosomal protein of 63 kDa;       
 1421::1928    4e-08  25% 1940 aa  MYH3_HUMAN RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 2395::2978    4e-08  22% 9439 aa  EBH_STAES RecName: Full=Extracellular matrix-binding protein
 2395::2978    4e-08  22% 9439 aa  EBH_STAEQ RecName: Full=Extracellular matrix-binding protein
  611::1135    4e-08  22% 1251 aa  CING_XENTR RecName: Full=Cingulin;
  295::718     5e-08  22%  875 aa  ZIP1_YEAST RecName: Full=Synaptonemal complex protein ZIP1;
  531::1183    5e-08  22% 1335 aa  SOJO_XENLA RecName: Full=Cytoskeletal protein Sojo;AltName:
 1109::1616    5e-08  19% 1820 aa  KI20B_HUMAN RecName: Full=Kinesin-like protein KIF20B;AltName:
  144::396     5e-08  21%  581 aa  IFA2_CAEEL RecName: Full=Intermediate filament protein
  368::739     5e-08  20% 1102 aa  CN145_MOUSE RecName: Full=Uncharacterized protein C14orf145
  813::1145    5e-08  26% 1153 aa  CING_SORAR RecName: Full=Cingulin;
  157::603     6e-08  22% 1116 aa  RB6I2_HUMAN RecName: Full=ELKS/RAB6-interacting/CAST family member
  708::1102    6e-08  24% 1388 aa  KIF15_HUMAN RecName: Full=Kinesin-like protein KIF15;AltName:
  104::763     6e-08  22%  794 aa  HMMR_MOUSE RecName: Full=Hyaluronan mediated motility
 1110::1592    6e-08  22% 3678 aa  DMD_MOUSE RecName: Full=Dystrophin;
  611::979     6e-08  28% 1438 aa  CLIP1_HUMAN RecName: Full=CAP-Gly domain-containing linker protein
  857::1182    6e-08  25% 1427 aa  C144A_HUMAN RecName: Full=Coiled-coil domain-containing protein 144A;
 1582::1791    8e-08  27% 1939 aa  MYH6_HUMAN RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
   27::645     8e-08  21%  941 aa  CCD39_HUMAN RecName: Full=Coiled-coil domain-containing protein 39;
   94::552     8e-08  25%  678 aa  CASP_PONAB RecName: Full=Protein CASP;
  609::992     8e-08  22% 1237 aa  C144C_HUMAN RecName: Full=Coiled-coil domain-containing protein
  110::322     1e-07  27%  406 aa  RIPL1_MOUSE RecName: Full=RILP-like protein 1;AltName:
  853::1107    1e-07  25% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
  319::656     1e-07  22%  726 aa  MFP1_ARATH RecName: Full=MAR-binding filament-like protein 1;
  708::1102    1e-07  21% 1387 aa  KIF15_MOUSE RecName: Full=Kinesin-like protein KIF15;AltName:
  238::623     1e-07  24%  731 aa  GOGA5_HUMAN RecName: Full=Golgin subfamily A member 5;AltName:
  323::967     1e-07  23% 2028 aa  DAPLE_HUMAN RecName: Full=Protein Daple;AltName:
  490::748     1e-07  22% 1094 aa  CN145_HUMAN RecName: Full=Uncharacterized protein C14orf145;
   56::562     1e-07  22%  692 aa  CCD41_MOUSE RecName: Full=Coiled-coil domain-containing protein 41;
 1138::1365    1e-07  25% 2057 aa  MYSN_DROME RecName: Full=Myosin heavy chain, non-muscle;AltName:
  115::600     1e-07  26%  704 aa  MAD1_YARLI RecName: Full=Spindle assembly checkpoint component
  236::636     1e-07  24%  728 aa  GOGA5_RAT RecName: Full=Golgin subfamily A member 5;AltName:
  926::1256    1e-07  27% 1487 aa  GOGA3_MOUSE RecName: Full=Golgin subfamily A member 3;AltName:
  465::1041    2e-07  21% 1354 aa  ROCK1_MOUSE RecName: Full=Rho-associated protein kinase 1;       
  201::590     2e-07  24% 1412 aa  FHAD1_HUMAN RecName: Full=Forkhead-associated domain-containing
   37::383     2e-07  27%  603 aa  CCD67_MACFA RecName: Full=Coiled-coil domain-containing protein 67;
  106::430     2e-07  23%  475 aa  CC64B_XENTR RecName: Full=Coiled-coil domain-containing protein
   94::552     2e-07  25%  678 aa  CASP_HUMAN RecName: Full=Protein CASP;
  313::537     2e-07  23%  627 aa  WIT2_ARATH RecName: Full=WPP domain-interacting tail-anchored
   29::429     2e-07  23%  688 aa  SCLT1_RAT RecName: Full=Sodium channel and clathrin linker
  112::599     2e-07  24%  718 aa  HOOK1_CHICK RecName: Full=Protein Hook homolog 1;
  270::701     2e-07  25%  760 aa  GOGA5_DANRE RecName: Full=Golgin subfamily A member 5;AltName:
  685::1140    2e-07  24% 1298 aa  CGNL1_MOUSE RecName: Full=Cingulin-like protein 1;AltName:
  293::533     2e-07  27%  703 aa  CEP63_HUMAN RecName: Full=Centrosomal protein of 63 kDa;       
  861::1003    3e-07  27% 1067 aa  YAF3_SCHPO RecName: Full=Uncharacterized protein C29E6.03c;
  109::418     3e-07  28%  452 aa  RGP51_LYMST RecName: Full=Retrograde protein of 51 kDa;
 1396::1807    3e-07  23% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
 1421::1896    3e-07  22% 1940 aa  MYH3_CHICK RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1107::1424    3e-07  26% 1972 aa  MYH11_HUMAN RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  194::779     3e-07  24% 1115 aa  MBO1_SCHPO RecName: Full=Microtubule organizer protein 1;AltName:
  128::453     3e-07  27% 1139 aa  LIPA_CAEEL RecName: Full=Liprin-alpha;AltName: Full=LAR-interacting
  311::769     3e-07  25%  887 aa  IMH1_ASHGO RecName: Full=Golgin IMH1;
  273::540     4e-07  26%  713 aa  SDCG8_HUMAN RecName: Full=Serologically defined colon cancer
  184::842     4e-07  22% 1130 aa  SBCC_BACSU RecName: Full=Nuclease sbcCD subunit C;
  295::787     4e-07  22%  873 aa  MYSP_BOOMI RecName: Full=Paramyosin;
 1568::1791    4e-07  28% 1938 aa  MYH6_MOUSE RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  192::427     4e-07  24%  611 aa  GACN_DICDI RecName: Full=Rho GTPase-activating protein
  288::769     4e-07  22% 1131 aa  FIL1L_MOUSE RecName: Full=Filamin A-interacting protein
  408::740     4e-07  21% 1161 aa  CING_DANRE RecName: Full=Cingulin;
   62::425     4e-07  26%  633 aa  CASP_SCHPO RecName: Full=Protein CASP;
   94::454     4e-07  25%  678 aa  CASP_MOUSE RecName: Full=Protein CASP;
  358::653     5e-07  23% 1416 aa  UACA_HUMAN RecName: Full=Uveal autoantigen with coiled-coil domains
  451::983     5e-07  22% 1401 aa  UACA_BOVIN RecName: Full=Uveal autoantigen with coiled-coil domains
 1399::1776    5e-07  20% 1979 aa  TRIPB_HUMAN RecName: Full=Thyroid receptor-interacting protein 11;   
  373::931     5e-07  23% 1233 aa  SMC1A_MOUSE RecName: Full=Structural maintenance of chromosomes
  157::603     5e-07  21% 1120 aa  RB6I2_MOUSE RecName: Full=ELKS/RAB6-interacting/CAST family member
  687::1040    5e-07  22% 1401 aa  KIF27_HUMAN RecName: Full=Kinesin-like protein KIF27;
  381::1042    5e-07  26% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  200::787     5e-07  23% 1873 aa  GRDN_MOUSE RecName: Full=Girdin;AltName: Full=Girders of actin
  602::1200    5e-07  20% 1360 aa  CING_XENLA RecName: Full=Cingulin;
   44::196     7e-07  26%  284 aa  TPM_ECHMU RecName: Full=Tropomyosin;
   38::190     7e-07  26%  278 aa  TPM_ECHGR RecName: Full=Tropomyosin A;         Short=EgTrpA;Flags:
 1241::1609    7e-07  25% 1930 aa  MIA3_MOUSE RecName: Full=Melanoma inhibitory activity protein
  253::835     7e-07  24%  954 aa  CCD46_MOUSE RecName: Full=Coiled-coil domain-containing protein 46;
  247::436     9e-07  29%  447 aa  TEKT4_MOUSE RecName: Full=Tektin-4;AltName: Full=Testicular
  454::782     9e-07  22%  980 aa  RAI14_HUMAN RecName: Full=Ankycorbin;AltName: Full=Ankyrin repeat
  505::829     9e-07  26%  993 aa  RAD50_METMP RecName: Full=DNA double-strand break repair rad50
  453::850     9e-07  23%  879 aa  MYSP_ONCVO RecName: Full=Paramyosin;
  627::966     9e-07  23% 1875 aa  MLP1_YEAST RecName: Full=Protein MLP1;AltName: Full=Myosin-like
   67::492     9e-07  25% 1202 aa  LIPA1_HUMAN RecName: Full=Liprin-alpha-1;AltName: Full=Protein
  419::913     9e-07  21%  963 aa  KINH_RAT RecName: Full=Kinesin-1 heavy chain;AltName:
  258::585     9e-07  23%  600 aa  IFT74_HUMAN RecName: Full=Intraflagellar transport protein 74
  284::686     9e-07  27% 1135 aa  FIL1L_HUMAN RecName: Full=Filamin A-interacting protein
  724::1225    9e-07  23% 1581 aa  ANR26_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
  107::263     1e-06  30%  286 aa  PU92_SCICO RecName: Full=Puff II/9-2 protein;Flags: Precursor;
 1465::1861    1e-06  22% 1937 aa  MYH8_MOUSE RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1417::1911    1e-06  24% 1939 aa  MYH1_PIG RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  758::1117    1e-06  22% 2238 aa  GOGA4_MOUSE RecName: Full=Golgin subfamily A member 4;AltName:
  205::770     1e-06  25% 1405 aa  CNTLN_HUMAN RecName: Full=Centlein;AltName: Full=Centrosomal
   73::351     1e-06  24%  604 aa  CCD67_HUMAN RecName: Full=Coiled-coil domain-containing protein 67;
  246::915     1e-06  22%  955 aa  CCD46_HUMAN RecName: Full=Coiled-coil domain-containing protein 46;
  150::447     1e-06  25%  817 aa  BRE1_USTMA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
 1398::1861    2e-06  21% 1937 aa  MYH8_HUMAN RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1406::1812    2e-06  20% 1940 aa  MYH13_CANFA RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
 1597::2148    2e-06  21% 2205 aa  KIF1_DICDI RecName: Full=Kinesin-related protein 1;AltName:
  586::1035    2e-06  26% 1387 aa  KI15B_XENLA RecName: Full=Kinesin-like protein KIF15-B;AltName:
   23::417     2e-06  19%  711 aa  CEP63_CHICK RecName: Full=Centrosomal protein of 63 kDa;       
  254::607     2e-06  22%  703 aa  WIT1_ARATH RecName: Full=WPP domain-interacting tail-anchored
 1802::2144    2e-06  21% 2873 aa  WDR87_HUMAN RecName: Full=WD repeat-containing protein 87;AltName:
  160::409     2e-06  24% 1170 aa  SMC2_YEAST RecName: Full=Structural maintenance of chromosomes
  707::1040    2e-06  22% 1084 aa  MYSS_RABIT RecName: Full=Myosin heavy chain, skeletal muscle;Flags:
 1229::1653    2e-06  26% 1922 aa  KIF4_DICDI RecName: Full=Kinesin-related protein 4;AltName:
  100::378     2e-06  24%  431 aa  K1C18_DANRE RecName: Full=Keratin, type I cytoskeletal 18;AltName:
 1227::1714    2e-06  20% 2871 aa  DESP_HUMAN RecName: Full=Desmoplakin;         Short=DP;AltName:
  276::654     2e-06  22% 1654 aa  CE152_HUMAN RecName: Full=Centrosomal protein of 152 kDa;       
   38::299     2e-06  30%  820 aa  BICD2_MOUSE RecName: Full=Protein bicaudal D homolog 2;       
  181::331     3e-06  20%  550 aa  YA046_MOUSE RecName: Full=Uncharacterized protein ENSP00000361571
  408::635     3e-06  21%  638 aa  Y658_HAEIN RecName: Full=Uncharacterized ABC transporter
  679::904     3e-06  22%  962 aa  USO1_HUMAN RecName: Full=General vesicular transport factor
  317::430     3e-06  30%  593 aa  POF1B_MOUSE RecName: Full=Protein POF1B;
 1420::1913    3e-06  24% 1941 aa  MYH2_HUMAN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  413::722     3e-06  29%  911 aa  IMH1_YEAST RecName: Full=Golgin IMH1;AltName: Full=Integrins and
  238::558     3e-06  20% 1109 aa  CD158_MOUSE RecName: Full=Coiled-coil domain-containing protein
  241::563     3e-06  31%  693 aa  CCD41_HUMAN RecName: Full=Coiled-coil domain-containing protein
  107::407     3e-06  23%  524 aa  C102A_XENLA RecName: Full=Coiled-coil domain-containing protein
  477::733     4e-06  24%  771 aa  SLMAP_RABIT RecName: Full=Sarcolemmal membrane-associated protein; 
  268::621     4e-06  25%  649 aa  ODFP2_XENLA RecName: Full=Outer dense fiber protein 2;AltName:
  426::839     4e-06  23%  848 aa  MYSP_DIRIM RecName: Full=Paramyosin;Flags: Fragment;
 1561::1894    4e-06  21% 1938 aa  MYH1_HORSE RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  146::451     4e-06  22%  564 aa  M12_STRPY RecName: Full=M protein, serotype 12;Flags: Precursor;
  120::357     4e-06  24%  373 aa  IKIP_RAT RecName: Full=Inhibitor of nuclear factor kappa-B
  567::888     4e-06  22% 1219 aa  FKB15_HUMAN RecName: Full=FK506-binding protein 15;AltName:
  322::700     4e-06  20% 1140 aa  F184A_HUMAN RecName: Full=Protein FAM184A;
  437::856     4e-06  22% 1300 aa  ATG11_NEUCR RecName: Full=Autophagy-related protein 11;
  535::682     5e-06  34%  756 aa  Y328_MYCGE RecName: Full=Uncharacterized protein MG328;
    1::249     5e-06  19%  432 aa  OV71_ONCVO RecName: Full=Muscle cell intermediate filament protein
 1418::1911    5e-06  23% 1939 aa  MYH2_PIG RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1419::1912    5e-06  23% 1940 aa  MYH2_CANFA RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  340::680     5e-06  20%  722 aa  MFP1_TOBAC RecName: Full=MAR-binding filament-like protein 1-1;
  427::880     5e-06  24%  935 aa  KINH_SYNRA RecName: Full=Kinesin heavy chain;AltName: Full=Synkin;
  184::332     5e-06  26%  466 aa  GCOM1_HUMAN RecName: Full=GRINL1A complex locus protein 1;AltName:
   43::281     5e-06  28%  305 aa  CCD69_XENTR RecName: Full=Coiled-coil domain-containing protein 69;
   99::562     5e-06  23%  692 aa  CCD41_RAT RecName: Full=Coiled-coil domain-containing protein 41;
  187::725     5e-06  23%  837 aa  BRE1_CAEEL RecName: Full=E3 ubiquitin-protein ligase bre-1;        
  669::884     6e-06  22% 1009 aa  SBCC_STAS1 RecName: Full=Nuclease sbcCD subunit C;
   15::214     6e-06  24%  257 aa  MYH8_RAT RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
  283::687     6e-06  26%  957 aa  ERC2_MOUSE RecName: Full=ERC protein 2;AltName: Full=CAZ-associated
  283::687     6e-06  25%  957 aa  ERC2_HUMAN RecName: Full=ERC protein 2;
  701::841     6e-06  28% 1165 aa  ATG11_CANAL RecName: Full=Autophagy-related protein 11;
  240::510     8e-06  24% 1233 aa  SMC1_SCHPO RecName: Full=Structural maintenance of chromosomes
  132::578     8e-06  24%  948 aa  RB6I2_RAT RecName: Full=ELKS/RAB6-interacting/CAST family member 1;
  295::666     8e-06  23%  822 aa  ODFP2_CHICK RecName: Full=Outer dense fiber protein 2;AltName:
  425::692     8e-06  27%  876 aa  MYSP_SARSC RecName: Full=Paramyosin;
  349::796     8e-06  22%  864 aa  MYSP_MYTGA RecName: Full=Paramyosin;
  265::651     8e-06  25%  715 aa  HOOK1_DANRE RecName: Full=Protein Hook homolog 1;
  443::791     8e-06  22% 1132 aa  CYTSA_DANRE RecName: Full=Cytospin-A-A;AltName: Full=SPECC1-like
 1400::1799    8e-06  24% 2414 aa  CP250_MOUSE RecName: Full=Centrosome-associated protein
  504::1074    8e-06  23% 1164 aa  CP135_DANRE RecName: Full=Centrosomal protein of 135 kDa;       
  119::554     8e-06  22% 1326 aa  CI093_HUMAN RecName: Full=Uncharacterized protein C9orf93;
  419::822     8e-06  22% 1113 aa  CD158_HUMAN RecName: Full=Coiled-coil domain-containing protein
  186::523     1e-05  18%  549 aa  YA046_HUMAN RecName: Full=Uncharacterized protein ENSP00000361571;
  272::543     1e-05  27% 1418 aa  SMC4_YEAST RecName: Full=Structural maintenance of chromosomes
  387::898     1e-05  21% 1046 aa  SBCC_LACLA RecName: Full=Nuclease sbcCD subunit C;
  192::528     1e-05  20% 1312 aa  RAD50_HUMAN RecName: Full=DNA repair protein RAD50;       
  318::431     1e-05  30%  588 aa  POF1B_PONAB RecName: Full=Protein POF1B;
   49::419     1e-05  27%  641 aa  ODF2L_XENLA RecName: Full=Outer dense fiber protein 2-like;
  871::1243    1e-05  22% 2104 aa  MYO3_SCHPO RecName: Full=Myosin type-2 heavy chain 2;AltName:
 1397::1804    1e-05  23% 1939 aa  MYH6_MESAU RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1565::1898    1e-05  21% 1942 aa  MYH1_MOUSE RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  258::478     1e-05  25%  600 aa  IFT74_MOUSE RecName: Full=Intraflagellar transport protein 74
   69::536     1e-05  24%  575 aa  IFA1_CAEEL RecName: Full=Intermediate filament protein ifa-1;AltName:
    2::304     1e-05  26%  335 aa  CCD68_HUMAN RecName: Full=Coiled-coil domain-containing protein
   72::543     1e-05  28%  725 aa  BRE1_ASPFU RecName: Full=E3 ubiquitin-protein ligase bre1;       
   96::807     1e-05  24% 1727 aa  ALM1_SCHPO RecName: Full=Abnormal long morphology protein
   80::391     1e-05  21%  461 aa  VIME_ONCMY RecName: Full=Vimentin;
  170::455     1e-05  25%  550 aa  TXND2_RAT RecName: Full=Thioredoxin domain-containing protein
  319::432     1e-05  30%  595 aa  POF1B_HUMAN RecName: Full=Protein POF1B;AltName: Full=Premature
  273::464     1e-05  25%  532 aa  OPTN_XENLA RecName: Full=Optineurin;
  315::522     1e-05  29%  692 aa  MYS_PODCA RecName: Full=Myosin heavy chain;Flags: Fragment;
 1560::1892    1e-05  21% 1937 aa  MYH2_HORSE RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1562::1895    1e-05  21% 1939 aa  MYH1_HUMAN RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
 1562::1895    1e-05  21% 1939 aa  MYH1_CANFA RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  644::815     1e-05  26% 1674 aa  KI21A_HUMAN RecName: Full=Kinesin-like protein KIF21A;AltName:
   38::449     1e-05  25%  788 aa  GRIP_ARATH RecName: Full=Protein GRIP;         Short=AtGRIP;
  762::1331    1e-05  22% 1411 aa  EEA1_MOUSE RecName: Full=Early endosome antigen 1;
  191::631     1e-05  21%  693 aa  BRE1_CANGA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  443::976     2e-05  24% 1050 aa  Y4862_ARATH RecName: Full=Uncharacterized protein At4g38062;
    4::214     2e-05  19%  284 aa  TPM_LEPSA RecName: Full=Tropomyosin;
  211::327     2e-05  25% 1241 aa  SMC4_ARATH RecName: Full=Structural maintenance of chromosomes
  460::836     2e-05  24% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
  157::395     2e-05  25%  556 aa  OPTN_CHICK RecName: Full=Optineurin;AltName: Full=Ag9-C5;AltName:
  296::605     2e-05  26%  721 aa  HOOK2_XENLA RecName: Full=Protein Hook homolog 2;
  221::584     2e-05  25% 1315 aa  FTM_HUMAN RecName: Full=Protein fantom;AltName:
  280::476     2e-05  26%  777 aa  CAGE1_HUMAN RecName: Full=Cancer-associated gene 1 protein;        
  384::645     2e-05  29% 1415 aa  SMC4_DICDI RecName: Full=Structural maintenance of chromosomes
  212::411     2e-05  23% 1009 aa  SBCC_STAAW RecName: Full=Nuclease sbcCD subunit C;
  212::411     2e-05  23% 1009 aa  SBCC_STAAT RecName: Full=Nuclease sbcCD subunit C;
  212::411     2e-05  23% 1009 aa  SBCC_STAAE RecName: Full=Nuclease sbcCD subunit C;
  212::411     2e-05  23% 1009 aa  SBCC_STAAC RecName: Full=Nuclease sbcCD subunit C;
  212::411     2e-05  23% 1009 aa  SBCC_STAA3 RecName: Full=Nuclease sbcCD subunit C;
   82::557     2e-05  24%  757 aa  PIBF1_HUMAN RecName: Full=Progesterone-induced-blocking factor 1;
  147::363     2e-05  30%  763 aa  KLPA_EMENI RecName: Full=Kinesin-like protein klpA;
   77::534     2e-05  25%  712 aa  GOGC3_ARATH RecName: Full=Golgin candidate 3;       
  136::336     2e-05  26%  530 aa  GOGA5_CAEEL RecName: Full=Golgin-84;
  167::530     2e-05  27% 1893 aa  CK5P2_PANTR RecName: Full=CDK5 regulatory subunit-associated
  317::530     2e-05  27% 1893 aa  CK5P2_HUMAN RecName: Full=CDK5 regulatory subunit-associated
  469::862     2e-05  25%  905 aa  ATG23_DEBHA RecName: Full=Autophagy-related protein 23;
  407::592     2e-05  28%  891 aa  ARK2_ORYSJ RecName: Full=Armadillo repeat-containing kinesin-like
  198::595     3e-05  26%  688 aa  SCLT1_HUMAN RecName: Full=Sodium channel and clathrin linker
  537::1094    3e-05  22% 1354 aa  ROCK1_RABIT RecName: Full=Rho-associated protein kinase 1;       
  186::743     3e-05  22% 1003 aa  ROCK1_PANTR RecName: Full=Rho-associated protein kinase 1;       
  537::1094    3e-05  22% 1354 aa  ROCK1_HUMAN RecName: Full=Rho-associated protein kinase 1;       
  102::310     3e-05  24%  394 aa  RIPL1_XENTR RecName: Full=RILP-like protein 1;AltName:
 1394::1801    3e-05  25% 1934 aa  MYH7_MESAU RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1406::1811    3e-05  25% 1940 aa  MYH2_BOVIN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  229::660     3e-05  25%  821 aa  LIN5_CAEEL RecName: Full=Spindle apparatus protein lin-5;AltName:
  590::915     3e-05  24% 1232 aa  KIF4A_HUMAN RecName: Full=Chromosome-associated kinesin KIF4A;     
  706::1100    3e-05  21% 1385 aa  KIF15_RAT RecName: Full=Kinesin-like protein KIF15;AltName:
  218::415     3e-05  21%  467 aa  K1C1_CARAU RecName: Full=Keratin, type I cytoskeletal 50
  640::895     3e-05  27% 1637 aa  GEK_DROME RecName: Full=Serine/threonine-protein kinase Genghis
  283::687     3e-05  25%  957 aa  ERC2_RAT RecName: Full=ERC protein 2;AltName: Full=CAZ-associated
 3165::3506    3e-05  23% 4367 aa  DYHC_NEUCR RecName: Full=Dynein heavy chain, cytoplasmic;AltName:
 5177::5584    3e-05  23% 7389 aa  BPA1_MOUSE RecName: Full=Bullous pemphigoid antigen 1, isoforms
  175::380     4e-05  23%  557 aa  NFL_XENTR RecName: Full=Neurofilament light polypeptide;       
  213::425     4e-05  24%  642 aa  NDC80_MACFA RecName: Full=Kinetochore protein NDC80
  213::425     4e-05  24%  642 aa  NDC80_HUMAN RecName: Full=Kinetochore protein NDC80
   39::239     4e-05  24% 1102 aa  MYSC_CHICK RecName: Full=Myosin heavy chain, cardiac muscle
   18::200     4e-05  27%  665 aa  LMNA_XENLA RecName: Full=Lamin-A;
  214::543     4e-05  24% 1257 aa  LIPA2_MOUSE RecName: Full=Liprin-alpha-2;AltName: Full=Protein
  266::619     4e-05  25%  681 aa  HOOK_DROAN RecName: Full=Protein hook;
  258::451     4e-05  22% 1213 aa  FLIP1_HUMAN RecName: Full=Filamin-A-interacting protein 1;       
  404::775     4e-05  20% 1118 aa  CYTSA_MOUSE RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
   83::405     4e-05  27% 1515 aa  CUX1_MOUSE RecName: Full=Homeobox protein cut-like 1;AltName:
 1508::1356    4e-05  26% 2442 aa  CP250_HUMAN RecName: Full=Centrosome-associated protein
   15::403     4e-05  25%  541 aa  CEP63_PONAB RecName: Full=Centrosomal protein of 63 kDa;       
   98::394     4e-05  24%  649 aa  CE63A_XENLA RecName: Full=Centrosomal protein of 63 kDa-A;       
  245::610     4e-05  24%  700 aa  BRE1_YEAST RecName: Full=E3 ubiquitin-protein ligase BRE1;       
   85::412     4e-05  22%  754 aa  ATK3_ARATH RecName: Full=Kinesin-3;AltName: Full=Kinesin-like
   13::164     4e-05  26%  219 aa  AGL19_ARATH RecName: Full=Agamous-like MADS-box protein AGL19;
  510::685     5e-05  28% 1116 aa  YHLA_SCHPO RecName: Full=Uncharacterized calcium-binding protein
  611::974     5e-05  23% 1033 aa  Y474_MYCPN RecName: Full=Uncharacterized protein MG328 homolog;
  180::383     5e-05  18%  470 aa  XNIF_XENLA RecName: Full=Low molecular weight neuronal intermediate
   13::225     5e-05  29%  284 aa  TPM_LEPDS RecName: Full=Tropomyosin;AltName: Allergen=Lep d 10;
    4::196     5e-05  22%  284 aa  TPM1_BOMMO RecName: Full=Tropomyosin-1;
  325::626     5e-05  24%  841 aa  TAXB1_XENTR RecName: Full=Tax1-binding protein 1 homolog;
  520::755     5e-05  20%  993 aa  SYCP1_MOUSE RecName: Full=Synaptonemal complex protein 1;       
  212::362     5e-05  24% 1009 aa  SBCC_STAAN RecName: Full=Nuclease sbcCD subunit C;
  212::362     5e-05  24% 1009 aa  SBCC_STAAM RecName: Full=Nuclease sbcCD subunit C;
  212::362     5e-05  24% 1009 aa  SBCC_STAA9 RecName: Full=Nuclease sbcCD subunit C;
  212::362     5e-05  24% 1009 aa  SBCC_STAA2 RecName: Full=Nuclease sbcCD subunit C;
  212::362     5e-05  24% 1009 aa  SBCC_STAA1 RecName: Full=Nuclease sbcCD subunit C;
  273::464     5e-05  27%  469 aa  RUFY3_RAT RecName: Full=Protein RUFY3;AltName:
  273::464     5e-05  27%  469 aa  RUFY3_HUMAN RecName: Full=Protein RUFY3;AltName:
  323::734     5e-05  24% 1074 aa  RAD50_METAC RecName: Full=DNA double-strand break repair rad50
  568::795     5e-05  24%  862 aa  RABE1_HUMAN RecName: Full=Rab GTPase-binding effector protein
   40::227     5e-05  27%  880 aa  MYSP_BRUMA RecName: Full=Paramyosin;
  991::1183    5e-05  31% 1853 aa  MYO5A_MOUSE RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
  841::1102    5e-05  24% 1935 aa  MYH7_RAT RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1399::1810    5e-05  21% 1939 aa  MYH4_RAT RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
 1399::1810    5e-05  21% 1939 aa  MYH4_MOUSE RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
  981::1288    5e-05  21% 1972 aa  MYH11_MOUSE RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  509::935     5e-05  24% 1732 aa  MRCKA_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  109::427     5e-05  25%  583 aa  LAML3_XENLA RecName: Full=Lamin-L(III);AltName: Full=Lamin-B3;
  154::461     5e-05  23%  817 aa  KLP2_SCHPO RecName: Full=Kinesin-like protein 2;
  546::960     5e-05  19% 1234 aa  KIF4B_HUMAN RecName: Full=Chromosome-associated kinesin KIF4B;     
  144::388     5e-05  23%  581 aa  IFA3_CAEEL RecName: Full=Intermediate filament protein
   72::182     5e-05  29%  519 aa  CNPD1_PEDPA RecName: Full=2',3'-cyclic-nucleotide
  131::406     5e-05  24%  684 aa  CCD62_HUMAN RecName: Full=Coiled-coil domain-containing protein
  400::560     5e-05  26%  762 aa  CCD21_HUMAN RecName: Full=Coiled-coil domain-containing protein 21;
  645::862     5e-05  23% 1162 aa  ATG11_PICST RecName: Full=Autophagy-related protein 11;
  190::622     7e-05  21%  813 aa  TAXB1_PONAB RecName: Full=Tax1-binding protein 1 homolog;
  532::698     7e-05  24%  976 aa  SYCP1_HUMAN RecName: Full=Synaptonemal complex protein 1;       
  575::930     7e-05  21% 1198 aa  SPD5_CAEEL RecName: Full=Spindle-defective protein 5;
  212::411     7e-05  23% 1009 aa  SBCC_STAAS RecName: Full=Nuclease sbcCD subunit C;
  212::411     7e-05  21% 1009 aa  SBCC_STAA8 RecName: Full=Nuclease sbcCD subunit C;
  166::321     7e-05  26%  403 aa  RIPL1_HUMAN RecName: Full=RILP-like protein 1;AltName:
  556::795     7e-05  27%  862 aa  RABE1_RAT RecName: Full=Rab GTPase-binding effector protein
  568::795     7e-05  24%  862 aa  RABE1_MOUSE RecName: Full=Rab GTPase-binding effector protein
  567::846     7e-05  22% 1251 aa  QN1_COTCO RecName: Full=Protein quail neuroretina 1;Flags:
  416::703     7e-05  30%  703 aa  NDC80_CRYNE RecName: Full=Probable kinetochore protein NDC80;
  419::836     7e-05  22%  866 aa  MYSP_SCHMA RecName: Full=Paramyosin;
  155::409     7e-05  22%  436 aa  KRT34_HUMAN RecName: Full=Keratin, type I cuticular Ha4;AltName:
  107::420     7e-05  23%  520 aa  ION3_CARAU RecName: Full=Intermediate filament protein ON3;
  126::279     7e-05  32%  576 aa  IFEA_HELAS RecName: Full=Non-neuronal cytoplasmic intermediate
  193::801     7e-05  17% 2230 aa  GOGA4_HUMAN RecName: Full=Golgin subfamily A member 4;AltName:
  136::509     7e-05  23%  767 aa  GOGA1_HUMAN RecName: Full=Golgin subfamily A member 1;AltName:
  613::864     7e-05  21% 1381 aa  EDE1_YEAST RecName: Full=EH domain-containing and endocytosis
 1336::2049    7e-05  21% 3674 aa  DMD_PIG RecName: Full=Dystrophin;
  240::701     7e-05  24% 1118 aa  CYTSA_CHICK RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  275::530     7e-05  25%  700 aa  CEP63_MOUSE RecName: Full=Centrosomal protein of 63 kDa;       
   93::261     7e-05  25%  793 aa  ATK1_ARATH RecName: Full=Kinesin-1;AltName: Full=Kinesin-like
  881::1287    7e-05  24% 1477 aa  AN30B_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
  247::436     9e-05  31%  447 aa  TEKT4_RAT RecName: Full=Tektin-4;
  254::949     9e-05  21% 1114 aa  SMC6_YEAST RecName: Full=Structural maintenance of chromosomes
  181::433     9e-05  25% 1230 aa  SMC3_YEAST RecName: Full=Structural maintenance of chromosomes
  304::526     9e-05  24%  606 aa  RUFY2_PONAB RecName: Full=RUN and FYVE domain-containing protein 2;
  353::575     9e-05  24%  655 aa  RUFY2_HUMAN RecName: Full=RUN and FYVE domain-containing protein
  436::611     9e-05  22% 1022 aa  PMFBP_MOUSE RecName: Full=Polyamine-modulated factor 1-binding
   97::384     9e-05  25% 1505 aa  CUX1_HUMAN RecName: Full=Homeobox protein cut-like 1;AltName:
  317::527     9e-05  27%  862 aa  CK5P2_MACFA RecName: Full=CDK5 regulatory subunit-associated
  129::467     1e-04  26%  660 aa  YNP9_CAEEL RecName: Full=GRIP and coiled-coil domain-containing
   13::272     1e-04  26%  284 aa  TPM1_CIOIN RecName: Full=Tropomyosin, smooth muscle/fibroblast
  176::438     1e-04  18%  814 aa  TAXB1_MOUSE RecName: Full=Tax1-binding protein 1 homolog;
  331::488     1e-04  22%  717 aa  SDCG8_MOUSE RecName: Full=Serologically defined colon cancer
  478::603     1e-04  27% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
  121::361     1e-04  21%  869 aa  MYSP_ANISI RecName: Full=Paramyosin;AltName: Allergen=Ani s 2;
  780::1090    1e-04  25% 1568 aa  MYO2_SACBA RecName: Full=Myosin-2;AltName: Full=Class V
  841::1102    1e-04  24% 1935 aa  MYH7_BOVIN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  419::810     1e-04  24% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  829::942     1e-04  20% 2779 aa  LVA_DROME RecName: Full=Protein lava lamp;
  580::914     1e-04  26% 1231 aa  KIF4_MOUSE RecName: Full=Chromosome-associated kinesin KIF4;       
  162::485     1e-04  21%  601 aa  K2C5_BOVIN RecName: Full=Keratin, type II cytoskeletal 5;AltName:
  173::608     1e-04  23%  719 aa  HOOK3_XENLA RecName: Full=Protein Hook homolog 3;
  876::1007    1e-04  32% 1690 aa  CL190_DROME RecName: Full=Restin homolog;AltName: Full=Cytoplasmic
  236::635     1e-04  21%  955 aa  CC146_HUMAN RecName: Full=Coiled-coil domain-containing protein
    1::244     1e-04  19%  284 aa  TPM_MIMNO RecName: Full=Tropomyosin;
   13::231     1e-04  23%  284 aa  TPM_DERPT RecName: Full=Tropomyosin;AltName: Allergen=Der p 10;
  810::995     1e-04  27% 1191 aa  SMC2_MOUSE RecName: Full=Structural maintenance of chromosomes
   18::211     1e-04  29%  527 aa  SEC2_SCHPO RecName: Full=Rab guanine nucleotide exchange factor
  212::409     1e-04  23% 1009 aa  SBCC_STAAR RecName: Full=Nuclease sbcCD subunit C;
  273::464     1e-04  27%  469 aa  RUFY3_PONAB RecName: Full=Protein RUFY3;
  469::594     1e-04  27% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
   11::262     1e-04  22%  441 aa  ROCK1_BOVIN RecName: Full=Rho-associated protein kinase 1;       
  102::312     1e-04  24%  394 aa  RIPL1_XENLA RecName: Full=RILP-like protein 1;AltName:
  166::321     1e-04  26%  403 aa  RIPL1_BOVIN RecName: Full=RILP-like protein 1;AltName:
  393::720     1e-04  21% 1208 aa  PCP1_SCHPO RecName: Full=Spindle pole body protein pcp1;
  338::491     1e-04  30%  882 aa  MYSP_CAEEL RecName: Full=Paramyosin;AltName: Full=Uncoordinated
 1192::1317    1e-04  20% 1979 aa  MYH11_CHICK RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  581::945     1e-04  21% 1732 aa  MRCKA_RAT RecName: Full=Serine/threonine-protein kinase MRCK alpha;
  235::620     1e-04  22% 1871 aa  GRDN_HUMAN RecName: Full=Girdin;AltName: Full=Girders of actin
  219::452     1e-04  27% 1265 aa  DCTN1_DROME RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
  443::843     1e-04  22% 2055 aa  CTRO_MOUSE RecName: Full=Citron Rho-interacting kinase;       
  578::975     1e-04  22% 1047 aa  CLIP2_MOUSE RecName: Full=CAP-Gly domain-containing linker protein
  195::426     1e-04  25%  689 aa  CASP_ARATH RecName: Full=Protein CASP;
  426::760     1e-04  24%  903 aa  ANR62_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
  575::903     2e-04  21% 1121 aa  U634B_HUMAN RecName: Full=UPF0634 protein B;AltName:
  574::902     2e-04  21% 1120 aa  U634A_HUMAN RecName: Full=UPF0634 protein KIAA1641;
  246::385     2e-04  27%  568 aa  TRAF3_HUMAN RecName: Full=TNF receptor-associated factor 3;AltName:
   11::213     2e-04  26%  526 aa  RICKA_RICFE RecName: Full=Arp2/3 complex-activating protein
 1296::1488    2e-04  24% 2245 aa  MYOJ_DICDI RecName: Full=Myosin-J heavy chain;AltName:
  991::1185    2e-04  30% 1828 aa  MYO5A_RAT RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
  991::1185    2e-04  30% 1855 aa  MYO5A_HUMAN RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
  960::1277    2e-04  22% 1526 aa  MYO2_SCHPO RecName: Full=Myosin type-2 heavy chain 1;AltName:
  841::1102    2e-04  30% 1935 aa  MYH7_HUMAN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
  501::935     2e-04  25% 1719 aa  MRCKA_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
   28::247     2e-04  23%  498 aa  MNS1_RAT RecName: Full=Meiosis-specific nuclear structural protein
  113::367     2e-04  21%  392 aa  KRT34_MOUSE RecName: Full=Keratin, type I cuticular Ha4;AltName:
   21::123     2e-04  35%  598 aa  KLP3_CAEEL RecName: Full=Kinesin-like protein klp-3;
  458::756     2e-04  21%  975 aa  KINH_DROME RecName: Full=Kinesin heavy chain;
  616::995     2e-04  20% 1226 aa  KIF4_XENLA RecName: Full=Chromosome-associated kinesin KIF4;       
  163::486     2e-04  22%  592 aa  K2C5_PANTR RecName: Full=Keratin, type II cytoskeletal 5;AltName:
  161::484     2e-04  22%  590 aa  K2C5_HUMAN RecName: Full=Keratin, type II cytoskeletal 5;AltName:
  120::378     2e-04  22%  575 aa  IFD1_CAEEL RecName: Full=Intermediate filament protein
  718::884     2e-04  24% 1173 aa  FBF1_MOUSE RecName: Full=Fas-binding factor 1;         Short=FBF-1;
  497::603     2e-04  30%  702 aa  ATI1_VARV RecName: Full=81 kDa A-type inclusion protein;       
  245::384     3e-04  27%  567 aa  TRAF3_MOUSE RecName: Full=TNF receptor-associated factor 3;AltName:
  249::378     3e-04  30%  627 aa  SAS6_DANRE RecName: Full=Spindle assembly abnormal protein 6
  237::464     3e-04  27%  469 aa  RUFY3_MOUSE RecName: Full=Protein RUFY3;AltName:
  186::480     3e-04  31% 1266 aa  RHG29_MOUSE RecName: Full=Rho GTPase-activating protein 29;AltName:
  661::819     3e-04  28%  979 aa  P115_MYCHR RecName: Full=Protein P115;
 1612::1935    3e-04  22% 1935 aa  MYH7_PIG RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1612::1935    3e-04  22% 1935 aa  MYH7_MOUSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1397::1518    3e-04  23% 1937 aa  MYH4_PIG RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
  149::466     3e-04  23%  551 aa  K2C75_MOUSE RecName: Full=Keratin, type II cytoskeletal 75;AltName:
  148::289     3e-04  25%  460 aa  K1C27_CAPHI RecName: Full=Keratin, type I cytoskeletal 27;AltName:
  148::289     3e-04  25%  460 aa  K1C27_BOVIN RecName: Full=Keratin, type I cytoskeletal 27;AltName:
  125::420     3e-04  20%  472 aa  K1C14_HUMAN RecName: Full=Keratin, type I cytoskeletal 14;AltName:
  137::416     3e-04  21%  492 aa  K1C13_ONCMY RecName: Full=Keratin, type I cytoskeletal 13;AltName:
  503::696     3e-04  24%  766 aa  EMIL3_HUMAN RecName: Full=EMILIN-3;AltName: Full=Elastin
  403::774     3e-04  20% 1117 aa  CYTSA_PANTR RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  403::774     3e-04  20% 1117 aa  CYTSA_HUMAN RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  357::493     3e-04  27%  945 aa  CF174_MOUSE RecName: Full=Uncharacterized protein C6orf174
   63::216     3e-04  24%  499 aa  CEP57_BOVIN RecName: Full=Centrosomal protein of 57 kDa;       
  640::785     3e-04  29%  827 aa  CCD45_MOUSE RecName: Full=Coiled-coil domain-containing protein 45;
  138::355     3e-04  27%  691 aa  CACO1_PONAB RecName: Full=Calcium-binding and coiled-coil
    1::211     3e-04  19%  394 aa  AV71_ACAVI RecName: Full=Muscle cell intermediate filament protein
  446::806     3e-04  22% 1738 aa  ACTNB_DICDI RecName: Full=Interaptin;AltName: Full=Alpha-actinin
  221::479     3e-04  27% 2365 aa  TARA_HUMAN RecName: Full=TRIO and F-actin-binding protein;AltName:
  472::625     3e-04  26%  883 aa  SYA_SILST RecName: Full=Alanyl-tRNA synthetase;       
  529::725     3e-04  23%  896 aa  RAD50_THEAC RecName: Full=DNA double-strand break repair rad50
   78::459     3e-04  23%  517 aa  OPTN_DANRE RecName: Full=Optineurin;
 1398::1809    3e-04  20% 1938 aa  MYH1_BOVIN RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
  309::480     3e-04  24% 1487 aa  MUKB_VIBVY RecName: Full=Chromosome partition protein mukB;AltName:
  309::480     3e-04  24% 1487 aa  MUKB_VIBVU RecName: Full=Chromosome partition protein mukB;AltName:
 1211::1579    3e-04  22% 1905 aa  MIA3_BOVIN RecName: Full=Melanoma inhibitory activity protein
 1024::1290    3e-04  21% 1593 aa  LAMC1_DANRE RecName: Full=Laminin subunit gamma-1;Flags: Precursor;
  150::404     3e-04  22%  473 aa  KRT36_MOUSE RecName: Full=Keratin, type I cuticular Ha6;AltName:
  176::465     3e-04  25%  551 aa  K2C75_HUMAN RecName: Full=Keratin, type II cytoskeletal 75;AltName:
  111::383     3e-04  25%  438 aa  K1C18_ONCMY RecName: Full=Keratin, type I cytoskeletal 18;AltName:
  112::363     3e-04  20%  411 aa  K1C12_RABIT RecName: Full=Keratin, type I cytoskeletal 12;AltName:
  124::251     3e-04  29%  450 aa  IFEB_HELPO RecName: Full=Non-neuronal cytoplasmic intermediate
  123::377     3e-04  21%  443 aa  IFD2_CAEEL RecName: Full=Intermediate filament protein
   18::415     3e-04  20%  575 aa  IFA4_CAEEL RecName: Full=Intermediate filament protein
  185::382     3e-04  24%  396 aa  ICR5_ARATH RecName: Full=Interactor of constitutive active ROPs 5;
  247::459     3e-04  23%  685 aa  HOOK_AEDAE RecName: Full=Protein hook;
  143::317     3e-04  21%  588 aa  GR1_ARATH RecName: Full=Protein gamma response 1;AltName:
  372::769     3e-04  24%  956 aa  GOGC5_ARATH RecName: Full=Golgin candidate 5;         Short=AtGC5;
  177::340     3e-04  27%  725 aa  GOGC4_ARATH RecName: Full=Golgin candidate 4;         Short=AtGC4;
  289::439     3e-04  24% 1224 aa  DCTN1_CHICK RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
  445::588     3e-04  21% 2027 aa  CTRO_HUMAN RecName: Full=Citron Rho-interacting kinase;       
   96::214     3e-04  27%  535 aa  CNPD_STRA5 RecName: Full=2',3'-cyclic-nucleotide
   96::214     3e-04  27%  535 aa  CNPD_STRA3 RecName: Full=2',3'-cyclic-nucleotide
   96::214     3e-04  27%  535 aa  CNPD_STRA1 RecName: Full=2',3'-cyclic-nucleotide
  666::861     3e-04  24%  905 aa  CIP2A_HUMAN RecName: Full=Protein CIP2A;AltName: Full=Cancerous
   78::202     3e-04  26%  247 aa  CENPH_HUMAN RecName: Full=Centromere protein H;       
  138::355     3e-04  27%  691 aa  CACO1_HUMAN RecName: Full=Calcium-binding and coiled-coil
  165::616     3e-04  21%  691 aa  BRE1_DEBHA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  475::680     3e-04  30% 1184 aa  BIMC_EMENI RecName: Full=Kinesin-like protein bimC;
  129::403     3e-04  26%  745 aa  ATK2_ARATH RecName: Full=Kinesin-2;AltName: Full=Kinesin-like
  687::789     4e-04  29% 1483 aa  Z518A_HUMAN RecName: Full=Zinc finger protein 518A;
  665::993     4e-04  21% 1211 aa  U634C_HUMAN RecName: Full=UPF0634 protein C;AltName: Full=Protein
  674::919     4e-04  24% 1097 aa  SMC6_MOUSE RecName: Full=Structural maintenance of chromosomes
  510::775     4e-04  25% 1163 aa  SBCC_CLOAB RecName: Full=Nuclease sbcCD subunit C;
  236::408     4e-04  19%  472 aa  SAS6_DROME RecName: Full=Spindle assembly abnormal protein 6
 2035::2348    4e-04  25% 2867 aa  RBP2_PLAVB RecName: Full=Reticulocyte-binding protein 2;AltName:
  122::369     4e-04  15%  916 aa  NFM_HUMAN RecName: Full=Neurofilament medium polypeptide;       
  841::1060    4e-04  25% 1938 aa  MYH6_RAT RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
   59::314     4e-04  24%  440 aa  MTS1A_DANRE RecName: Full=Mitochondrial tumor suppressor 1 homolog
  104::311     4e-04  28%  657 aa  LMNA_CHICK RecName: Full=Lamin-A;
   87::257     4e-04  20%  969 aa  LIPB1_MOUSE RecName: Full=Liprin-beta-1;AltName: Full=Protein
  416::889     4e-04  20%  963 aa  KINH_HUMAN RecName: Full=Kinesin-1 heavy chain;AltName:
   68::289     4e-04  23%  344 aa  ICR1_ARATH RecName: Full=Interactor of constitutive active ROPs 1;
  275::422     4e-04  27%  718 aa  HOOK3_HUMAN RecName: Full=Protein Hook homolog 3;       
  161::527     4e-04  20% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
  738::941     4e-04  26% 1054 aa  FPP6_ARATH RecName: Full=Filament-like plant protein 6;       
   63::174     4e-04  33%  524 aa  CNPD_DESHY RecName: Full=2',3'-cyclic-nucleotide
  660::856     4e-04  23%  907 aa  CIP2A_MOUSE RecName: Full=Protein CIP2A;AltName: Full=Cancerous
  790::1014    4e-04  29% 1191 aa  CING_MOUSE RecName: Full=Cingulin;
  564::875     4e-04  23% 1302 aa  CGNL1_HUMAN RecName: Full=Cingulin-like protein 1;AltName:
  343::631     4e-04  20%  872 aa  CC147_HUMAN RecName: Full=Coiled-coil domain-containing protein
  138::332     4e-04  24%  680 aa  CACO1_BOVIN RecName: Full=Calcium-binding and coiled-coil
 1649::2041    4e-04  21% 5171 aa  BPAEA_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  431::709     4e-04  21%  945 aa  ARK1_ORYSJ RecName: Full=Armadillo repeat-containing kinesin-like
   57::198     6e-04  26%  248 aa  YTTA_BACSU RecName: Full=Uncharacterized membrane protein yttA;
  160::353     6e-04  22%  390 aa  TUFT1_BOVIN RecName: Full=Tuftelin;AltName: Full=Enamelin;
  190::584     6e-04  21%  789 aa  TAXB1_HUMAN RecName: Full=Tax1-binding protein 1;AltName:
  532::785     6e-04  25%  926 aa  TAF1_SCHPO RecName: Full=Taz1-interacting factor 1;       
 5166::5467    6e-04  23% 6885 aa  SYNE2_HUMAN RecName: Full=Nesprin-2;AltName: Full=Nuclear envelope
  565::621     6e-04  31% 1165 aa  SPAG5_MOUSE RecName: Full=Sperm-associated antigen 5;AltName:
  428::755     6e-04  24%  828 aa  SLMAP_HUMAN RecName: Full=Sarcolemmal membrane-associated protein; 
  122::369     6e-04  15%  926 aa  NFM_BOVIN RecName: Full=Neurofilament medium polypeptide;       
  213::496     6e-04  21%  642 aa  NDC80_MOUSE RecName: Full=Kinetochore protein NDC80
  104::425     6e-04  22% 2346 aa  MYOME_HUMAN RecName: Full=Myomegalin;AltName:
 1094::1294    6e-04  27% 1485 aa  MUKB_EDWI9 RecName: Full=Chromosome partition protein mukB;AltName:
   98::235     6e-04  29%  299 aa  LZTL1_PONAB RecName: Full=Leucine zipper transcription factor-like
   98::235     6e-04  29%  299 aa  LZTL1_HUMAN RecName: Full=Leucine zipper transcription factor-like
   37::327     6e-04  26% 1043 aa  LIPA4_RAT RecName: Full=Liprin-alpha-4;AltName: Full=Protein
  183::573     6e-04  21%  677 aa  HOOK_DROPS RecName: Full=Protein hook;
  183::573     6e-04  21%  677 aa  HOOK_DROPE RecName: Full=Protein hook;
 2333::2446    6e-04  25% 3672 aa  EPI1_CAEEL RecName: Full=Laminin-like protein epi-1;Flags: Precursor;
  150::274     6e-04  24%  310 aa  EFC4B_MOUSE RecName: Full=EF-hand calcium-binding domain-containing
  168::556     6e-04  19%  820 aa  BRE1_CRYNE RecName: Full=E3 ubiquitin-protein ligase BRE1;       
   61::297     6e-04  24%  984 aa  BRE1A_CHICK RecName: Full=E3 ubiquitin-protein ligase BRE1A;       
  565::833     6e-04  23% 1371 aa  ATG11_EMENI RecName: Full=Autophagy-related protein 11;
  348::645     7e-04  21%  662 aa  TLPA_BACSU RecName: Full=Methyl-accepting chemotaxis protein tlpA;
  228::473     7e-04  21%  477 aa  TFB1_SCHPO RecName: Full=RNA polymerase II transcription factor B
  304::488     7e-04  25% 1189 aa  SMC2_CHICK RecName: Full=Structural maintenance of chromosomes
  484::603     7e-04  27% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
    6::186     7e-04  19%  357 aa  RF1_BORBZ RecName: Full=Peptide chain release factor 1;       
    6::186     7e-04  19%  357 aa  RF1_BORBU RecName: Full=Peptide chain release factor 1;       
   95::464     7e-04  23%  584 aa  OPTN_MOUSE RecName: Full=Optineurin;
 1495::1604    7e-04  29% 2035 aa  NIN_MOUSE RecName: Full=Ninein;
 1474::1688    7e-04  19% 2090 aa  NIN_HUMAN RecName: Full=Ninein;AltName: Full=hNinein;AltName:
  250::445     7e-04  23%  640 aa  MYSP2_DROME RecName: Full=Paramyosin, short form;AltName:
  760::997     7e-04  19% 1574 aa  MYO2_YEAST RecName: Full=Myosin-2;AltName: Full=Class V
 1612::1935    7e-04  22% 1935 aa  MYH7_CANFA RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1398::1511    7e-04  25% 1938 aa  MYH4_RABIT RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
 1182::1333    7e-04  28% 1939 aa  MYH4_HUMAN RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
 1750::2128    7e-04  26% 3106 aa  LAMA2_MOUSE RecName: Full=Laminin subunit alpha-2;AltName:
  136::279     7e-04  24%  449 aa  K1C27_RAT RecName: Full=Keratin, type I cytoskeletal 27;AltName:
  136::279     7e-04  24%  448 aa  K1C27_MOUSE RecName: Full=Keratin, type I cytoskeletal 27;AltName:
  157::379     7e-04  21%  458 aa  IF3T_TORCA RecName: Full=Type III intermediate filament;
  247::597     7e-04  21%  691 aa  HOOK_CULQU RecName: Full=Protein hook;
  723::992     7e-04  24% 1068 aa  HIP1R_HUMAN RecName: Full=Huntingtin-interacting protein 1-related
  374::511     7e-04  31%  578 aa  DYTN_HUMAN RecName: Full=Dystrotelin;
  175::539     7e-04  21% 1232 aa  DCTN1_XENLA RecName: Full=Dynactin subunit 1;
   35::167     7e-04  26%  531 aa  CNPD_LACLA RecName: Full=2',3'-cyclic-nucleotide
   98::393     7e-04  23%  648 aa  CE63B_XENLA RecName: Full=Centrosomal protein of 63 kDa-B;       
  164::289     7e-04  35%  582 aa  BPS2_ACIAM RecName: Full=Protein bps2;
    4::282     0.001  22%  284 aa  TPM1_LIZAU RecName: Full=Tropomyosin alpha-1 chain;AltName:
  232::378     0.001  26%  685 aa  STIM1_HUMAN RecName: Full=Stromal interaction molecule 1;Flags:
  230::376     0.001  26%  683 aa  STIM1_BOVIN RecName: Full=Stromal interaction molecule 1;Flags:
  100::332     0.001  23%  400 aa  OMPA_THEMA RecName: Full=Outer membrane protein alpha;Flags:
  485::809     0.001  23% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
 1619::1808    0.001  24% 3075 aa  LAMA1_HUMAN RecName: Full=Laminin subunit alpha-1;       
  704::1105    0.001  21% 1463 aa  KIF15_STRPU RecName: Full=Kinesin-like protein KIF15;AltName:
  113::367     0.001  19%  404 aa  K1M2_SHEEP RecName: Full=Keratin, type I microfibrillar, 47.6
   94::208     0.001  28%  330 aa  IM30_ARATH RecName: Full=Probable membrane-associated 30 kDa
  135::455     0.001  23%  478 aa  GAS8_HUMAN RecName: Full=Growth arrest-specific protein 8;       
  961::1168    0.001  29% 1385 aa  FAT1_SCHPO RecName: Full=Actin-interacting protein 3 homolog;
  252::413     0.001  31%  567 aa  EZRA_BACP2 RecName: Full=Septation ring formation regulator ezrA;
  497::752     0.001  23%  758 aa  EMIL3_MOUSE RecName: Full=EMILIN-3;AltName: Full=Elastin
 3385::3496    0.001  35% 4625 aa  DYH1A_CHLRE RecName: Full=Dynein-1-alpha heavy chain, flagellar inner
  435::667     0.001  24% 3680 aa  DMD_CANFA RecName: Full=Dystrophin;
 1503::1808    0.001  22% 2017 aa  CROCC_HUMAN RecName: Full=Rootletin;AltName: Full=Ciliary rootlet
   35::167     0.001  25%  531 aa  CNPD_LACLS RecName: Full=2',3'-cyclic-nucleotide
   35::167     0.001  25%  531 aa  CNPD_LACLM RecName: Full=2',3'-cyclic-nucleotide
  580::974     0.001  23% 1046 aa  CLIP2_HUMAN RecName: Full=CAP-Gly domain-containing linker protein
  222::386     0.001  22%  550 aa  CLC4F_RAT RecName: Full=C-type lectin domain family 4 member
 1890::2252    0.001  23% 3214 aa  BPA1_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  558::705     0.001  21%  726 aa  ATI_CAMPS RecName: Full=A-type inclusion protein;       
  558::705     0.001  21%  726 aa  ATI_CAMPM RecName: Full=A-type inclusion protein;       
  558::705     0.001  21%  726 aa  ATI_CAMPC RecName: Full=A-type inclusion protein;       
 1716::1831    7e-04  24% 2414 aa  CP250_MOUSE RecName: Full=Centrosome-associated protein(query 340->455)
  256::445     6e-04  24%  575 aa  IFA1_CAEEL RecName: Full=Intermediate filament protein ifa-1;AltName:(query 232->424)
  493::695     4e-04  23%  757 aa  PIBF1_HUMAN RecName: Full=Progesterone-induced-blocking factor 1;(query 254->448)
  120::272     3e-04  21%  394 aa  AV71_ACAVI RecName: Full=Muscle cell intermediate filament protein(query 267->426)
  632::895     0.001  22%  905 aa  CIP2A_HUMAN RecName: Full=Protein CIP2A;AltName: Full=Cancerous(query 738->997)
    1::1300

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CP135_MOUSE     ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
RAI14_RAT       ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
RAI14_MOUSE     ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
MYH15_HUMAN     ----------------------------------------------------------------------
CE290_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       ----------------------------------------------------------------------
EBH_STAEQ       ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
ROCK1_MOUSE     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     ----------------------------------------------------------------------
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
LIPA_CAEEL      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
RB6I2_MOUSE     ----------------------------------------------------------------------
KIF27_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
MYH1_PIG        ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CE152_HUMAN     ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      ----------------------------------------------------------------------
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------------------------
SLMAP_RABIT     ----------------------------------------------------------------------
ODFP2_XENLA     ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYH1_HORSE      ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
F184A_HUMAN     ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ----------------------------------------------------------------------
SMC1_SCHPO      ----------------------------------------------------------------------
RB6I2_RAT       ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
HOOK1_DANRE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CI093_HUMAN     ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      ----------------------------------------------------------------------
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      ----------------------------------------------------------------------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_CANFA      ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
BRE1_CANGA      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
HOOK2_XENLA     ----------------------------------------------------------------------
FTM_HUMAN       ----------------------------------------------------------------------
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
ROCK1_PANTR     ----------------------------------------------------------------------
ROCK1_HUMAN     ----------------------------------------------------------------------
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       ----------------------------------------------------------------------
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      ----------------------------------------------------------------------
BPA1_MOUSE      ----------------------------------------------------------------------
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
HOOK_DROAN      ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      ----------------------------------------------------------------------
ATK3_ARATH      ----------------------------------------------------------------------
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       ----------------------------------------------------------------------
RUFY3_HUMAN     ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
LAML3_XENLA     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     ----------------------------------------------------------------------
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      ----------------------------------------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ----------------------------------------------------------------------
NDC80_CRYNE     ----------------------------------------------------------------------
MYSP_SCHMA      ----------------------------------------------------------------------
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC3_YEAST      ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      ----------------------------------------------------------------------
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
K2C5_BOVIN      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------------------------------------------------------
U634B_HUMAN     ----------------------------------------------------------------------
U634A_HUMAN     ----------------------------------------------------------------------
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K2C5_PANTR      ----------------------------------------------------------------------
K2C5_HUMAN      ----------------------------------------------------------------------
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
RUFY3_MOUSE     ----------------------------------------------------------------------
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     ----------------------------------------------------------------------
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ----------------------------------------------------------------------
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     ----------------------------------------------------------------------
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SBCC_CLOAB      ----------------------------------------------------------------------
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
ARK1_ORYSJ      ----------------------------------------------------------------------
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     ----------------------------------------------------------------------
MUKB_EDWI9      ----------------------------------------------------------------------
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ----------------------------------------------------------------------
HOOK_DROPS      ----------------------------------------------------------------------
HOOK_DROPE      ----------------------------------------------------------------------
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     ----------------------------------------------------------------------
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
TFB1_SCHPO      ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     ----------------------------------------------------------------------
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAMSIMEPNSSQNDITPTVESTEGDLGNEPSSTSPQP
CP135_MOUSE     ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
TSG10_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
RAI14_RAT       ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
RAI14_MOUSE     ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
MYH15_HUMAN     ----------------------------------------------------------------------
CE290_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
MYSP_SCHJA      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     --------------------------------------------QEELQNAVAETKARLLQEQGCAEEEA
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       ----------------------------------AINILQDKEDNSELVRAKEKLDQAINSQPSLNGTQE
EBH_STAEQ       ----------------------------------AINILQDKEDNSELVRAKEKLDQAINSQPSLNGTQE
CING_XENTR      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
ROCK1_MOUSE     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     ----------------------------------------------------------------------
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
LIPA_CAEEL      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
RB6I2_MOUSE     ----------------------------------------------------------------------
KIF27_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
MYH1_PIG        ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
KI15B_XENLA     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CE152_HUMAN     ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      ----------------------------------------------------------------------
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------------------------
SLMAP_RABIT     ----------------------------------------------------------------------
ODFP2_XENLA     ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYH1_HORSE      ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
F184A_HUMAN     ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ----------------------------------------------------------------------
SMC1_SCHPO      ----------------------------------------------------------------------
RB6I2_RAT       ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
HOOK1_DANRE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CI093_HUMAN     ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      ----------------------------------------------------------------------
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      ----------------------------------------------------------------------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_CANFA      ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
BRE1_CANGA      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
HOOK2_XENLA     ----------------------------------------------------------------------
FTM_HUMAN       ----------------------------------------------------------------------
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
ROCK1_PANTR     ----------------------------------------------------------------------
ROCK1_HUMAN     ----------------------------------------------------------------------
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       ----------------------------------------------------------------------
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      ----------------------------------------------------------------------
BPA1_MOUSE      ----------------------------------------------------------------------
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
HOOK_DROAN      ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      ----------------------------------------------------------------------
ATK3_ARATH      ----------------------------------------------------------------------
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       ----------------------------------------------------------------------
RUFY3_HUMAN     ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
LAML3_XENLA     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     ----------------------------------------------------------------------
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      ----------------------------------------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ----------------------------------------------------------------------
NDC80_CRYNE     ----------------------------------------------------------------------
MYSP_SCHMA      ----------------------------------------------------------------------
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC3_YEAST      ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      ----------------------------------------------------------------------
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
K2C5_BOVIN      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------------------------------------------------------
U634B_HUMAN     ----------------------------------------------------------------------
U634A_HUMAN     ----------------------------------------------------------------------
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K2C5_PANTR      ----------------------------------------------------------------------
K2C5_HUMAN      ----------------------------------------------------------------------
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
RUFY3_MOUSE     ----------------------------------------------------------------------
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     ----------------------------------------------------------------------
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ----------------------------------------------------------------------
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     ----------------------------------------------------------------------
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SBCC_CLOAB      ----------------------------------------------------------------------
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
ARK1_ORYSJ      ----------------------------------------------------------------------
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     ----------------------------------------------------------------------
MUKB_EDWI9      ----------------------------------------------------------------------
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ----------------------------------------------------------------------
HOOK_DROPS      ----------------------------------------------------------------------
HOOK_DROPE      ----------------------------------------------------------------------
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     ----------------------------------------------------------------------
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
TFB1_SCHPO      ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     ----------------------------------------------------------------------
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QIEPMQAFAATQSCPNASPDTNLCIDSQAREAEPRVRSERIANSLTKETGSTTSKISKQQRLRTPSRLSK
CP135_MOUSE     ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     --------------------------------EVQLSEEQIRNK-DEEIQQLRSKLEKAEKERNELRLNS
MYSP_DERFA      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      -----------------------------------VQVQTLMDNMTLERERESEKL-KDECKKLQSQYAS
CC150_MOUSE     ----------------------------------------------KCTALHSSMKTTQDLLAQEQRKNE
KTN1_CHICK      ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     -------------------------------------SEEQIRNKDEEIQQLRSKLEKVEKERNELRLSS
TSG10_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
RAI14_RAT       ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
ANR26_HUMAN     ---------------------------------------------TKKTSNEKNKVKNQQSMDDVDDLTQ
CE290_BOVIN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
RAI14_MOUSE     ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
MYH15_HUMAN     ----------------------------------------------------------------------
CE290_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
ICR2_ARATH      ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
MYH8_CANFA      ------------------------IDDLASNAETISKAEKMCRTLEDQVSELKTKEEEQQRLINDARLQT
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------------------------------
MYSP_SCHJA      --------------------------------------------------STTRLESRVRELEDILDLER
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     LLQRIQALESALELQKRLTEEALAESASCRERELRVEAEHAERVLTLSREMLELKADYERRLQTPQRLPQ
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       SINNYTTKRREAQNIASSADTIINNGDASIETENKIRVEEATNALNEAKQHLTADTTS---LKTEVRKLS
EBH_STAEQ       SINNYTTKRREAQNIASSADTIINNGDASIETENKIRVEEATNALNEAKQHLTADTTS---LKTEVRKLS
CING_XENTR      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
ROCK1_MOUSE     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     ----------------------------------------------------------------------
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
LIPA_CAEEL      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------KEKQDVLQKLLKEKDLLIKAKSDQ
SMC1A_MOUSE     ----------------------------------------------------------------------
RB6I2_MOUSE     ----------------------------------------------------------------------
KIF27_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     ------------------------------------------------------------------KLKR
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
MYH1_PIG        ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      ---------------------------QANSVEDRDKWVQTLDPLRKVTELKDEELAKQQIEKSSSQLDQ
KI15B_XENLA     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CE152_HUMAN     ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      ----------------------------------------------------------------------
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------------------------
SLMAP_RABIT     ----------------------------------------------------------------------
ODFP2_XENLA     ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYH1_HORSE      ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
F184A_HUMAN     ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ----------------------------------------------------------------------
SMC1_SCHPO      ----------------------------------------------------------------------
RB6I2_RAT       ---------------------------------PVSMASTVPHSLRQARDNTIMDLQTQLKLRENDLLRK
ODFP2_CHICK     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
HOOK1_DANRE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CI093_HUMAN     ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      ----------------------------------------------------------------------
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      ----------------------------------------------------------------------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_CANFA      ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
BRE1_CANGA      ----------------------------------------------------------------------
Y4862_ARATH     -----------------------------------------------------------------SRLAN
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
HOOK2_XENLA     ----------------------------------------------------------------------
FTM_HUMAN       ----------------------------------------------------------------------
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
ROCK1_PANTR     ----------------------------------------------------------------------
ROCK1_HUMAN     ----------------------------------------------------------------------
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       ----------------------------------------------------------------------
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      ----------------------------------------------------------------------
BPA1_MOUSE      ----------------------------------------------------------------------
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
HOOK_DROAN      ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      ----------------------------------------------------------------------
ATK3_ARATH      ----------------------------------------------------------------------
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       ----------------------------------------------------------------------
RUFY3_HUMAN     ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
LAML3_XENLA     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     ----------------------------------------------------------------------
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      ----------------------------------------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ----------------------------------------------------------------------
NDC80_CRYNE     ----------------------------------------------------------------------
MYSP_SCHMA      ----------------------------------------------------------------------
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC3_YEAST      ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      ----------------------------------------------------------------------
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
K2C5_BOVIN      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------------------------------------------------------
U634B_HUMAN     ----------------------------------------------------------------------
U634A_HUMAN     ----------------------------------------------------------------------
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K2C5_PANTR      ----------------------------------------------------------------------
K2C5_HUMAN      ----------------------------------------------------------------------
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
RUFY3_MOUSE     ----------------------------------------------------------------------
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     ----------------------------------------------------------------------
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ----------------------------------------------------------------------
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     ----------------------------------------------------------------------
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      -------------------------------------------------------------------LKS
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SBCC_CLOAB      ----------------------------------------------------------------------
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------IAQYRCQRTQAETEARTLAGMLREVERKNE
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------------------
ARK1_ORYSJ      ----------------------------------------------------------------------
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     ----------------------------------------------------------------------
MUKB_EDWI9      ----------------------------------------------------------------------
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ----------------------------------------------------------------------
HOOK_DROPS      ----------------------------------------------------------------------
HOOK_DROPE      ----------------------------------------------------------------------
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     ----------------------------------------------------------------------
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
TFB1_SCHPO      ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     ----------------------------------------------------------------------
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     ----------------------------------------------------------------------
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DTGKTSSLPSQPSEEDLFYLLIHRLKKRDQVXXXXXXXXXXXXKKLREVNEENEALKSQLREAEDRCHAQ
CP135_MOUSE     ------------------------------------------------LSNRNEKLCQELTEIDQLAHKE
USO1_YEAST      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     -------------------------------------------EEMVELKESNRTIHSQLTDAESKLSSF
CP135_HUMAN     ------------------------------------------------LSNKNEKLCQELTEIDQLAHKE
PUMA_PARUN      -------------------------------------------KQLQKMDEENERLESVLRDTVDTSEIA
TSG10_MOUSE     ----------------------------------------------------------------------
HOOK_BRAFL      -------------------------------------------KQLRDTMEELNEVRAAKEEIAQRCHEM
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     DRSRISELTSELTDER------NTGESASQLLDAETAERLRAEKEMKELQTQYDALKKQXXXXXXXXXXA
MYSP_DERFA      ----------------------------------------------------------------------
CLIP1_MOUSE     -----------------------------------------------KLSKENESLRSKLDHA-------
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      SEATISQLRSEPQEVAVYVQELQKLKQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNLHQKDLDCQQL
CC150_MOUSE     DLGMTSQLKSDLNSRDNLICKLVEENKATQI-------------SLKKEHEENIYLKSEILSLQDVSGKA
KTN1_CHICK      --------------------------------------------RVQELVEQNDALNAQLQKLHSQMAAQ
ODFP2_RAT       ----------------------------------------------KHLQQEKECLMSKLVEAEMDGAAA
GCC2_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      -------------------------------------------KRLAEVGRDYESAQGEIRQLKESVRAQ
MY18A_MOUSE     DRLETSELTSELTDER------NTGESASQLLDAETAERLRTEKEMKELQTQYDALKKQXXXXXXXXXXA
TSG10_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     -------------------------------------------RNIRELQQQNQNLLSAVHELADRMEKD
KTN1_MOUSE      --------------------------------------------QVQDILEQNEALKAQIQQFHSQIAAQ
MFP1_SOLLC      ----------------------------------------------------------------------
RAI14_RAT       ----------------------------------------------------------------------
CCD18_MOUSE     -------------------------------------------QELMEKNEKIRSLESNINEHEKICFAF
ANR26_HUMAN     SSETASEDCELPSSYKNFMLLIEQLECKDSVSLLKIQDAALSCERLLELKKNHELLTVKIKKMEDKVNVL
CE290_BOVIN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
CE290_HUMAN     ---------------------------------------------------ESKTIKEEKRKLEDQVQQD
UACA_CANFA      --------------------------------------------------EEHEQLKSRLEQRAGELAKK
TG278_CAEEL     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------KHLQQEKECLMSKLVEAEMDGAAA
RAI14_MOUSE     ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------KHLQQEKECLMSKLVEAEMDGAAA
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
KI20B_MOUSE     --------------------------------------------ELRNEKEEKAELNKQVVSLQQQLRFF
GCC2_MOUSE      ---------------------------------------------IKVLTERLDALLLEKAETEQQCLCL
ANT1_ONCVO      -------------------------------------------KEIEKLSEMNNRLQ---QDKNDLIGAK
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
MYH15_HUMAN     ------------------------------------------------------------RKLEDECFEL
CE290_MOUSE     ---------------------------------------------------DSEMIREEKRKLEDQAEQD
TPR_HUMAN       ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     -------------------------------------------EKLNKLRQQNACLVTQLMTKFESIHFE
CC150_HUMAN     ----------------------------------------------------------------------
MLP2_YEAST      --------------------------------------------KIKELENNLERLRSDLQEIESIRSCK
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
Y147_TNAVC      ---------------------------------------------MKRVVGENESLNNRIKSIYDKQIAE
ICR2_ARATH      ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
MYH8_CANFA      EAGEYSR---QLDEKDALVSQLSRSKQAST------QQIEELKRQLEEETKAKNALAHALQSSRHDCDXX
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
APSB_EMENI      -------------------------------------------KQLKDQQSDKESMLNHDPEGEDRDHAQ
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
MYSP_BLOTA      -------------------------------------------KMAQKISEYGEQLEALL----NKCSAL
MYO2_CAEEL      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
DAPLE_XENLA     --------------------------------------------KLHELEKENLQLKSKIHDLEDR---Y
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     ----------------------------------------------RGANCDVELLKTTTRDREEKC---
MYSP_SCHJA      D----ARVRAERHAADLSYQVDALSERLDEAGGSTTQTQELLKRREMEINKENANASLELAETSMRRRHQ
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     ESPETKSEPGQGPEMQEVLLEVQRLRVENQQLSKDYARKAEELQATYE--RENEAIRQAMQQSVSQAQWQ
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       RRGDTNN--KKPSSVSAYNNTIHSLQS--EITQTENRANTIINKPIRSVEEVNNALKESLKEARNRLESK
EBH_STAEQ       RRGDTNN--KKPSSVSAYNNTIHSLQS--EITQTENRANTIINKPIRSVEEVNNALKESLKEARNRLESK
CING_XENTR      -------------------------------------------KELQRVQDQLKQLSVDKQKVEENLHQR
ZIP1_YEAST      --------------------------------------------ELMKKGKEIEYLKRELDDCSGQLSEE
SOJO_XENLA      ------------------------------------------------------ALQKLVEEKSQVYSAA
KI20B_HUMAN     ----------------------------------------------------------------------
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     --------------------------------------------QLKEVLRENDLLRKDVEVKESKL---
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      -------------------------------------------KRIQDMESELEKTEAKLNAAV----RE
DMD_MOUSE       ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      -------------------------------------------KRLIDVPDPVPALDQQLQLKVQRLHDI
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      -----------------------------------------------EIKQQKEELIRTQSELDSKNSAI
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      --------------------------------------------KQKELSDENRTLKEELRSLQSQHEAD
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
ROCK1_MOUSE     -------------------------------------------KELDEEGNQRRNLESAVSQIEEKMLLQ
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     ----------------------------------------------------------------------
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      -------------------------------------------KRLIDVPDPVPALDQQLQLKVQRLHDI
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      -------------------------------------------KTKQRLQNEVEDLMIDVERSNAACAAL
MYH11_HUMAN     ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
LIPA_CAEEL      ----------------------------------------------------------------------
IMH1_ASHGO      -------------------------------------------QKYENLVEEHQQLSLELEKSRH----W
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      -------------------------------------------KKLRRQAQEANARKNEMLAEQSGLGEA
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      ----------------------------------------------------------------------
CASP_MOUSE      -------------------------------------------KRLIDVPDPVPALDQQLEIKVQRLHDI
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     LLSSNENFTNKVNENELLRQAVTNLKERILILEMDIGKLKGENEKIVELQETNMKFSMMLREKEFECHSM
SMC1A_MOUSE     -------------------------------------------KKYHRLKEEASKRAATLAQELEKFNRD
RB6I2_MOUSE     --------------------------------------------QLKEVLRENDLLRKDVEVKESKL---
KIF27_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      -------------------------------------------ESLLKLETEHKQLQKRIGEFKIESEAK
GRDN_MOUSE      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      -------------------------------------------RKLHELDLENARLAGEIREKESEAARR
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     --------------------------------------------KLHEVGHERDSLQRQLNTALPQEFAA
KINH_RAT        ----------------------------------------------RKCEEEIAKLYKQLDDKDEEINQQ
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     MENKYKGLQKEMSEEEVKSRLEHEKVGWEQELCRLRFALKQEEEKRRSADQLSEKTMEQLRRKGEQCQSE
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      ---------------------------------------------------------------ETQAELE
MYH1_PIG        ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
MYH8_HUMAN      -------------------------------------------QRLQEAEEHVEAVNA-------KCASL
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      QTGQQIVLAKQKEIEELTNT-ISQLQLEKEINTQQFDGLRD---EIQNRDEELEQYKSQQSQKINQLSGQ
KI15B_XENLA     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
KIF4_DICDI      -------------------------------------------KELEKLREKFNAIDAKLKQAQDKQTIQ
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CE152_HUMAN     ------------------------------------------------IKDEKDGLTLSLRESQ-----K
BICD2_MOUSE     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      ----------------------------------------------------------------------
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------------------------
SLMAP_RABIT     ----------------------------------------------------------------------
ODFP2_XENLA     ----------------------------------------------------------------------
MYSP_DIRIM      -------------------------------------------RKLHELDLENARLAGEIREKESEAARR
MYH1_HORSE      ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     ---------------------------------------------IQRIIQENERLKQEILEKSNRI---
F184A_HUMAN     ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
BRE1_CAEEL      ----------------------------------------------------------------------
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ----------------------------------------------------------------------
SMC1_SCHPO      ----------------------------------------------------------------------
RB6I2_RAT       DVEKESKLSSSMNSIKTFWS--PELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQ
ODFP2_CHICK     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      --------------------------------------------EIREITIELENTQIIVQDLTKRNRQL
HOOK1_DANRE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CI093_HUMAN     ---------------------------------------------------QNSELQAKTNETEK---AF
CD158_HUMAN     -------------------------------------------RELDNRNMEVQRLEALLKALKSECQGQ
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      -------------------------------------------------------LSLQVEKKQSKVEEL
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      ----------------------------------------------------------------------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      -------------------------------------------RQMQEYKREKMSLETKLKEM-------
ALM1_SCHPO      ------------------------------------------------LRNENESLKTNLENQNKRFDAL
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_CANFA      ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
BRE1_CANGA      ----------------------------------------------------------------------
Y4862_ARATH     --AKDKQIKDEKREGNCYSLLMEQLDQKNAALA----------KAQMEIKEERESVACLLKRIE-MLDLF
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
HOOK2_XENLA     ----------------------------------------------------------------------
FTM_HUMAN       --------------------------------------------QIEELEHLAEILKTQLRRKENEIELS
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
GOGC3_ARATH     -------------------------------------------KKLQESESDIKALSALLREKEDQISRL
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ----------------------------------------------------------------------
ROCK1_RABIT     -------------------------------------------------NEKLAQLQKQLEEANDLLRTE
ROCK1_PANTR     -------------------------------------------------NEKLSQLQKQLEEANDLLRTE
ROCK1_HUMAN     -------------------------------------------------NEKLSQLQKQLEEANDLLRTE
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       ----------------------------------------------------------------------
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      ----------------------------------------------------------------------
BPA1_MOUSE      ------------------------------------------------VKRDLEALSKQCNKLLDRAKTR
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
HOOK_DROAN      ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CUX1_MOUSE      -------------------------------------------KRLIDVPDPVPALDQQLEIKVQRLHDI
CP250_HUMAN     -------------------------------------------EQIRELEKDRETQRNVLEHQLLELEKK
CEP63_PONAB     ----------------------------------------------------------------------
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      ----------------------------------------------RKEDAENEKLELDLKFSDLRAEIN
ATK3_ARATH      ----------------------------------------------------------------------
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       ----------------------------------------------------------------------
RUFY3_HUMAN     ----------------------------------------------------------------------
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     ---------------------------------------------LEQQLEEANAVRQELDDAFRQIKAY
LAML3_XENLA     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     ----------------------------------------------------------------------
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     ----------------------------------------------------------------------
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      ----------------------------------------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ----------------------------------------------------------------------
NDC80_CRYNE     ----------------------------------------------------------------------
MYSP_SCHMA      ----------------------------------------------RQMNDQVKELKSSLRDANRRL---
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         ------------------------------------------------INEELETFNSRWRELHEE--AV
CYTSA_CHICK     ----------------------------------------------------------------------
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      ---------------------------------------------------------------ENLLYAS
SMC3_YEAST      ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      --------------------------------------------ELRDLESKVDQLNRALRDTEALIKAQ
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
K2C5_BOVIN      ----------------------------------------------------------------------
HOOK3_XENLA     -------------------------------------------RQLKKANEENDALSAK-EEIAQRCHEL
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      -------------------------------------------KKMKEKQQEVEAITLELEELKREHASN
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     -----------------------------------------------EVDKLRAANEKYAQEVADLKAKV
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------------------------------------------------------
U634B_HUMAN     ----------------------------------------------------------------------
U634A_HUMAN     ----------------------------------------------------------------------
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     -------------------------------------------KQVAEVNEEANSVRRELDDAFRQIKAS
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K2C5_PANTR      ----------------------------------------------------------------------
K2C5_HUMAN      ----------------------------------------------------------------------
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
RUFY3_MOUSE     ----------------------------------------------------------------------
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     ----------------------------------------------------------------------
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      --------------------------------------------RLNTMDVENEALKNQVKELEEALRGQ
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ----------------------------------------------------------------------
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     ----------------------------------------------------------------------
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      ENNTLSKLKSQSKVEDLQAQLLTLVKDNDR----------RSSKTLQRIDESLTNGSDVKEEASETVKSE
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SBCC_CLOAB      ----------------------------------------------------------------------
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ELSKSQQLESERAQNDIEHLFQHS-------------------KKLESVAAEHEILTKSYMELVQRNEAT
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     ----------------------------------------------------------QACEATASKHLS
ARK1_ORYSJ      ----------------------------------------------------------------------
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     ----------------------------------------------------------------------
MUKB_EDWI9      -------------------------------------------KRLRKAERDYHLMRTQVTQAERRLHRR
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ----------------------------------------------------------------------
HOOK_DROPS      ------------------------------------------------LQEERDAMAQKCFETEKKMLLL
HOOK_DROPE      ------------------------------------------------LQEERDAMAQKCFETEKKMLLL
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     ----------------------------------------------------------------------
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ----------------------------------------------------------------------
TFB1_SCHPO      ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      -------------------------------------------ERLKALTHENERLKEELGKFKEKSEKP
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     ----------------------------------------------------------------------
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       -------------------------------------------KEIKRLNEELERMKSKMADS-NRLERQ
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     ----------------------------------------------------------------------
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     --------------------------------------------KLRAANEK---YAQEVAGLKDKVQQA
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ---------------------LQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRESWYRLKVQ
PIBF1_HUMAN     -------------------------------------------KKLEVLTKEFYSLQASSEKRITELQAQ
AV71_ACAVI      --------------------------------------------------------KLKVQEIQTQSTRQ
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ETQNTAQRNIIERWKVKLGKVKSLVAIIGNDHEILRKDGQFLKSAQIALVRGKHQLQTDLRHLKCGTDHL
CP135_MOUSE     QVLETADKELGEAKK----EIKRNLCEMRNLEEKMSKLQWELDLSH----KEKERLNSELL-LKSDLETV
USO1_YEAST      -----------------------------------------------AINENLEEMKIQCNNLSKEKEHI
NUF1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     EQENKSLKGSIDEYQNNLSSKDKMVKQVSSQLEEAR--------SSLAHATGK------LAEINSERDFQ
CP135_HUMAN     ELLETADKELGEAKK----EIKRKLSEMQDLEETMAKLQLELNLCQ----KEKERLSDELL-VKSDLETV
PUMA_PARUN      EYTEVKVKELREKYKADLERLQS-------NKDDLERRVQILEDELAERQRIVERQRTEMNDLKLEYQLE
TSG10_MOUSE     ----------------------------------------------------------------------
HOOK_BRAFL      QVQQLMEENTL--MKVEKDELSDKVNQVDGYEDTSTPAGR----RYIQLTHQVEQLQEETYRLETGRDEY
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     RLIRAAEINAGGEWRLKYERAKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRL
MYSP_DERFA      ------------------------------------------------------ELTSHKQRLSQENTEL
CLIP1_MOUSE     ---NKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGIGTDSAEFA------ELKTQIERLRLDYQHQ
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      QSRLSASETSLHRIHVELSKLKEELSEVETKYQHLKAXXXXXXXXXXXXXXHGLQLQSEINQLQLGEAHS
CC150_MOUSE     QVLNDQLSKKCSELTSMLQVVKMENSRIIAEHQAILKVEQLLLDAAHASITGELQVQNEKAQLQIHLDHL
KTN1_CHICK      TSASVLAEELHKVIAEKDKQLKQMEDSLGNEHANLTSKEEELKVLQNMNLSLKSEIQK------------
ODFP2_RAT       AKQVMALKDTI-------GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDEQ
GCC2_HUMAN      -----------------------------------------LEQSHINYVKEIENLKNELMAVRSKYSED
UACA_MOUSE      HIRPEEHEQLRSRLEQKSGELGKKVSELTLKNQTLQKDVEKLHADNKLLNQQVHSLTVEMK-----TRYV
MY18A_MOUSE     RLIRAAEINAGGEWRLKYERAKRLQQELEDKMEVXXXXXXXXXXXXGDLQADSDESQRALQQLKKKCQRL
TSG10_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     EKPDLDGAEIQEETLIKANEIDQLTKMLEEVSDQLRKERDFFRS----LVQENEKL-------------L
KTN1_MOUSE      TSASVLAEEL---------------------HKVIAEKDKQLKQTEDSLANEQDHLASKEEELKQNMNFL
MFP1_SOLLC      -----------------------------------------LKDKEDAFVSMKKQFESELLSEREDRNKL
RAI14_RAT       ------------------------------------------------------QLQDTLHDLQKRLETS
CCD18_MOUSE     EKQHKEMEKQIEQLETQLEKRDQQFKEQEKTMSILQQDQHHLESLDRLLTESKVEMEKENMKKDEALKAL
ANR26_HUMAN     QRELSETKEILEHQKVEWERELCSLRFSLNQEEEKRRNADTLYEKIREQLRRKEE------------QYR
CE290_BOVIN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
CE290_HUMAN     AIKVKEYNNLLNALQMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLR-------------
UACA_CANFA      VTELTSKNQVLQRDVEKVQQVHNLTSEIKSHYVPLQVSEEMKKSHDVTVEELKKQLQLEMEKLLLENDSL
TG278_CAEEL     ----------------------------------------------------------------------
ODFP2_MOUSE     AKQVMALKDTI-------GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKED--
RAI14_MOUSE     ------------------------------------------------------QLQDSLHDLQKRLESS
ODFP2_HUMAN     AKQVMALKDTI-------GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDEQ
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      ------------------------------------------------------------------TKKF
KI20B_MOUSE     EEKNSSLRADVEQYNSAVAELQTQKAVNQEQRDRILKLSQEMETAARSIVSQIKQMQTKIDELRSSPSHI
GCC2_MOUSE      KKENVKMKQEVEDSVTKLEETHKEFE---QSHRNYVKEIESCKNELMA-VHSEHSKET------------
ANT1_ONCVO      QKGDTELNLLTE----KIRKVEI-------EFERIKKDNQELEDHE-RTARDDLKQETNRNHL------L
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
MYH15_HUMAN     KKEIDDLETMLVKSEKEKRTTEHKVKNLTEEVEFLNEDISKLNRAA-KVVQEAHQQTLDDLHMXXXVDEL
CE290_MOUSE     AVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERHLRKENGKHRNDVIAM
TPR_HUMAN       ------KRRAIESMEQQLSELKKTLSSVQNEQEALQRASTALSNEQQA----RRDCQEQAKIAVEAQNKY
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     LTQSRAKVSMLESAQQQAASVPNLEAEVSAQDKVLREENKLEQSQKMVIXXXXXXXXXXXXCIKLKVDLL
CC150_HUMAN     ---------------------KNLQISFNKEHE----ENAYLRSEIMSLHEAKAQVLNDQLTKKCSESCM
MLP2_YEAST      DSQLKWAQNTIDDTEMKM---KSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTPTL
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------ITKERKVLKELQKSFETERDHLRGYIREIEATGLQT
Y147_TNAVC      IGEEVAKKN-------ELIKILTLVENIESNNEDVRGDGNFFKNLLVTTIRERNDLDRKVQELQ------
ICR2_ARATH      ------------------------------------------------------QLQEELKKAKLSASEA
CENPF_HUMAN     -------KTAVEMLQNQLKELNEAVAALCGDQEIMKATEQSLDPP----IEEEHQLRNSIEKLRARLEAD
MYH8_CANFA      XXXXXXXXXXXXXXXRALSKANSEVAQWRTKYETXXXXXQRLQEAEVEAVNAKASLEKTKQRLQNEVEDL
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       ------------------------------------------------------ECQTELKYLRQNKEEI
APSB_EMENI      DEELLFLRERVETYELEIER---------------------LRSESIARESEKRRLAEMLKSLNDGRPTG
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
MYSP_BLOTA      EKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKL
MYO2_CAEEL      -------------WFKLYGKVKPLVGKIEAQYEKLQETVATLKDTVVQEEEKKRQLQEGAERLNKETADL
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
DAPLE_XENLA     SDKNRIEELLEENMVLEIAQKQSM----NESAQLGWELDQLSKSTDLSDARKSFVFELN--------ETT
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     ---------MLEKYERHLAEIQGNVKVLTSERD---KTFLLYEQAQEEIARLRREMKSLARKAMDTESEL
MYSP_SCHJA      TALNELSLEVLQKQKGKAEKDKSHL-IMEVDNVLGQLDGA-LKAKQSAESK-LEGLDSQLNRLKTLTDDL
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     EKESDLRKNFQVQESALQAQVRKLEGDLGRKISDLKKYAQKLKERIQDLDVQLKEARQENSELKGTAKKL
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       QTDGMTQQSVYKQAKIKAQNESSIAQTLINNGDASDQE----VSTEIEKLNQKSELTNSINHLTVNKEPL
EBH_STAEQ       QTDGMTQQSVYKQAKIKAQNESSIAQTLINNGDASDQE----VSTEIEKLNQKSELTNSINHLTVNKEPL
CING_XENTR      ERELSALK----------GALKEEVAGRGRETERLREQLQSFKKDNENLGRESQRIQDQLKQVLLEKQRH
ZIP1_YEAST      KIKNSSL--IQEMGKNREEMIKSIENFFSEDHHLL----QFNKFEERVHDLFEKKLQ---KHFDVAKDTL
SOJO_XENLA      EARNAGLEEKLKNYK---DQIVNLEDNINKEHEVL-----------LALERSKDIHQDQQKELMKQIEHL
KI20B_HUMAN     -----------------------------NQDDLLKEKETLIQQLKEELQEKNVTLDVQIQHVKRALSEL
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     ------------------------------------------------------RVQLNFNSMASELEEV
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     ---SSSMNSIKTFWSPELKKERALITIWKEQYRVVQEENQHMQMT-IQALQDELRIQRDLNQL-FQQDSS
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      KTSLSASNASLEKRLTELTRANELLKAKFSE------DGKNMRALSLELMKLRNKRETKMRSMMVKQEGM
DMD_MOUSE       ----------------------------------VNEGGQKIKSE--AELEFASRLETELRELNTQWDHI
CLIP1_HUMAN     ----------------------------------------------------------------------
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     -------------------------------------------------------LEDQLSKLKDERASL
CASP_PONAB      ETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNAETIALEKEQKLQNDLEEAEHKVQSL
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      EELNTRITTLVAEKESYIQKLDS----ISKDYSALKLTSETQAAADAELISRKEQ---EIQQLNENLDRA
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     --------NRVERLELELTRCKEKL----HDVDFYKARMEELREDNIILIETKAMLEEQLTAARARGDK-
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     KSQNELKRVLIEK-QASQEKFQLLLELVEKARDIEKMKLQVLTPQKLELV--KAQLQQELEAMRERFRTL
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      GREQSENRALVSEMNYKIEDYEHRIKAASTTTDDLLKEGTALTEAKMNVVKFEESLKGESLDLKQSAKDL
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     -----------------------------DEMEIHLQSLKFDKEQMIALTEANETLKKQIEELQ---QEA
ROCK1_MOUSE     HRINEYQRKV-EQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKLTQLQKQLETAVRLRKSHTE-M
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     ----------------------------------------------------------------------
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      ETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNAETIALEKEQKLQNDLEEAEHKVQSL
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      DKKQKNFDKILSEWKQKYEETQA-------ELEASQKESRSLSTE---LFKMKNAYEESLDHLET-LKRE
MYH11_HUMAN     ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
LIPA_CAEEL      -----------------------------------------------------------LEHLECLVSRH
IMH1_ASHGO      EQECLDSRKKVETLETELKDVKPKLK---NSNEELETVRGMLKTVGNELVHARDEL----KQLNCGTNEV
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      SSEAVEQEKVLEQAEARL--------------EAMRKNRDQAKERFT-----EHQEIWNVQKEKSTYEEE
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     --------------------------------------------------RLEKELQTQTTEFHQNQDKI
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      --------------EVKLGEMKGLLKLYQSGIDSLTKRA---KSAEATFFRVYETLGEVPDPYPLLIEAA
CASP_MOUSE      ETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKSAETIALEKEQKLQNDF----------
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     KEKALAFEQLLEKEQGKTGELNQLLNAVKSMQEALQNEVQRLRDKEF---RSNQELERLRNHLLESEDSY
SMC1A_MOUSE     QKADQDRLDLEERKKVETAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKELTEEVEMAKRRIDEI
RB6I2_MOUSE     ---SSSMNSIKTFWSPELKKERALITIWKEQYRVVQEENQHMQMT-IQALQDELRIQRDLNQL-FQQDSS
KIF27_HUMAN     ----------------------------------------------------------------------
HMW2_MYCPN      EALLIQERELLEKRR----EIDDLLTQASLEYEQQRRTNQVLKE--------KHQVQQHFQNLV----HA
GRDN_MOUSE      ----------------------------------------------------------------------
CING_XENLA      ------------------------------------------------LDRVREQYQNDMQQLRKNMDNV
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      DAENRAQRALAELQQLRIXXXXXXXXXXNMQFEIDRADAEARMKAEIARLKKKY--QAEIAELEMTVDNL
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     LTK---ELNVCXXXXXXXXXXXXXXXXXXNNTRLLLEHLECLVSRHERSLRMKRQAQSPLKALKSLFEHH
KINH_RAT        S-------QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQK
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     VEARQQLEASLRTLEMELKTVKSHL------NQVLEERNETQR--QLSREQNARMLQDGISHL-CKQKEI
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      SCQKESRTLSTELFKVKNAYEESL------DHETLRRENKNLQQEISDLTE---QIAEGGKHIH-ELEKI
MYH1_PIG        -----------------------------------------------SLEKTKQRLQNEVEDLMID----
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     -------------------------------------------------------------------DHF
BRE1_USTMA      --------------------------------------------------------------LRCLSQQG
MYH8_HUMAN      EKTKQRLQNEVEDLMLDVERSNAACAALDNFDKVLSEWKQKYEETQAELEASQKELSTELFKVKNVYEES
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      VNK---LENVTQEKELTIG---SLSSTLNNTNQIIELINEQSKSY-------KNVAEMEIESLRDETTQL
KI15B_XENLA     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
KIF4_DICDI      SEKQSLEREITETELDKLKKTHLAADVKSKDFIALNKSVEILTKSQEQLKSTIIELESDL----------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      ------------------------------------------------------QKEDDSKNLRNQLDRL
CE152_HUMAN     LFQNGKEREIQLEAQIKALETQ-IQALKVNEEQMIKKS----RTTEMALESLKQQL-VDLHH----SESL
BICD2_MOUSE     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      ----------------------------------------------------------------------
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      -------------------------------------------------------LEKTKQRLQNEVEDL
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------------------------
SLMAP_RABIT     ----------------------------------------------------------------------
ODFP2_XENLA     ----------------------------------------------------------------------
MYSP_DIRIM      DAENRAQRALAELQQLRIXXXXXXXXXXNMQFEIDRADAEARMKAEISRLKKKY--QAEIAELEMTVDNL
MYH1_HORSE      ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------KKELEEAEKDIQFGREVH
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     EEQNDKISELIER------------------------NQRYVEQSNLMMEKRNNSLQTATENTQARVLHA
F184A_HUMAN     ----------------KCQKLQTALAIAENNVQVLQKQLDDAKEGEMALLSKHKEVESXXXXXXXXXXXX
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        -------------------------------------------------------LEKTKQRLQNEVEDL
MYH2_CANFA      -------------------------------------------------------LEKTKQRLQNEVEDL
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       ---------------------------------------QILTPQKLELV--KAQLQQELEAMRERFRTL
BRE1_CAEEL      ------------------------------------------------------ELTAKAASLAIQNEKL
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ------------------------------------------------------QQQKEMEHMKLKTE--
SMC1_SCHPO      --------------------------------------------------------------------HL
RB6I2_RAT       RDLNTGEPCVAELTEENFQRLHA-------EHERQAKELFLLRKT---LEEMELRIETQKQTLNARDESI
ODFP2_CHICK     ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      ENENAALQKRCDDLSAENGQLRNEKANLEAECARLKVXXXXXXXXXXXXXXXXXGLQNALRE----ANNE
HOOK1_DANRE     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     ------------------------------DAELSRKERDELQSVLLGFEKHMEDIQTRVKLLTAERDQL
CI093_HUMAN     QTSQQKWKEECRRFEHDLEERDNMIQNCNREYDLLMKEKSRLKTLQEALEREKNEMESHIRETALEEFRL
CD158_HUMAN     MERQMAA---IQGKNESLEKVSSLTAQLESTKEMLRKVVEELTAKKMTLESSERTISD-----------L
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      KLEQADNLTLLESFKANLGQAAENISTLQDD---VISDDYFINKRE-----ERNQLELTFRGKLIPT---
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      ------------------------------------------------------QLTNDLQEEQALAHEK
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      ----------------------------------------------------------------------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      -SKATAYHNVIDAWFNQLDEVKTLMGALDED-----KDRPSFRSSLLF-----ENMEDFEKHLKARSDDI
ALM1_SCHPO      TTENQSLRELQEQSKIQLSIAKDQIEALQNENSHLKKQHMFASSSEEILVQEKSALVSDLASLQ--SDHS
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH1_CANFA      ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      -------------------------------------------------------------------DQL
EEA1_MOUSE      ----------------------------------------------------------------------
BRE1_CANGA      ----------------------------------------------------------------------
Y4862_ARATH     ENQNIQMQKEVERFK-----------------EMVEESSRFQTQMQEKMKEAENDYEEKLLQVCDALDNT
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
HOOK2_XENLA     ----------------------------------------------------------------------
FTM_HUMAN       LLQLREQQATDQRSNIR------------DNVEMIKLHKQLVKSNALSAMEGKFQLQEKQRTLRISHDAL
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
GOGC3_ARATH     NQENTSTSAALKEARTDISRGSNNYAIKGNNDQSLHKSVSHLKSPNMSNGKGKDTKEKDLADML--EDRT
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     ---------------------------------------------------------------------L
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ----------------------------------------------------------------------
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ----------------------------------------------------------------------
ROCK1_RABIT     SDTAVRLRKSHTEMSKSISQLESL-------NRELQERNRILENSKSQTDKDYYQLQAVLEAERRDRGHD
ROCK1_PANTR     SDTAVRLRKSHTEMSKSISQLESL-------NRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHD
ROCK1_HUMAN     SDTAVRLRKSHTEMSKSISQLESL-------NRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHD
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       ----------------------------------------------------------------------
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      ----------LQRFNAKLLKQQGKITFLTPRH-FLDFVAQYVKLYN----EKREDLEEQQRHLNVGLEKL
BPA1_MOUSE      EEQVDGATEKLEEFHRKLEEFSTLLGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQS
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ----------------------------------------------------------------------
HOOK_DROAN      --------------------------------ELLQSEG-----AREDLKLKAHQQETDLLHMQIRIDEL
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
CUX1_MOUSE      ETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKS--------------------------
CP250_HUMAN     DQMIESQRGQVQDLKKQLVTLECLALELEENHHKMECQQKLIKELE-----GQRETQVALTHLTLDLEER
CEP63_PONAB     --------------------------------------GGFLTSCEAELQELMKQIDIMVAHKKSGRTHL
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      SLSSTIKDXXXXXXXXXXXXXKT------------RSEVSNLKKQQIAAADQDPDFKSDHESLLAKIQHL
ATK3_ARATH      ----------------------------------------------------------------------
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       --------------------------------------------------------------------HL
RUFY3_HUMAN     --------------------------------------------------------------------HL
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     EKQKTLQQ---EREDLNKELVQASERLKNQSKEL--KDAHCQRKLAMQEFMEINERLTELHTQK---QKL
LAML3_XENLA     ----------------------------------------------------------------------
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     -----------------------------NDNQLQPIQFQYIKNLELEVINLQKEKEELVRELQTAKKNV
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     ---------------------------------------------------------------------V
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      ----------------------------------------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ----------------------------------------------------------------------
NDC80_CRYNE     ---------------------------------------------------------------------V
MYSP_SCHMA      -TDLEALRSQLEAER------DNLASALHDAEEALHDMDQKYQASQAALNHLKSXXXXXXXXXXXXXXXX
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------REELQMDQQAKKHLQEEF
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         RRQKLLEQSIQSAQEIEKSLHLIQDSLSSIDHQLAVYIADKVDAAQMP--QEAQKIQSDLTSHEISLEEM
CYTSA_CHICK     -------------------------------------------------------VESTLLQLQEQNTAI
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      AIHDSAQENMA----LHLENLKSLKAEYEDAKKLLRELNQMLLQAKSLWIDVAHNLENEISGIQQKVDEV
SMC3_YEAST      ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      ETENDLEVNNMKKEK---NNTKSSIEKLTEENTRLTKQDEKIKSADF---------EARLRSAECRIVEL
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
K2C5_BOVIN      ---------------------------------------------------------------------I
HOOK3_XENLA     DMQVAAENQILMERMNQSDSLEDPNSPAGRRHXXXXXXXXXXXXXXFRLEASK-----DDYRIRC--EEL
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      EQQLDAVNEAIKAYEGQIEKMAAEVA--KNKESVNKAQDELMKQKQIITAQAKHNLQNNESQLK--IKEL
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     --------------------------------------------------------------------HL
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     -----------------------------------------------------YQLQAVLEAERRDRGHD
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      -----------------------------------------------------HTLQEQLHKANEEIEFL
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ------------------------------------------------------EINERLTELHTQKQKL
GRDN_HUMAN      ----------------------------------------------------------------CGSPGM
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     QQATTENMGLMDNWKSKLDSLAS-------DHQ------KSLEDLKATLNSGPGAQQKEIGELKALVEGI
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------------------------------------------------------
U634B_HUMAN     ----------------------------------------------------------------------
U634A_HUMAN     ----------------------------------------------------------------------
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      --------------------------------ESLRENNATVLSEKAEFNEQCKSLQETIVTKDAELDKL
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     EKQKTLQQ---EREELNKELVQASERLKNQSKEL--KDAHCQRKLAMQEFMEINERLTELHTQK---QKL
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      --------------KKKLGEQSKLLKLRESTEKTVAKMNQEIQGMKMQRVQLMRQMKEDAEKFRTWKQQK
K2C5_PANTR      ---------------------------------------------------------------------I
K2C5_HUMAN      ---------------------------------------------------------------------I
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      --------------------------------------------------RSTQQLQTKVSELETANREL
RUFY3_MOUSE     ------------------------------DFSMYLKDGNSSKGSETAILDQKNYVEELNRHLNATVNNL
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        -------------------------------------------------LRVKKKMEGDLNEMEIQLSHA
MYH7_MOUSE      -------------------------------------------------LRVKKKMEGDLNEMEIQLSHA
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     ----------------------------------------------------------------------
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      ILRIQAEKNDLSELQLKMGQGSPSIRIADDDLKVTKDLSSVPEASAFSMPKAESEEQTVLRSLRAETDE-
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ----------------------------------------------------------------------
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------------------------------------
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     ------------------------------------------------------KLMHENEQLKSVTEDL
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      VNKDTTVKNENSVDNXXXXXXXXXXXXLKSDNRLLKESMNQINTNYDKVVKENLQLSDKLENLN--ENDL
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SBCC_CLOAB      ----------------------------------------------------------------------
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ----------------------------------------------IGNVSKKH---SELSKITCSDKSY
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     EKKNTDLQTTCESLNKHIETMKKL-------NEALKQQNEKTIAQLIEKEEQRKEVQSQLADRECKLSNL
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     EPIAVDPKNLLEETKALQGQISSQQVAV----EKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDL
ARK1_ORYSJ      ----------------------------------------------------------------------
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     --------------------------LLENKIQLLQEESRLAKNEMAALVEAEKECNLEL-------SEK
MUKB_EDWI9      ELAYMDADELRSMSDKALGALR--LAVADNEHDVLREDPKRPERKVQFYVAVYQHLRERIRQDIIRSDDP
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ----------------------------------------------------------------------
HOOK_DROPS      IDEKTNLQQELQRVQKEFARLEHSSTVIGDD-------GVSLGPVQTGSVR--------YNELRRQLDLL
HOOK_DROPE      IDEKTNLQQELQRVQKEFARLEHSSTVIGDD-------GVSLGPVQTGSVR--------YNELRRQLDLL
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     ----------------------------------------------------------------------
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      -----------------------------------------------------HSLRSLIHGIKDSVEH-
TFB1_SCHPO      -----------------------------------------------------------------GNDQN
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      EKLKTQVEQEVEHLKIQVMRLRALLGIVSELQLKLNSGGSSEDSVEIRMTEG--ETEGAMKEMKTRTDPI
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      -------------------------------------------------LRVKKKMEGDLNEMEIQLSHA
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     ---------------------------------------------------------------------V
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      ---------------------------------------------------------------------L
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------EENLRAQVKDLEEKLETL
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       LEDTVTLRQEHEDSTQRLKGLEKQYRLARQEKEELHKQ----------LVEASERLKSQTKELKDAHQQR
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     --------------------------------------------------------------------HS
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     TSENMG---LMDNWKSKLDSLAS-------DHQ------KSLEDLKATLNSGPGAQQKEIGELKAVMEGI
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      EIQYTCRENALPVCPIT--QATSCRAVTGLQQEHDKQKAEELKQQVDELTAANRKAEQDMRELTY-----
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     -----------------------------------------------------------LEHLKLILRDK
IFA1_CAEEL      EIQTQSARQNMERLRTQLSDLRGKLADLESRNSLLEKQIQELN----------YQLEDDQRSYEAALNDR
PIBF1_HUMAN     NSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQL
AV71_ACAVI      NLEQGYAKEEVKRLRVQLSELRGKLADLEGRNSLLEKQTQELN----------YQLEDDQRSYEAALNDR
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKAVTQQRAELASMQAKFTVLEQSLALRDNRLENSEKLLEREKNHTSTLEAFIRNHSNRGLKQIALLQQT
CP135_MOUSE     VHQLEQEKQRLSKKLQSFAVTERELTLEVERMRLEHGIKRRDKS-PSRLDTFLRDYYKKELEKLQHLIQR
USO1_YEAST      SKELVEYKSRFQSLVAKLTEKLKSLAYKDMQAENESKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIE
NUF1_YEAST      ---------------------EQEVREHQMKKERFDRALESKKRHITYANSDISNNEIKSLKEIKELRKE
SPO15_SCHPO     NKKIKD-----------FEKIEQDLRASSNELKEKSALIDKKDQELNNLREQIK--------------EQ
CP135_HUMAN     VHQLEQEKQRLSKKVESFAVTERQLTLEVERLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHI
PUMA_PARUN      SDRL---RAEMATVELKYSEVEDERDQRSRDADSWKVTSEELRSKISFMEKMLEEAKHRE----TVLREE
TSG10_MOUSE     --------------------------------EELKCMLEKYERHLAEIQGNVKVLTSERDKTFLLYEQA
HOOK_BRAFL      RLKCEEMEKEILDLAGKNEEL-MALAAETQLLKDEMDILRQSAEKTSKYEQTIETYKKK-LEDLADLRRT
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     TAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQ----REKDMLLAEAFSLKQQ
MYSP_DERFA      IKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVEL-----------------
CLIP1_MOUSE     SKQDSERSAEMETMQAKLMKIEDSLEAVKARLDSAEDLVEMEDTLNKLQEAEIK------VKELEVLQAK
GOGB1_HUMAN     ----------------------------------------------------------------------
EEA1_HUMAN      SEKLMDKEQQVADLQLKLSRLEEQLK---EKVTNSTEL-QHQLDKTKXXXXXXXXXXXSTTAKLREAQND
CC150_MOUSE     ILEHNQCLQKSQEAEKRTVVQKELLESTIARLQGELKASLQEKKSLLEKNEWFQREINKTEKEVAKLEKE
KTN1_CHICK      LQALTNEQAAAAHELER---MQKSIHIKDDKIRTLEEQLREELAQTNTKEEFILKDQNKTLQ--AEVQKL
ODFP2_RAT       QGALLKRLAEADSEKARLLLLLQD---KDKEVEELLQEIQCEKAQAKTASELSKSESMRGHLQA----QL
GCC2_HUMAN      KANLQKQLEEAMNTQLE---LSEQLKFQNNSEDNVKKLQEEIEKIRPGFEEQILYLQ----KQLDATTDE
UACA_MOUSE      PLRVSEERSHDVNVEDLNKKLSEATQRYAEKKQEAERLLENDKKNVSRLEAVFEKHEKEGLKSIAELKKQ
MY18A_MOUSE     TAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEETQREKLQREKLQ----REKDMLLAEAFSLKQQ
TSG10_HUMAN     --------------------------------EELKCMLEKYERHLAEIQGNVKVLKSERDKIFLLYEQA
NU211_SCHPO     DMAPATPNSKLNTNLIEQTSYQRSLIR-----------LEQLTNELESLKSISRNKEKKFEEAISSLQLE
KTN1_MOUSE      LKAEVQKWQALANEQAATAHEVEKMQKSIHVKEDEIRLLEEQLQHSKMEELKILSEQNKALQSEVRKLQT
MFP1_SOLLC      IRREGEERQALVNQSAKTTVISLG-----QELQNEKKLAEDLKFEIKGLQNDLMNTXXXXXEKITLLKDK
RAI14_RAT       EAEKKQLQDELQSQRTDTTCLNNT-EISENGSDLSQKLKDTQSKYEEAMKEVL---SVQKQMKLGLLSHE
CCD18_MOUSE     QIHVSEETIKVRQLDSALEICKEELALHLNQLERNKEKFERQKIKTHNLEETSEQNAIXXXXXXXXXXXX
ANR26_HUMAN     KEVEVKQQLELSTLEMELRTVKSNLNQVVQERNDAQRQLSREQNARMLQDGILTNHLSKQ-KEIEMAQKK
CE290_BOVIN     ----------------------------DNSVSLSEELANRQYNELTAKYRDILQKDNMLVQRTNNLEHL
HMW2_MYCGE      -------------LNSKYANLANFQANYHNKLNDFHRLIENQNQTINRLNQKINGNQNLIDNNVALLQNP
CE290_HUMAN     -KENEKQKNELLSMEAKEMAIFKIAALQDNSVSLSEELANKQYNELTAKYRDILQKDNMLVQRTSNLEHL
UACA_CANFA      SKNVSRLETVFVKHQKEVTALKSSVALKRQLLELNKKCGEREKINALVSE-------NTSLKKTLSNQYV
TG278_CAEEL     ---------------------------KDAEILNLRKQLEKEISHTEDRNRLLHENTQ---KELEAHKET
ODFP2_MOUSE     SERLMEQQAEADSEKARLLLLLQD---KDKEVEELLQEIQCEKAQAKTASELSKSESMRGHLQA----QL
RAI14_MOUSE     EAEKKQLQDELQSQRTD-TLCLNNTEISENGSDLSQKLKETQSKYEEAMKEVL---SVQKQMKLGLLSQE
ODFP2_HUMAN     QGALLKRLAEADSEKARLLLLLQD---KDKEVEELLQEIQCEKAQAKTASELSKSESMRGHLQA----QL
MYSP_OPIFE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------ENMSLRE-RIDSINKELEISKEKLHTLEQAFENISTTG-GEIIMDKAT
NDC80_YEAST     ----------------------------------------------------------------------
MYO1_YEAST      NEQINKLKNDLQEMESKKKFLEEKNQKTVNELENTQDLLNQEKENLRKNESLL----NRVKTSSETLQKQ
KI20B_MOUSE     SKIDLLNLQDLSSG-----------AKGDNCLNTSQQLPGGDFSSTHTQEISRENSFHASIEAIWEECKE
GCC2_MOUSE      --AILQK--ELEEAVHKQVELREQLKSQSDSEDNVRKLQEEIQNITAAFEEQISCLEKK-------LEAT
ANT1_ONCVO      AKELEEARADIVALNDRLAKMDANFKIKDETIKKSPADHETIKSRESKSEKIIVKHETK-----------
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       --------------------------------EELKCMLEKYERHLAEIQGNVKVLTSVRDKTFLLYEQA
MYH15_HUMAN     EGALEQERKARMNCERELHKLEGNLKLNRESMEN----LESSQRHXXXXXXXXXXXX-------------
CE290_MOUSE     EAEVTEKLGSLQRFKEKIAALQKVI---DNSVSLSEELANKQYNELTTKYRDILQKDNMLVQRTSNLEHL
TPR_HUMAN       ERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKLLECKASWEER-ERMLKDEVSKCVKQNRLLHD-
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
CENPE_MOUSE     ------------SEQQKESMKEISSKLQELQNKEYECLAMKTINETQGSRCEM-DHLNQQLEQKSTLEKV
CCD18_HUMAN     EQTKQGKRAERQRNEALYNAEELSKAFQQYKKKVAEKL-EKVQAEEEILERNLTNKENKRLQERCGLYKS
CC150_HUMAN     LQTVTMEKARIAILQVEQKMMTQTFQEQNLLLDAAHASITNEQNEKTQLQAHLDHLILEHNQCIQKAQDA
MLP2_YEAST      RKELEQIQVQLKDANSQIQAYEEIISSNENALELKNELAKTKENYDAKIELEKKEKWARELGEIRALQPK
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     KEELKIAHIHLKEHQETIDELRRSVSEKTAQIINTQDL---EKSHTKLQEEIPVLHEEQELKEVSETQET
Y147_TNAVC      -SEVFINKSRLSECQATMVQLNNDLTMRVEENKNLERVIVELRERISNNES--------------KLQEL
ICR2_ARATH      LKKEAQDQAEETKQQ-----LMEINASEDSRIDELRKLSERDKAWQSELEAMQRQHA------------M
CENPF_HUMAN     EKCVLQQLKESEHLKGRVENLERELEIARTNQEHAALEAENSKGEVETLKAKIEGQSLRGLELDVVTIRS
MYH8_CANFA      MLDVERSNAACAALDKKQRNFDKVLAEWKQKYEETQAELEASQKEARTLELFVKNAYEESLDQVETLKRE
MYH3_RAT        ----------------------------------------------------------------------
RAD50_RAT       RDQITSKEAQLASSREIVKAYENELEPLKNRLKEIEHNLSKIMRLDNEIKA-LDSRKKQMEKDNSELEQK
APSB_EMENI      SDSGAREERDMWK-----DMLDAETAAREQADEENKRLREEEATYAIAPAAPLRSHRNRG---DSLVSHS
ICR3_ARATH      ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     ------KRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQAKADLQEALRLGETEVTEKCNH
MYSP_BLOTA      QHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQEXXYKEAETLRKQEEAKNQRLTAELAQT
MYO2_CAEEL      SKGSTREVEEMTAMNEQKVALEGKLADASKKLEVEEKLVEAEKKNCQDVDLSLRKEKNAKEHQIRALQDE
MYH3_MOUSE      ----------------------------------------------------------------------
MEDB_GIALA      --------------QYKDTLVEDRLALTNTLDEAVQILVDSGKEEADKLGFNIYSAVSRYISEIWASQSG
DAPLE_XENLA     SSKILKLEKENQSLQNIIQDLEASLTLEEGNLKGQE--WEKENQQLSKKIENLNQQIERERQXXXXXXXX
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     GR----QKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQISILGGT
MYSP_SCHJA      QRQLTELN------NAKSRLTSENFELLHINQDYEAQILNYSKAKSS-LES-----------QVDDLKRS
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     GEKLAVAKDRMMLQECRGT--QQTDAMKTELVSENKVLREENDLEAGNLHP---QQDQSCLKECPCMKGT
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       ETAKNQLQANIDQKPSTDGMTQQSV-------QSYERKLQEAKDKINSINNVLANNPD-----VNAIRTN
EBH_STAEQ       ETAKNQLQANIDQKPSTDGMTQQSV-------QSYERKLQEAKDKINSINNVLANNPD-----VNAIRTN
CING_XENTR      EEAVHQRERELSALKG---ALKDEVSGRDREAERLRAQFEQDAMQTK-----------RSYEELVKINKR
ZIP1_YEAST      NVGLRNTTVELSSNTE--TMLKQQY---EDIKENLEQKMSSSKDEMA------KTINELSVTQKGLIMGV
SOJO_XENLA      QLQLEMKNLHAGEQKHTITILQQETLWHEQQLESARKELEIQTKNTSAAMKSLQNQVEVESAKVSQLESA
KI20B_HUMAN     TQGVTCYKAKIKELE---TILETQKVERSHSAKLEQDILEKEKEFQEHLQDSVKNTKDLNVKELKLKEEI
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     KRCMERKDQEKATLAAQIENLTRDLENREKQQLQMLDQLTEIQNHFETCEA----NRKRTDLQLSELSQH
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     SRTGEPCVAELTELHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEM-LQSKGLSAKA
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      ELKLQATQKDLTESKGKIVQLE-------GKLVSIEKEKIDEKCETEKLLEYIQEISEKCKVDIAQLEED
DMD_MOUSE       CRQVYTRKEALKAGLDKTVSLQKDLSMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEALQKET
CLIP1_HUMAN     -------------------------------------------------------HANKENSDVIALWKS
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     QDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEH----FKAIAQRELGRVKDEIQRLENE
CASP_PONAB      QTALEKTRTELFDLKTKYTAKADEIEMIMTDLERANQRAEVAQREAETLREQLANHS--------LQLAS
C144C_HUMAN     ----------------------------------------------------------------------
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      LDDVNKSKDKVADLTEKYEDSKRMLDIERHELEGTKKTLQASRDRVSDLETMLRALCSKLESELAIVHEE
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     ---VHELEKENLQLKSKLHDLELD---RDTDKKRIEELLEENMVLEIAQKQSMNESAHLGWELEQLSKNA
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     DEEVERYRAEYNKLRYEYTFLKSEFVSEEEKMKYKSEVARLEKDKEELHNQLLSVDPTRDSKRMEQLVRE
MYSN_DROME      ----------------------------------------------------------------------
MAD1_YARLI      -EAVEQTKSQLSDQIKYSRELESALTVRVEAAESAQQLSQVYEEDLSSMKGKLKN--MEGLRQQLAEQQL
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     KKAITEQKQKMKRLGSDLTSAQKEMKTKHKAYENAVSILSRRLQEALAS----KEATDAELNQL----RA
ROCK1_MOUSE     SKSISQLESLNRELQERNRILENSKSQADKDYYQLQAVLERDRGHDSEMIGDLQARITSLQEEVKHLKH-
FHAD1_HUMAN     ----------------------------------------------------------------------
CCD67_MACFA     --------------ERKMRALETRLDLRDQELANAQTCLDQKGQEVGLLR-----------QKLDSLEKC
CC64B_XENTR     ----------------------------------------------------------------------
CASP_HUMAN      QTALEKTRTELFDLKTKYTAKADEIEMIMTDLERANQRAEVAQREAETLREQLANHS--------LQLAS
WIT2_ARATH      ----------------------------------------------------------------------
SCLT1_RAT       ---------------------------RDPAMQNSMSTLTNSVNDQSALPPLIAEYE----KHLEELNRQ
HOOK1_CHICK     --------------------------------------------------------------ELGRLMQL
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     -----QVKMEREQHQTEIRDLQDQLSEMHDELDSTKRSEDREKG--ALIEEXXXXXXXXXXXXIALLRKR
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      NKNLQQEISDLTEQ-----IAEGGKAIHE--LEKVKKQIEQEKSXXXXXXXXXXXXXXXXXGKILRVQQV
MYH11_HUMAN     ---------------------------------------------------------NNALKKIRELEQE
MBO1_SCHPO      --------------------------------------IKEERNYLHSQDAPTTNALSKKISDILIPASA
LIPA_CAEEL      ERSLRRQAQNHAGVSSEVEVLKALKSLFEHHKALDEKVRERERVATLEEELSTKGDENSSLKXXXXXXXX
IMH1_ASHGO      ERLKSELQELRTENSTQIATLKEQLQLLNDQKKALETDVEQHKRKMEDLES-----------ELLKSQEN
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      EKRLAEEQPHIDSMQKRLLEAETAAALKDRYAEAIQHEEQAEKEQTLAQKDLA--------DRTAFFQQK
MYSP_BOOMI      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ----------------------------------------------------------------------
FIL1L_MOUSE     MAKLTNEDSQNRQLRQKLAALSRQI----DELEETNRSLRKAEEELQD----IKDKINKG-------EYG
CING_DANRE      ----------------------------------------------------------------------
CASP_SCHPO      NNLKTQKQIE--DLKKEKEEMEGSLQGKEKEVENLRKELDKYKDLVETRAAITKEECEKSLEQQKLYKDM
CASP_MOUSE      ----AEKERKLQETQMSTT---SKLEEAEHKLQTLQTALEKTRTELFDLKTKYDEETTAKADEIEMI-MT
UACA_HUMAN      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TRIPB_HUMAN     TREALAAEDREAKLRKKVTVLEEKLVSSSNAMENASHQASVQVESLQEQLNVVSKQRDETALQLSVSQEQ
SMC1A_MOUSE     NKELNQ-------------VMEQ---LGDARIDRQES--SRQQRKAEIMESIKRLYPGSVYRLIDLCQPT
RB6I2_MOUSE     SRTGEPCVAELTELHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEM-LQSKGLSAKA
KIF27_HUMAN     ------QKSDLENEDLKIDCLQESQELNLQKLKNSERILTEAKQKMRELTINIK------MKEDLIKELI
HMW2_MYCPN      KKKLDQKRHYLAEQKR----------IDEEQIFKLKEKIATERRELEKLYLVKKQKQDQKENDLLIFEKQ
GRDN_MOUSE      --------------------------LIDERDEHSETIVELSEERDGV--HFLPHASSSAQSPCGSPGMK
CING_XENLA      SQDQLSLESERQKINQVVRNLQRELEESSDEISQWKEMFQKNKEELRSTXXXXXXXXXXXXXRFSLLQSA
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     ---------------------EKELDMKTKMMEASEEKLKLQQKHDAEVQXXXXXXXXXXXXXXXXXXXX
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     -----QLQVELQSRRAELVCLNNT-EISENSSDLSQKLKETQSKYEEAMKEVLSVQKQMKLGLVSPESMD
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      NRANIEAQKTIKKQSEQLKVLQASLEXXXXXXXXXXXXYALAQRKVSALSAELEDNAIRARKQAEILEEA
MLP1_YEAST      ----------------------------------------------------------------------
LIPA1_HUMAN     KALDEKVRERLRVALERCSLLEEELGATHKEL----MILKEQNNQKKTLTDGVLNHEQENTKRSSDGSLS
KINH_RAT        SQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDGNNDVKQTGMIDEE
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     EMTQKKMTSEVSVSHEK----EKDLLHKNQRLQDEVAVLRLEMD---TIKSHNQEKEKRYLEDIKIANEK
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      KKQVEQEKCEIQXXXXXXXILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNHV-----RVVETMQS
MYH1_PIG        ---VERSNAACAALDKKQRNFDKILAEWKQKYEETHAELEASQKESRSLELFVKNAYEESLDQLETLKRE
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     -------RKEFSDLEKKFKDKSQEIKDTKECVQNKEKNLEEENKKLSTRCTDLLNDLEKLRKQEAHLRKE
CCD67_HUMAN     ----------------------------------------------------------------------
CCD46_HUMAN     LSRIREKELDMKTMEAKFH--EEKLKLQQKHDADVQKILERKNNEIEELKTLYRS--------------K
BRE1_USTMA      DVNIVELQQKLHDLADEGSRYKQDLFLTQSKLQRAQDALAQTSQKLSKVEEYVRYQSN-------LLRAT
MYH8_HUMAN      LDQLETLRRENKNLQQEISDLTEQIAKQIHELEKIKKQVEQEKCEIQXXXXXXXXXXXXXXGKILRIQQV
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      RETSQLLANRLKECRSSIQSAESLLSERDLEITQLKALLTQQEESSGITSLNLKNQSDQTMKQIDILSKT
KI15B_XENLA     -----------ARMRERMLQLESELATSKQEYEEFKELTKKKQEQESELQSLMK--SNQHLENILAIKEN
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     ---------------------------REQLIEKKMKLAQKRERWINSMEELTKNKMI--LYQKKNLAQE
SMC2_YEAST      ----------------------------------------------------------------------
MYSS_RABIT      -------------------ILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNH----LRVVESMQST
KIF4_DICDI      ----SKKNIELEKKQ------EELVTLNQDKLEKEKKTNQLESDHSS---ATIK----------------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      SRENRDLKDEIVRLN------DSILQATEQRRRAEENALQQKACGSEIMQK--KQHLEIELKQV--MQQR
CE152_HUMAN     QRAREQHESIVMGLTKKYE--EQVLSLQKNALKEQEDICSRLKDHVKQLE---RNQEAIKLEKTEIINKL
BICD2_MOUSE     -------REKIQAAEYGLAVLEEKLKLQFEELEVDYEAIRSEMEQLK--EAFGQAHTNH--KKVAADGES
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      -------------------------------------------------------------------EQT
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      MLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLELFIKNAYEESLDQLETLKRE
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
C102A_XENLA     ----------------------------------------------------VRAERNKAREEGAQLRSR
SLMAP_RABIT     -----------------------------------------------------RNQVEESSKQIQVLQAQ
ODFP2_XENLA     --------------------------------------------------------TNRSLRTL-LREQH
MYSP_DIRIM      NRANIEAQKTIKKQSEQLKILQASLEXXXXXXXXXXXXYALAQRKVSALSAELEDNAIRARKQAEILEEA
MYH1_HORSE      -------------------ILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNHV-----RVVETMQT
M12_STRPY       AADLLRHKQEIAEKENVISKLNGELQPLKQKVDETDRNLQQEKQKVLSLEAVTKENAKKDFEKIAELESK
IKIP_RAT        ----------------------------------------------------------------------
FKB15_HUMAN     EQEKAKVTEELAAATAQVSHLQL-------------KMTAHQKKETE-----LQMQLTESLKETDLLRGQ
F184A_HUMAN     XSDLVLKASHIGMLQA--TQMTQEVTIKD--LESEKSRVNERLSQLEEERAFLRSKTQSXXXXXXXXXXX
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        MLDVERTNAACAALDKKQRNFDKILAEWKQKYEETHAELEASQKEARSLELFMKNAYEESLDQLETLKRE
MYH2_CANFA      MLDVERTNAACAALDKKQRNFDKILAEWKQKYEETHAELEASQKEARSLELFMKNAYEESLDQLETLKRE
MFP1_TOBAC      ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CCD41_RAT       DEEVERYRAEYNKLRYEHTFLKSEFEHQKERISEEEKMKYKEKDKEELHNQLLSVDPTRDSKRVEQLVRE
BRE1_CAEEL      QSEVTKVQSDCYNLERKKRILTDKLSVQENRVQELEHQLEDARFETATLVSEGQSGGNGGAKKISAPDIP
SBCC_STAS1      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     -KRVDELMKKLQEKDEECQSLKQENKIKCDEVENLTKKLELSDNHNKELEAKITEYT-----------QK
SMC1_SCHPO      EKSISSNMAEVTRLKADSI---QLIERRDENTKEIEKLKEKEGSIRRNLLAFDR----KVRKQEKLIASK
RB6I2_RAT       KKLLEMLQSKGLSAKATEEDHERTLAEAEMHVHHLESLLEKEKENNMLREEMHRRFENAPDSAKTKALQT
ODFP2_CHICK     ----------LADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSESVRGHLQ-AQLRHK
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      LKAANRTINELTALKAQLEAERDNLALRDTRSEMEQRLREKDEEIDS-----IRKSSARAIDE---LQRT
HOOK1_DANRE     -----------------------------------------------------RIHCEELEKQLVELQHR
CYTSA_DANRE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     SSQCXXXXXXXXXXXXXXXXXXXQRRIRDDR-EQTEAELQRVTAERDALRDRLKAHST------ALTDRE
CI093_HUMAN     QEE--QWEAERRELQ--FIVQEQ-----DTAVQNMHKKVEKLETEHMDCSDLLRRQTSE------LEFST
CD158_HUMAN     TTSLQEKERAIEATNAEITKLRSRVDLKLQELQH----LKNEGDH---------------------LRNV
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SBCC_LACLA      FQKVKHSKDDIVGLELKLK--ENTIALSENK-DNLEKAKEKLKGRRRLMIAQLQSELQEGCPVCGALEHP
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      DILVERANSRVEVVHERLSSLENQVTIADEKYEAEKQSIEEDLANKQTEISYLSDLSSTLEKKLSSIKKD
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      -------------------ILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNH----IRVVESMQST
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      RAIITRLQAELEKALAEKQQLEESLEAASLRYMVAEKKLDRARSLTAKLE-----------KQYLLAQRP
ALM1_SCHPO      SRQVQDLEKKLAGLAQQNTELNEKIQLFEQKRSNSIKELEEEVETQKRLTALWESKSSELQSEVAALQEK
VIME_ONCMY      ----------------------------------------------------------------------
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      -------------------ILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNHV-----RVVETMQT
MYH1_HUMAN      -------------------ILRIQLELNQVKSEVDRKIAEKDEE----IDQMKRNHI-----RIVESMQS
MYH1_CANFA      -------------------ILRIQLELNQVKSEIDRKIAEKDEE----IDQLKRNH----IRVVESMQST
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      LQMIAELRLENDFLRSQFEGLKDEVA-QGRSLQKAEQV-EADSAQLKQLQEQVASLS----REIDVEKQT
EEA1_MOUSE      ----------------------------DLELRNAERELQEQEEVVSCTKLDLQNKS----EILENIKQT
BRE1_CANGA      --------------------------------DNTDNISNTEQRPTSVSPVLTNGHVKNEVKTEQEALNN
Y4862_ARATH     NVSLTRQIESLGTVKEKNLVMEKETQEYKEMLEESEKCRVLLEEQISQLE----SDSNENIRELAKLAEE
TPM_LEPSA       ----------------------------------------------------------------------
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     -------------MQAK-EELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLE----REKALLQHK
OPTN_CHICK      --------------------------------------LQVKLNIASAEDSFVEIGMNEEVNRTARENQN
HOOK2_XENLA     -------------------------------------------------EMDVLRHSSDRVGKLESLVDS
FTM_HUMAN       MANGDELNMQLKEQRLKCCSLEKQL----HSMKFSERRIEELQDRINDLE-----------KERELLKE-
CAGE1_HUMAN     ----------------------------------------------------------------------
SMC4_DICDI      ---------------------------RDNALEYIDKELEREKNEIAAKQEMVEKQ---------LEQEL
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
KLPA_EMENI      ---------------------------------------EREQNLESLFETFVSRISQQGQESSGLKDAL
GOGC3_ARATH     KSMAAVQATELAKEREKLRDFQLSLQXXXXXXXXXXXXMRLDKNKTSMEISKMRSELDAKLLEIKHLQMK
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     EKDVTAAQAEL---EKAFAGTETEKALR---LRLESKLSEMKKMHEGDLAALVLDEKDRLIXXIQCLKEE
CK5P2_HUMAN     ----------------------------------------------------------------------
ATG23_DEBHA     ---------ELASMTKALRIKENTVTQLESRLSKSKSKYESTANELSVIEETLREQIKRLEKSVEDKSIS
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     ---VTNENMEVTNQQFLKTVTEQSVII-----EQLRKKLRQAKLELRVAVAKVEELTNVTEDLQGQMKKK
ROCK1_RABIT     SEMIGDLQARITSLQEEVKHLKYNLERMEGERKEAQDMLNHSEKEKNNLEIDL----NYKLK--SLQQRL
ROCK1_PANTR     SEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDL----NYKLK--SLQQRL
ROCK1_HUMAN     SEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDL----NYKLK--SLQQRL
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ---------------------------------NQAKLSERRRKRLQELEGQIADLKKKLNEQSKLLKLK
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       -------------------------------LQFSEKLSHQQTRHNMELEALREQFSELENANLALLQQT
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      RDTVDKVRDLRVTLSEKKAQLEQKDAEANEKLQRDQREAEQRKNISLEIEAEVASRKKVVLEDLARAEPA
BPA1_MOUSE      AAANTCTQGDLDSVNSRWKTLNKKVAQRTSQLQEAQDALESLLSWMADTEELVANQKPPSAEFKVVKAQI
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     ---------------------QEIVALREQNVHIQRKMVSSESEHLEGMEAGQKVHE----KRLSNGSID
HOOK_DROAN      MKS----SAEVTTLKDEVDVLRES----NDKLKICEAQLDTYK---KKLEDY-----NDLKKQVRILEER
FLIP1_HUMAN     ----------------------------------------------------------------------
CYTSA_MOUSE     --------------------------MEENQHSTSEELLQELADLQQITQELNSENERLGEEKVILMESL
CUX1_MOUSE      --------------QAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEE--AEHKLQTLQ--TALEKT
CP250_HUMAN     SQELQAQSSQIHDLESHSTVLARELQERDQEVKSQREQIERQKEHTQDLE---RRDQELMLERIQVLEDQ
CEP63_PONAB     ETCLKIREQELKSLRSQLDVTHKEVGMLHQQVEEHEKILKKLHEELGILKRSYEKLQKKQMREFRGNTKN
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      ----TEQNAELSSFLSKFQVLAKEKEIYTKKVEEFQKSLDSLVEMNSSLEVRIRTARDDLLSKIAILEKS
ATK3_ARATH      -----------------FQELELDYAFEQEKLKNA---LELNEKHCVDMEVSLKNKENMIIEELRKFESV
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       ----------------------------------------------------------------------
TPM1_BOMMO      ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       NATVNNLQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESS----YLLESNRKGPKQ-------
RUFY3_HUMAN     NATVNNLQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESS----YILESNRKGPKQ-------
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MRCKA_HUMAN     ARHVRDKEEEVDLVMQKVESLRQEL----RRTERAKKELEV---HTEALAA-------EASKDRKLREQS
LAML3_XENLA     -------REEYRQLQARNSKKENDLSLAQNQLRDLESKLNTKEAELATALS-----GKRGLEE--QLQEQ
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     NQALSEHRHKLLQE------LEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIWMMKNQRVQLMRQM
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     EKELKERRAELQKQEDRLLQREDSLDRKDNSFEKRENSLERKEQKL----ALDQKHIDEQQQKASSLVEE
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     ------------------------------------------------------NHEKERCDQLQAEQKG
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      -------------MQEKMSQIREALARLFERLKSSAALFEE------ILERMGSSDPNADIKKMKLAFET
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       ------------------------------RAQVAEEDLSRARDVIQQLTSTVSEKEKEMETKIVELKTR
NDC80_CRYNE     KEAVISQEAELEARQSELAHIEQAVAAQNLSPDEVQRMNHERDSLTRSLED-LRN-------KISEASQF
MYSP_SCHMA      XKSTTRTIEELTVTITEMEVKYKSLSRLKKRYESNIADLEIQLDTANKANANLMKE-NKNLSQ----RVK
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      ----TQEKEQMKSLNNRFASFIDKLEQQNKMLETKWSLLQNQTATRSNIDAMFEAYINNLRRQLDSLGND
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     DASLEEKDQYISVLQTQVSLLKQRLVLKPPQLEPQAEVFTKEENPESDGEPVVEDGTS--VKTLETLQQR
GOGA1_HUMAN     ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
DMD_PIG         KKHYQGKEAKLQDVSMKFRLFQKP-ANFEQRLQESKMILDEVKMHLPALESVEQEVVQSQLNHCVNLYKS
CYTSA_CHICK     REELNQLKNENRMLKDRLNALGFSL---EQRLDNSEKLFGYQ---SLSPEITAGNHSDGG----------
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     ----------------------------------------------------------------------
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      TEKIRNRQEKIERYTSDGTTIEAQIDAKDSEHQNARELLEKEKSN----QAEAQSNIDQGRKKVDALNKT
SMC3_YEAST      -----------ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKE-LEKYNELERNRKIYQFTLYDRE
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
YNP9_CAEEL      SDQQGNEKLGLARKMAESEILEEAV---DVLKSENEKLLAKNEEFSAKLVXXXXXXXXXXXXXXXVLEKK
TPM1_CIOIN      ----------------------------------------------------------------------
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     --------------------------MQSNTLTKDEDV-QRDLEHSLQMEAYER--------RIRRLEQE
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      -------------------VLELQTAKKD---ANQAKLSERRRKRLQELEGQIADXXXXXXXXXXXXXXX
K2C5_BOVIN      QRVRTEEREQIKTLNNKFASFIDKVRFLEQQLDTKWALLQEQGTKTQNLEPLLEQYINNLRRQLDGIVGE
HOOK3_XENLA     EKEITEFRQQNEDL---ITLADEAQSLKDEMRHSSDKVAKLE----SQVDSYKKKLEDLGRRQVKLLEEK
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       ----------------------------------------------------------------------
SMC2_MOUSE      DHSISKHKREADDAAAKV-----SKMLSDYDWINAEKHLFGQPN---SAYDFKTNNPKEAGQRLQKLQEV
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     NATVNNLQAKVDALEKSNTKLTGELAVANNRIITLQEEMERVKEESS----YILESNRKGPKQ-------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     SEKIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLNHSEKEKNNLEIDL-NYKLKSLQQ--RLEQE
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      HDQISRMNEEGKNFE---DIMLQFRSLEEERLESKLQTLEDDNNSLRLMTSSLGN-------QIESLRTQ
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       ARHVRDKEEEVDLVMQKAESLRQELRRAERELEVHTEALIAEASKDRKLREQSRHYSKQLENELEGLKQK
GRDN_HUMAN      KRTESRQHVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQMYRDELDALREKAVRVDKL
DCTN1_DROME     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     KM---EHQLELGNLQAKHDL---ETAMHGKEKEGLRQKLQEVQEELAGLQQHWREQLEEQASQHRLELQE
CASP_ARATH      ----------------------------------------------------------------------
ANR62_HUMAN     ----------------------ERLKVKFQKMKNNISVLQKVLSETDKTKSQSEHQNLQGKKKLCILQQQ
U634B_HUMAN     ----------LLKIKNTFCLWKRLIKLKDNHCEQLRVKIRKLKNKASVLQKRISEKEEIKSQSLRFAIQQ
U634A_HUMAN     ----------LLKIKNTFCLWKRLIKLKDNHCEQLRVKIRKLKNKASVLQKRISEKEEIKSQSLRFAIQQ
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------VEDEKNSLITQLTTVKFE
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      TKYISDYKTEIQEMRLTNQKMNEKSIQQEGSLSESLKRVKKLERENSTLISDV-SILKQQKEELSVLKGV
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ARHVRDKEEEVDLVMQKAESLRQEL----RRAERAKKELEV---HTEALIA-------EASKDKKLREQS
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ---------ELVNMKLQMRILETHIETKDRLLRNLEDIIDEQESRIANMEDFIQSYTNRSLKGISVL---
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      TKEVIQLKEKDRKRQYELLKLERDFQKQANALQRQKEAMEKRKDSQSKMEGAASRVKNWLANEVEVLVST
K2C5_PANTR      QRVRTEEREQIKTLNNKFASFIDKVRFLEQQLDTKWTLLQEQGTKTQNLEPLFEQYINNLRRQLDSIVGE
K2C5_HUMAN      QRVRTEEREQIKTLNNKFASFIDKVRFLEQQLDTKWTLLQEQGTKTQNLEPLFEQYINNLRRQLDSIVGE
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      IDKKYKSDSTIRDLKAKLTSLEQVLSLRDSECHEKERLLNQLQTRVAVLEQEIKDKDQLVLRTKEVLEAT
RUFY3_MOUSE     -----QTKVDL--LEKSNTKLTEELAVANNRIITLQEEMERVKEESS----YLLESNRKGPKQ-------
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        NRMAAEAQKQVKSLQSKDTQIQLDDAVRANDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQE
MYH7_MOUSE      NRMAAEAQKQVKSLQSKDTQIQLDDAVRANDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQE
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     -----EEREQIKTLNNKFASFIDKVRFLEQQLETKWNLLQEQGSRTQNLEPFFDTYVNDLRRQLDGITAE
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     ----------------------------------------------------------------------
EMIL3_HUMAN     -------------VQTELAVLEQRLVSLETSCTPSDSLVAEVKAWQSRSEALLRQVASHA----ALLQQL
CYTSA_PANTR     --------------------------MEENQHSTSEELLQELADLQQITQELNSENERLGEEKVILMESL
CYTSA_HUMAN     --------------------------MEENQHSTSEELLQELADLQQITQELNSENERLGEEKVILMESL
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
OPTN_DANRE      -----KERLQLTLQEARGRIAELESKLEHADSSAQTSLPSAAETNAST---EVKNLEDQLLKLCNELKQA
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     ---VLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV-VEDFKVRYED
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      ----------------------------------------RTMQSTATYGSTISSGTSRTLKITEIGGSN
ICR5_ARATH      ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     KRKSNE--AEVESLREEYHQRVATLERKVYALTKERDTLRREQNKKSDAAALLKEKDNQVMAEGEELSKK
GOGC4_ARATH     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      -------RQELKQMEARLTDRASSLDRKDENLSNKEKMLDSKEQSLTDKS----RHINEREQEIATLETK
CNPD_STRA3      -------RQELKQMEARLTDRASSLDRKDENLSNKEKMLDSKEQSLTDKS----RHINEREQEIATLETK
CNPD_STRA1      -------RQELKQMEARLTDRASSLDRKDENLSNKEKMLDSKEQSLTDKS----RHINEREQEIATLETK
CIP2A_HUMAN     ----------------------------------------------------------------------
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      INSVSYQELAAHNKQLNESVINDTTVNKLNELENKQTLLDKEREENETLKQQLQKSENDLVKQTILKADF
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      ----------------------------------------------------------------------
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     ----------LLKIKKTFCLCKRLTELKDNHCEQLRVKIRKLKNKASVLQKRLSEKEEIKSQSLRFAIQQ
SMC6_MOUSE      ---ISDLETEIENKKGHIITLQQRLSALEKDIKRNEELLKRCQLHYKEIKMKIRKNISE-IRELENIEEH
SBCC_CLOAB      ---------------AKYSEYNESLKASLRVVENSEQVLRTKKEEMTKLEDKI---SKVNIK----IESL
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      DNIIAEKQTELQNLRNSFTQ-EKTNTNSDSKLEKIKTDFESLKNALKTLEGEVNNHEHVQSKSLSEIEKE
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      --------AERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRL
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------------------------------------
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     HKIAKSQEEKLNVLQKEKEDKQETIDILRKELSRTEQIRKELSIKASSLE--------------------
CING_MOUSE      ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     SKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQLNSTALQDIISKN---------IMLEQD
ARK1_ORYSJ      ---------------------------RQQKLKNSEKMLEKKLKESEASLNDLKVTSNMQIENMAMEKRQ
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     ------------------------------------------------------NHEKERCDQLQAEQKG
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ----------------------------------------------------------------------
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     -------------------------AVEETKLSKENQTRAKESDFSDTLSPS-KEKSSDDTTDAQMDEQD
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     LKGVTKNWEDVPGDQVKPDQYTEALAQRDKRIEELNQSLAAQERLVEQLSR----------EKQQLLHLL
MUKB_EDWI9      IDAIEQMEIELARLTEELTAREQKLAISARSVANIRKTIQREQNRIRML--------NQGLQSVAFGQVN
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       ---VTTLEEQLAGAHQQVSALQQGAGIRDGVAEEEERLWKDDTGRVEELQGLLEKQNSQARERLVTLSAT
HOOK_DROPS      KEELLQ--SEGAREDLKLKAQQQETDLLHMQMRIDELLKSTAEVTTLKDEVDVLRESNDKLKICEGQLDT
HOOK_DROPE      KEELLQ--SEGAREDLKLKAQQQETDLWHMQMRIDELLKSTAEVTTLKDEVDVLRESNDKLKICEGQLDT
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     -------------------MLDQRQAIEDELREHIEKLERRQATDDASL-LIINRYWNQFDENIRIILKR
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ---VASSSEELTASADQTSRATEHITMAIEQFSNGSES-QSEKIETTTEQI---NEMNDGLAELARAAAV
TFB1_SCHPO      ANVIAELRPDIT-----MRIDKEALPFMKNINQLSERLLEKSLGNS---KRFNNENEETYLKESGFHDLE
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      SLSNCTEDARSCAEFEELTVSQLLLCLREGKVERLEVALREAKERISDFEKKANGHSSTE-KQTARRADR
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     ----------------------------------------------------------------------
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      NRMAAEAQKQVKGLQSKDTQIQLDDAVRANDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQE
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     NKLFGEPRAQNEDMEKD---LQQKLAEYKNKLDDAWDLLREATDKTRDANRLAANQKNMTIKEAIEGSKR
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      RKVVDGLKDELLQAETARDDLKMKSAMQEKEISDLQVKIDELHSATAEIEIDILKEANDKLKICETQLQT
HIP1R_HUMAN     ----------------------------------------------------------------------
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     KMKRAEDKAKLKEMEKSKLQLEQVQEWK-SKMQEQQADIQRQXXXXXXXXXXXXXXXXRYMEEMADTADA
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ----------------------------------------------------------------------
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       KRAL-QEFSELNERMAELRSQKQKVS---RQLRDKEEEMEVAMQKIDSMRQDIRK-SEKSRKELEARLED
LAMA1_HUMAN     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     ELAVLEQR--LVSLETSCTP-STTTAILDN-------LVAEVKAWQSRSEALLHQVA----RHTALLQQL
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     KM---EHQLELGNLQAKHDLVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLE-------LQEA
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      ---------ELNALQLEKTSSEEKARLLKDKLDETNNTLRCLK-----LELERKDQAEKGYSQ--QLREL
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     EKEVECQQERIQELQGHMGQLEQQLQGLHRKVGETSLLLTHREQETATLQQHLQEAKEQGELREQVLQGQ
IFA1_CAEEL      DSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEEN-----RAGLKQLVEQVVKTHAITQET
PIBF1_HUMAN     SQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQLEKDVSNLN-----------KEKSALLQT
AV71_ACAVI      DAQIRKMREECQALMMELQMLLDTKQTLDAEIAIYRKMLEGEENRAQLVEQVVKTHSLTEIGETESIRVL
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QTETASNVGNLAEGIKNLLTESQSTIKVELGLQLKPCLEILETLSKPESIDLAQLAQIDKALRDISMKVD
CP135_MOUSE     RSVKCSEKGDCSTDV-HLITRERDELQRMLE-RFEKYMEDIQSNVKLLTAERDKLNVLYKEAKESTLRKE
USO1_YEAST      RGSIEKNIEQLKKTISDLXXXXXXXXXXXXXXQISLLKEKLETATTANDENVNKISELTKTREELEAELA
NUF1_YEAST      KNDTLNNYDTLEEETDDLKNRLQALEK-ELDAKNKGCIEEREQMERK----LAELERKLKTVKDQVLELE
SPO15_SCHPO     KKVSESTXXXXXXXXRDILNEKKKHEVYESQLELKGELQTEISNSEHLSSQLSTLA----AEKEAAVATN
CP135_HUMAN     QRRSCSTSYSAREKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEKYDIQSNVKLLTAERD-KLSVL
PUMA_PARUN      ATEW--------EEKHDIISNESLKLRNEIERIRSDAEEDIQKWKKDVHMAQNELKNLERVCETLRSQLT
TSG10_MOUSE     QEEIA-----------RLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRE-RLKIA
HOOK_BRAFL      VEQLQEETYRLETGLSHCELRKANTLRSQLDMYKKQVQELHGKVS--EETKRADKAEFE--LKRSTEKLD
SGM1_YEAST      ----------------------------------------------------------------------
MY18A_HUMAN     LEEKDMDIAGFTQKVVSLEAE-------------------LQDISSQESKDEASLAKVKKQLRDLEAKVK
MYSP_DERFA      ------------ESLKVQLDE-ESEARLELERQLKANGDAASWKSKYEAELQAHADEVEELRRKMAQKIS
CLIP1_MOUSE     YTEQSEVIGNFTSQLSDALRKANSEGKLELETQLEGAEKQIKNLETERNAESSKANSITKELQEVSAQTR
GOGB1_HUMAN     ------------------------------------------------------------SLNDAGVELK
EEA1_HUMAN      LEQVLRQIGDKDQKIQNLEALLQKS-KENISLLEKEREDLYAKIQAGEG-ETAVLNQLQEKNHTLQEQVT
CC150_MOUSE     LAESKEDINVLNQNLQTLMEENKHLTNKMASLEHHKATKALEKITDSKNMLAYEKGKLQTKVKQLEAQLE
KTN1_CHICK      QALLSEPVQPTFEANKXXXXXXXXXXXXXXX-KIKTVEELLEA-------GLIQMANKEEELKVLSLRKX
ODFP2_RAT       RCKEAEN-SRLCMQIKNL-ERSGNQHKAEVEAIMEQLKELKQKGDRDETLKKAIRAQKERAEKEYAEQLH
GCC2_HUMAN      KKETVTQLQNIIEANSQHYQKNINSLQEEL-LQLKAIHEVKELMCQIEASAKEHEAEINK-LNELKENLV
UACA_MOUSE      LSELNKKCGEGQEKIRALMSEN-SSLKKTLSSQYVPAKEVKASLNSTVEKTNRALLEAKKRFDDTSQEVS
MY18A_MOUSE     MEEKDLDIAGFTQKVVSLEAE-------------------LQDISSQESKDEASLAKVKKQLRDLEAKVK
TSG10_HUMAN     QEE-----------ITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRE-RLKIA
NU211_SCHPO     KSNIQLQLTSLTSE-RSLALEKLNDLEKSL---------VLSERSKDE------LDESYKSLQEASKKIE
KTN1_MOUSE      AVSQQPN--------KDVVEQMEKCIQ-EKDEKLRTVEELLET-------GLIQVATREEELSAIR----
MFP1_SOLLC      EVSLRSNTSKLAESLSDMYQQSQDQL-MNLTSEIK---ELKDEIQKREELELKCVSEDNLNVQLNSLLLE
RAI14_RAT       SADTDEDVDALKQDLQRALEESKKLVEKEKAEATKPSSEVIENMNKEKAFLFEKYQQAQEEIMKLKDTLK
CCD18_MOUSE     XXETMRN-GEL-EDTQSKLEKQVSKQEQELQKQLRKMEEKYETAIREVDLKRQKIIELTGTARQAKLEMD
ANR26_HUMAN     MXXXXXXXXXXXKD----LSHKNSMLQEEIAM-LRLEIDTIKNQNQEKEKKCFEDLKIVKEKNEDLQKTI
CE290_BOVIN     ECENVSLKEQMESINKELEITKEKLHTIEQAWEQETKLGNESNMDKAKSVTNSEIVSISKKITMLEMKEL
HMW2_MYCGE      NI-TVEKKNYLLNVIDQLYNE----------------LDQLENQKRLLSIEYRELVSADNELQNVYENID
CE290_HUMAN     ECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKSITNSDIVSISKKITMLEMKEL
UACA_CANFA      PAKTHEEVGTLDKTNRELLDAKKKW--EDLNQEFVKTKDENEILKRNLENTQSQIKAEYISLREHEEKMS
TG278_CAEEL     HTETSAKIRELEAQNKTLLSEMEKVKHVAENLEADNLLEELESKNKNIEHLKQEIAQLNEKISTKETEKD
ODFP2_MOUSE     RCKEAEN-SRLCMQIKNL-ERSGNQHKAEVEAIMEQLKELKQKGDRDETLKKAIRAQKERAEKEYAEQLH
RAI14_MOUSE     SADGYSHLREAPEDIDTLKQDLQKAVEEELETKLKPPAEVIENMNKEKAFLFEKYQQAQEEIMKLKDTLK
ODFP2_HUMAN     RSKEAEN-SRLCMQIKNL-ERSGNQHKAEVEAIMEQLKELKQKGDRDESLKKAIRAQKERAEKEYAEQLH
MYSP_OPIFE      -----------------------------------------------DMLDLERDARVERHAADMSFQVD
CE290_DANRE     KAVANSEIVSVSRRITTLE---------------------MKELNERQRAEHAQ--KMYEHLRNSLKQVE
NDC80_YEAST     --------------------------------------------------------KLDMCLNKVDRSLI
MYO1_YEAST      FDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQ-ETIREREATLEKLHSKNNELIKQISDLNCDISKEQS
KI20B_MOUSE     IVKASSKKSHQIQGLEEQIEKLQ--VEVKGYREENSDLRAQESQGKNRDHQLKEKESLIQQLRE-----E
GCC2_MOUSE      SDEKQQEIIHLQKVIEDKAQHYQNTFQAEI-LQLRATHEVTELMSQIETSAKEHEAEINKL---------
ANT1_ONCVO      ----IYEINKYRAELEKLESDKDDLEKRIIGLQ--------DELNEKDRDTDRLNAEIDDLKRKLQTEIE
CC110_MOUSE     ----------------------------------------------------------------------
TSG10_RAT       QEEIA-----------RLRREMMKSCQSPKSTTAHAILRRVETERDVAFTDLRRMTTARDSLRERLKIAQ
MYH15_HUMAN     -----SQMNSKVENEKGLVAQLQKTVK-ELQTQIKDLKEKLEAKMERERADLTQLADLNERLEEVGGSSL
CE290_MOUSE     ECENASLKEQMEAISKELEITKEKLHTIEQAWEQETKLGNDSNMDKAKSMTNSDIVSISKKITVLEMKEL
TPR_HUMAN       QIEKLSDVASVKEGVQGPLNVSLS----EEGKSQEQILEILRFIRREKEIAETEVAQVESXXXXXXXXXD
MYO3_CAEBR      ----------------------------------------------------------------------
MRP4_STRPY      -----------------------------------------------------QARDLGDTINHMSQTIS
CENPE_MOUSE     EMENV----NLTQRLHETLEEMRSVAKERDELQLKKSLEVTKGMEKEEELRVAHVETINKLRKMVSDYTD
CCD18_HUMAN     ELEI------LKEKLRQLKEENNNG-KEKLRIMAVKNSEVMAQLTESRQSILSELENKDEILRD-KFSLM
CC150_HUMAN     EKRTAVQKELLESTIARLRGELEASMQEKKSL-LEEKERFQREVNKTEKEIVQERCNLEKELAKNKVDIN
MLP2_YEAST      LKEGALHFVQQSEKLRNEVERIQKMIKMSTIVQLCKKKEMSQYQSTKENKDLSELAELTKTKSSLYSAQD
MYH13_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     MNEL------------ELLTE-QSTTKDST------------TLARIEMERLRLNEKFQESQEEISLTKE
Y147_TNAVC      QLEDGGRMTRIPE------YDDENIRNYRLRLXXXXXXXXXXXX------ELSRLKNVDNDLRELRKKLL
ICR2_ARATH      DSAALSSTMNEVQKLKAQLSESENVENLRM--------ELNETLSLVEKLR--------------GELFD
CENPF_HUMAN     EKENLTNE----------LQKEQERISE---------LEIINSSFENILXXXXXXXXXXXXXSSTAMEM-
MYH8_CANFA      NKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKC----DIQXXXXXXXXXXXXXXGKILR-IQLELN
MYH3_RAT        -------------------------------------------------------AALDKKQRNFDKVLA
RAD50_RAT       MEKVFQGTD---EQLNDLYHNHQRTVR-EKERRLVDCQRELEKLSKEARLLNQERAELLVEQGRLQLQAD
APSB_EMENI      AVSDRELYRNTAAG-----SSSSSTLVMEFELLKQENAELRREVSAQTSMLTSRNREKERLYQEIELKLG
ICR3_ARATH      -----------------------------------------------------------KQLQEVSSKLE
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     IREVKSLLEELSKGELNVQISERKTIKQEIEKEEENLQVVLRQMSKHKTLDMLQLENHE--LQGLKLQHD
MYSP_BLOTA      RHDYEKRLAQKEEEIEALRKQYQIEIE-QLNMRLAEAEAKLKTVARLKKKYQAQITELELSL-DAANKAN
MYO2_CAEEL      MRQQDENISNLAANLMQSLEDSEQTMEREKRNELKIAQETLEELNKSKSDAENALRRKETELHTLGMKLE
MYH3_MOUSE      -------------------------------------------------------AALDKKQRNFDKVLA
MEDB_GIALA      QTTAAPPATDI-DGLHRQLVALKNSLGQNAELYEQRCQ------LQAELRELQEFSENPAAAVEEIMQLK
DAPLE_XENLA     XXXXXXXXXQLSQALENIKSQKERQIK-ELEQENKHLIQTLEAVRQRSQVSTARVKDIEETIKDTSSKMN
CLIP1_CHICK     ----------------------------------------------------------------------
TSG10_MACFA     LNDLAKEKECL-QACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQSTEALIMCEQDISRQLD
MYSP_SCHJA      LDDESRNRFNLQAQLTSLQMDYDN-LQAKYDEESEEASNLRNQVSKFNADIAALKSKFERELMSKTEEFE
MYO4_CAEEL      ----------------------------------------------------------------------
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     DMQTKKEASAETEYMKQQYEEDLRKIKHQTEEEKKQLVKRLEDLVKKHTVEI----------KSVRSSVE
CEP63_MACFA     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
EBH_STAES       KVETEQINNELTQAKQGLTVDKQPLINAKTALQ-----QSLDNQPSTTGMTEATIQNYNAKRQKAEQVIQ
EBH_STAEQ       KVETEQINNELTQAKQGLTVDKQPLINAKTALQ-----QSLDNQPSTTGMTEATIQNYNAKRQKAEQVIQ
CING_XENTR      LESEKVDLERVRQVIENNLQESR-----EENDDLRRKILGLEAQLKETNTFCDDLQRAESRLKDKITKLE
ZIP1_YEAST      QEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYAS-LENLVKAYKAEIVQSNEYEERIKHLSERST
SOJO_XENLA      LTVCKEELALYLHELEDNREQFENQIKTKLQNEIKLRTQSLQETSE-ENVRXXXXXXXXXELEDHHTELE
KI20B_HUMAN     -TQLTNNL----QDMKHXXXXXXXXXXXXXXXXXXXKEELSASSARTQNLK-ADLQRKEEDYADLKEKLT
IFA2_CAEEL      ----------------------------------------------------------------------
CN145_MOUSE     AEEATKQAEHYLSEFQRSETLREEAEKRREDLKAKAQESIRQWKLKHKKLERS----MEKQAETLVQLTE
CING_SORAR      ----------------------------------------------------------------------
RB6I2_HUMAN     TEEDHERTRRLAEALESLLEQKESMLREEMHRRFENAPDSAKTKALQTVIEMSKISSMERGLRDLEEEIQ
KIF15_HUMAN     ----------------------------------------------------------------------
HMMR_MOUSE      LKEKDREILSLKQSLEENITFSKQTVKCQLLETERDNLERAETLSAEMQILTERLAXXXXXXXXXXXXXX
DMD_MOUSE       KTETVNSVPSAQEALKKEL-ETLTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVELKL-
CLIP1_HUMAN     KLETAASHQQAMEELKVSFSKGLGTETAEFA-ELKTQIEKMENLQNQQDSERAAHAKEMEALRAKLMKVI
C144A_HUMAN     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
CCD39_HUMAN     MASILEKKSDKENGIFKA-TQKLDGLKCQMNWDQQALEAWLEESAHKDSLTLQKYAQQDNKIRALTLQLE
CASP_PONAB      QIQKAPDVEQAIEVL------TRSSLEVELAAKEREIAQLVESLTKLRENSASQISQLEQQLEKLKGQAD
C144C_HUMAN     ----------------------------------------LEMAQKKRNPEISHRHQKEKDLFHENCMLQ
RIPL1_MOUSE     ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MFP1_ARATH      WKEAKERYENLAEKQKNEISASELALEKDLRRRVKDELEGVTHELKESSVKNQSL---QKELVEIYKKVE
KIF15_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     DLSDASRKSFVFE-----LNECASSLKLEKENQLQSTIQGLRDASLVLEESGLKCGELEKENHQLSKKIE
CN145_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     KTHLLQKLKSLEAEVAELRAEKENS-----GAQVE----------NVQRIQVRQLAEMQATLRSLEAEKQ
MYSN_DROME      ---------------------------------------------------------------------D
MAD1_YARLI      QENSAKWKAYLEKSDEFKTVEEVVTALNKARMEKASLLERAGSGVNDETRSTAEYARLQERVTTLESELQ
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     QSTGGSSDPVLHEKIRALEVEGQSKILLEKELQITMTSQELEE-SREKVLELEDELQESRGFRRKIKRLE
ROCK1_MOUSE     NLERVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAM
FHAD1_HUMAN     ---------SVAEGIPGAVPPAEIYVEEDLAQQDKD--EIILLLGK----EVSRLSEIESKYKDVII-AN
CCD67_MACFA     NLAMTQNYEGQLQSLKSKLTNSFEKLRLHQMKQNKVPRKELPHLKEELPFELSNLNQKLEEFRAKSREWD
CC64B_XENTR     ----------------------------------------------------AQVADLESDLAEARLQMQ
CASP_HUMAN      QIQKAPDVEQAIEVL------TRSSLEVELAAKEREIAQLVESLTKLRENSASQISQLEQQLEKLKGQAD
WIT2_ARATH      -------------------------------------------------------------LREYVKSAE
SCLT1_RAT       LTYYQKHMGEMKLQLETVITENE-----RLHSKLKDAVEKLEALPFGTGIG-NDICADDETVRNLQEQLQ
HOOK1_CHICK     ILGCAVNCERKQEHIQNIMTLEESVQHVVMAIQELMSKEAMGPSASDVSSEMEQ--QLKKALEDLQEAIA
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     ERELTALKGALKEEVSSH-DQEMDKLKEQYDAELQAFRESVEEATKNVEVNSSEQSQAEADLREKVLK--
CEP63_HUMAN     ----------------------------------------------------------------------
YAF3_SCHPO      ----------------------------------------------------------------------
RGP51_LYMST     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYH3_CHICK      KSDIDRKIAEKDEEIDQLVDSMQSTLDAEIALRLKKKMEDLNEIEIQLSHANRQAAEAQKNLRNTQGVL-
MYH11_HUMAN     DLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQ
MBO1_SCHPO      MKDLKDRKNALAKEFEESQPGSSLTLKEQFGLKLK-CYFLYDQLNKKQNIDLKTLTELQRAVAGYEKKIS
LIPA_CAEEL      XXXXXXXXGSISSESANRLIEMQEALKTELANSLKQSTEITTRNAELED-QLTEDAREKHAAQESIVRLK
IMH1_ASHGO      VSKFRNQNNDLSEKLRDVLKKSEATTRMSLS-QKEKTIEYLEE----------QVRQYNS--KEIEDKKA
SDCG8_HUMAN     ----------------------------------------------------------------------
SBCC_BACSU      HEEYEAWRQHKSEKEPELLAKQEQLSRLQ-EIEIK-----LSEAKQEEERKKADLRQKEEALQSVMNELE
MYSP_BOOMI      --------------------------------------------TKYETEVQAHADEVEELRRKMAQKIS
MYH6_MOUSE      ----------------------------------------------------------------------
GACN_DICDI      ------------ESLESMMTDSNSISEV-----VRVLIEEFHVLYEIKQTLLYQVSAIDLGIREDKRSTS
FIL1L_MOUSE     NSGIMDEVDELRKRVLDMEGKDEELIKMEEQCRLNKRLEKETVQSKDFKLEVDKLSVRITALEKLEDALD
CING_DANRE      ------------------------------------------------------------------ISVT
CASP_SCHPO      EQENASTIQKLTSKIRELQA-SQLDHDLQASQNESAGLDVNAKSAEVNAI-LSELDDANKIIVELQAEIA
CASP_MOUSE      DLERANQRAEVAETLREQLSSANHSLQLASQIQKAPDVEAIEVLTR-SSLEVELAAK----EREIAQLVE
UACA_HUMAN      --------------------------------------------------------QHEESLRTIEALKN
UACA_BOVIN      ----------------------------ELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMY
TRIPB_HUMAN     VKQYALSLANLQMVLEHFQQEEKAMYSAELEKQKQ---LIAEWKKNAENLE-GKVISLQECLDEANAALD
SMC1A_MOUSE     QKKYQIAVTKLGKNMDAIIVDSEKTGR--------DCIQIKEQRGEPETLDYLEVKPTDEKLRELKIRYE
RB6I2_MOUSE     TEEDHERTRRLAEALESLLEQKENMLREEMHRRFENAPDSAKTKALQTVIEMSKISSMERGLRDLEEEIQ
KIF27_HUMAN     KT------GNDAKSVSKQYSLKVTKLEHDAEQAKVELIETQKQLQELENKDLSDVAMKVKLQKEFRKKMD
HMW2_MYCPN      LRQYQADFENEIEEKQNELFASQKSLQKSF-TQLKNKEAELNQKAQKIAEDWAHLKQNKHHHADLEIFLE
GRDN_MOUSE      RTESRQHLSELADAIRRLRQELEE--KTEQLLDCKQELEQIEVELKQENMNLLSDARSARALREKAVRVD
CING_XENLA      QVKKGSVDPGEVASVRKELQRVQDQLK-QLSVDKQKVEENLQQREREMSALKGTLKEEVSGRDRETVRLR
TPM_ECHMU       ----------------------------------------------------------------------
TPM_ECHGR       ----------------------------------------------------------------------
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     QTETEETIRKLEKKVQILIRDCQ-VIRETKENQITELKKICE--QSTESLNNDWEKKLHNAVAEMEKKFE
TEKT4_MOUSE     ----------------------------------------------------------------------
RAI14_HUMAN     NYSTEEEINVLKQDLQNALEESERNXXXXXGTVIKPPVEVIENMNKEKAFLFEKYQEAQEEIMKLKDTLK
RAD50_METMP     ----------------------------------------------------------------------
MYSP_ONCVO      NGRITDSINNNLTAIKNKLETELSTAQADLDEATKELHXXXXXXXXXXXXXXXXVEQLHEE-QEHSMKID
MLP1_YEAST      -----------------------------------------------------------KQLTETKRDLE
LIPA1_HUMAN     HEEDLAKVIELQEIISKQSRE-QSQMKERLASLSSHVTELEEDLDTARK-DLIKSEEMNTKLQRDVREAM
KINH_RAT        FTVARLYISKMKSEVKTMVKRCKQLESTQTXXXLAACLRISQHEAKIKSLT-EYLQNVEQKKRQLEESVD
IFT74_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
ANR26_MOUSE     ND-------NLQRMVKNMLSS-----KLDNEKQNKERLETVESFRSRLASALHDHAEIQTAKRDLEIAFQ
PU92_SCICO      ----------------------------------------------------------------------
MYH8_MOUSE      TLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKDTQLHLDDALRG------
MYH1_PIG        QQEISDLTEQIAEGGKRI--HELEKIKKQVEQEKSEIQXXXXXXXXXXXXXXGKILRIQLELNQVKSEVD
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     KYSTDAKIDNLIEARKEVEVSQSKYNALSLQLSNKQTLQELQNLYKQNSTHTAQQAELIQQLQVLNMDTQ
CCD67_HUMAN     -----------------------------------------QKLDSLEKCNLAMTQNYEGQLQSLKAKLT
CCD46_HUMAN     QHETEETIRKLEKKVQTLIRDCQ-VIRETKEDQIAELKKICE--QSTESLNNDWEKKLHNAVAEMEQKFD
BRE1_USTMA      EGKPTIPAGTIVSASEPAPATEQTA----------------DTAVKKETATLAPTPHTSETLQKAVDELE
MYH8_HUMAN      KSEVDRKIAEKDEEIDQLKTRVVETMQSTLDAEIRSRNDALRVKKKMEG-DLNEMEQLNHANRLAAESLR
MYH13_CANFA     ----------------------------------------------------------------------
KIF1_DICDI      VQQSTATIQNISSQLDSTITSINSAYKDESD-RLKDXXXXXXXXXXXXXXXMRSLEQTHLQQKETS----
KI15B_XENLA     KRHEVSQLNRMAETIKNMTTPTKA---YNLRSRLVPRLS---------------LDGISNGLTDTPKSGD
CEP63_CHICK     ----------------------------------------------------------------------
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     KKNLAQEKEKLAQRKENLLYN-----KERLTHSKKQLVQVKNKLGMFNKI----LAQVEEKLTQEKETVI
SMC2_YEAST      -----------------------------------------------EILSLIEEAAGTKMFEDRREKAE
MYSS_RABIT      -LDAEIRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEAIKNLRNTQGI-----------LKDTQLHLD
KIF4_DICDI      -----------LENYENQITQLTSEI-IDLXXXXXXXXXXXXXNIKQQEINLKESNDLNQQL--------
K1C18_DANRE     ----------------------------------------------------------------------
DESP_HUMAN      SEDNARHKQSLEEAAKTIQDKNKEILKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFEEINITKT
CE152_HUMAN     TR-------SLEESQKQCAHLLQSGSXXXXXXXXXXXXXXXKAHAMSANMNKALQEELTELKDEISLYES
BICD2_MOUSE     REESL---------IQESASKEQYYVRLELQTELKQLRNVL-TNTQSENERLTSVAQ---ELKEINQNVE
YA046_MOUSE     ----------------------------------------------------------------------
Y658_HAEIN      EQQVRDYLGSFAQAVKSFSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQA--LTEALVDYSLVVV
USO1_HUMAN      ----------------------------------------------------------------------
POF1B_MOUSE     ----------------------------------------------------------------------
MYH2_HUMAN      QQEISDLTEQIAEGGKRI--HELEKIKKQVXXXXXXXXXXXXXXXXXXXXXXGKILRIQLELNQVKSEVD
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     -----------------------------------------------QRIQVRQLAEMQATVRSLEAEKQ
C102A_XENLA     LEILSKELGALKRERQEAATETEQLRKE------------LERLQGKARVLVSNDHDIEEPVRDVEIEKL
SLMAP_RABIT     LQRLHMDIENLREEKDNEITSTRDEL-LSARDEILLLHQAAEKAASERDTDIASLAELEKAASEYEKEVT
ODFP2_XENLA     RQETETYRXXXXXXXXXXXXSDADTEKMHLQLKLHEQEEKVEDL-------LAQL-KTEKDLSKTASEVS
MYSP_DIRIM      NARITDSINNNLTAIKNKLETELSTAQADLDEATKELHXXXXXXXXXXXXXXXXVEQLHEE-QEHSMKID
MYH1_HORSE      MLDAEIRSRNDAIRIKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRG------
M12_STRPY       LADAKKDFELAALGHQHAHNEYQAKLAEKDGKQLEEQKQILDASRKGTARDLEAVRQAKKA-----TEAE
IKIP_RAT        -----------------------------------------------------EVAGLQRSIHDIENSEE
FKB15_HUMAN     LTKVQAKLSELQE------TSEQAQSKFKSEKQNRKQLELKVTSLEEELTDLVEKESLEKNLSERKKKSA
F184A_HUMAN     XXXXVNEAKRTQEYYERELKNLQSRLEEEVTQLNEAHSKTLEELAWKHHMAIE--AVHSNAIRDLQMDLE
ATG11_NEUCR     ----------------------------------------------------------------------
Y328_MYCGE      ----------------------------------------------------------------------
OV71_ONCVO      ----------------------------------------------------------------------
MYH2_PIG        QQEISDLTEQIAEGGKRI--HELEKIKKQVEQEKSEIQXXXXXXXXXXXXXXGKILRIQLELNQVKSEVD
MYH2_CANFA      QQEISDLTEQIAEGGKRI--HELEKIKKQVEQEKSEIQXXXXXXXXXXXXXXGKILRIQLELNQVKSEID
MFP1_TOBAC      ---------------------------------------------------LVERDESKKELDAIQKEYS
KINH_SYNRA      ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     --------------------------------------ELLQKIKKQETRDILQKHQAEKAALADTHKAD
CCD41_RAT       KTHLLQKLKSLEAEVAELRAEKENS-----GAQVE----------NVQRIQVRQLAEMQATLRSLEAEKQ
BRE1_CAEEL      PSETAAKLQDLEEMNKKVQTLTQENSKLRLETQTFFSVDSIKNLKKYYSLAIKEYERVSKDLEDITTERD
SBCC_STAS1      -----------------------------------------------------QIRQFDQTLNEIEQKI-
MYH8_RAT        ----------------------------------------------------------------------
ERC2_MOUSE      ----------------------------------------------------------------------
ERC2_HUMAN      ----------------------------------------------------------------------
ATG11_CANAL     ATSKTKEIADLNKTVSNL--------RSELGDAMHMKNDLLSNLSSKEAEFTKERNQFNNDLKALQLKLD
SMC1_SCHPO      RPELISIAEKALESKSNLRKIQRKAAEIE-----------------KDYSDQASTLQV------------
RB6I2_RAT       VIEMKSKISSMERGLRDLMLKSNGALSTXXXXXXMKQMEVYRSHSKFMKNKIGQLSRKDTELLALQTKLE
ODFP2_CHICK     EAEN----NRLTTQIRNLRSEAQHKAEVEIKDQLKELRQKADR--DKDALKRALRAQKERAERECAGQLA
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      LVEVETRYKTEISRIKKKYETDIRELEGALDNANRANAEYLKQIKSXXXXXXXXXXXXXXATRQLD---D
HOOK1_DANRE     NDELTS------------LAEESRSLKDELDI-LRSCLEASVETYRKKLEDLSDLRRQMKALEEKNMTYN
CYTSA_DANRE     QSDKLEHCGRQIEYFRSLLDEHGVAYSVDEDIKSGRYMELEQRLAENARFEREQLLGVQQHLSN-TLKMA
CP250_MOUSE     ----------------------------------------------------------------------
CP135_DANRE     QEEFRFDLENTIEKLEREKADLRAQVTV-----LKESRVVVEKELKAQSAVLLQNVEEATQQRVESSALR
CI093_HUMAN     QREERLRKEFEATTLRVRKLEENIEAERAAHLESKFNSEIIQLRIR----DLEGALQVEKASQAEAV-AD
CD158_HUMAN     QTE--------CEALKLQMTEKDKVIEI-LRQQIENMTQLVGQHGRTAGAMQVEKAQLEKEINDRRMXXX
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------INEKES
SBCC_LACLA      FTETIEESSYKELG--NLLKEIDESQKKQTVXXXXXXXXXXXXXXXXXXXDLKKI-EADEFEKELSILYS
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     ----------------------------------------------------------------------
ODF2L_XENLA     ----------------------------------------------------------------------
MYO3_SCHPO      EQTISSKYKELEKDYLNIMADYQHSSQ--------------------------HLSNLEKAINEKNLNIR
MYH6_MESAU      ----------------------------------------------------------------------
MYH1_MOUSE      -LDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHSNRMAAEALRNYRNTQGILKDTQLHLDDALRG------
IFT74_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     -----------------------TTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIR
BRE1_ASPFU      GGDSASGNREEQSPVNGLPSSAERNTELEAHKQLVAVSEQKEQLQKLESENANLLSQITELNIKRTKPTD
ALM1_SCHPO      LTSQQSLYNNVTEELNNQLLISENSLR-ELQEKYDSVVSELQVVKENKNTSVSPLAQKLSAVQNPEFKVY
VIME_ONCMY      ---------------------------------------------------------VDFALSDAEFKAN
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      MLDAEIRSRNDAIRIKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRG------
MYH1_HUMAN      TLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRS------
MYH1_CANFA      -LDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRG------
KI21A_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      RVAAEQALEHLREAYSEADAKSQEYSSKFSQVEQKLDQEIKERDEKYADLDAKRIQEIQKEKDDLDARFR
EEA1_MOUSE      LTKKEEENVVLKQEFEKLSQDSKTQHK-ELGDRMQAAVTELTAVKAQKDALLAELSTTKEKLSKVSDSL-
BRE1_CANGA      HTDSSQSSGITEEEKKKLFLQYENKI-TDLESHNSSLNRIIEELENYKQLNEKELAQTRLEISNLLSEKH
Y4862_ARATH     VEKTASLV-RKSESIKEMLEESTKTVENDSKRKLADVSEALEIANSELSDKTSEVFQIEFQLKSIAKRLK
TPM_LEPSA       ---------------------------------------------------------IKKKMQAMKLEKD
SMC4_ARATH      ----------------------------------------------------------------------
ROCK2_HUMAN     NAEYQRKADHEADKKRNLENDVNS---------LKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALL-
OPTN_CHICK      SSEMASNIAKSADESKNL--ESEELTVSQLLCCLRNETQRREKLEKELQDHKERLSKMENETSNCLESGT
HOOK2_XENLA     YKKKLEDLGDLRRQVK--LLEERNTMYMQRTFQLE------EDLHKANA-SRGQVESLSRQVQELHKKHS
FTM_HUMAN       ------NYDKLYDSAFSAAHEEQWKLKEQ---QLKVQIAQLETALKSDLTDKTEILDRLKTERDQNEKLV
CAGE1_HUMAN     ------------------------------------CRENCEMPDWEQSAESLQPVQEDMALNEVLQKLK
SMC4_DICDI      VTQKASN-DKLLEFEKNL--KQQNKQLDELNKQMAKCKNELLTTEK----------------KGVKYKEE
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
PIBF1_HUMAN     ---------------------------------------------------LTKIEELEEKLNDAL----
KLPA_EMENI      EV-YKSRVGELEEA-KSEQTEQNIRLKVELDVRLAEAEDALKNAQRDHEIAIDELMSRQRAECE-SVRYE
GOGC3_ARATH     LTGQESHIGPGMEHLKEVLEKENNELKLKRS-ELEAALEESRKLTKPESFPGKE--EMEQSLQRLEMDLK
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     KSQMASPDENVSSGEKXRETEAAQMEHQKERNSFEERIQALEEDLREKEREIANSLKRDKAIQGLTMALK
CK5P2_HUMAN     ----------------------------------------------------------DKAIQGLTMALK
ATG23_DEBHA     QKEYESQIKILNDEIKEKDTEISSLTDANIDYNIK--VXXXXXXXXXXXXXTGRLGRENNGLEEINSXLD
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     EKDVVSAHGR-EEASDRRLQQLQSSIKQ---LEIRLCVTIQEANQLR-----TENTHLEKQTRELQAKCN
ROCK1_RABIT     EQEV-----NEHKVTKARLTDKHQSIEEAKSVAMCXXXXXXXXXXXXXXXXXNRVVQIEKQCSMLDVDLK
ROCK1_PANTR     EQEV-----NEHKVTKARLTDKHQSIEEAKSVAMCXXXXXXXXXXXXXXXXXNRVVQIEKQCSMLDVDLK
ROCK1_HUMAN     EQEV-----NEHKVTKARLTDKHQSIEEAKSVAMCXXXXXXXXXXXXXXXXXNRVVQIEKQCSMLDVDLK
RIPL1_XENTR     ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
LIN5_CAEEL      ----------------------------------------------------------------------
KIF4A_HUMAN     ES-TERTVSKLNQEIRMMKNQ-----RVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLE
KIF15_RAT       ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       QERLKTQMESITDSAETLL-----ELKKQHDLEKSSWFEEKQRLSSEVNLKSKSLAEDDEIFKELRMKRE
ERC2_RAT        ----------------------------------------------------------------------
DYHC_NEUCR      VEEAKASVSSIK---RQHLTEVRSMPTPPSGVKL--ALESVCTLIGHKANDWKTIQGIVRRDDFIASIVN
BPA1_MOUSE      QEQKL---------LQRLLEDRKSTVEV-----IKREGEKIAASAEPDRVKLTQLSLLDSRWEALLSRAE
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      ----------------------------------------------------------------------
LIPA2_MOUSE     STDDTSQIVELQELLEKQMKERLTALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAM---AQKED
HOOK_DROAN      SADYVQQNAQFEEDAKRYANTK------------------------------GQVELFKKEIQDLHAKLD
FLIP1_HUMAN     ---------------------------------------------------IEQLGLQSQKVQDLTQKLR
CYTSA_MOUSE     QSDKLEHFGRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRLAENARFEREQLLGVQQHLSN-TLKMA
CUX1_MOUSE      RTE-----------LFDLKTKYDE-----------------ETTAKADEIEMI-MTDLERA--NQRAEVA
CP250_HUMAN     RTRQTKILEEDLEQIKLSLRERGR----ELTTQRQLMQERAEEGKGPSKAQRGSLEHMKLILRDKEKEVE
CEP63_PONAB     HREDRSEIERLTAKIEEFRQKSLDWEKQRLIYQQQSSLEAQKALAEQSEIIQAQLANRKQKLESVELSSQ
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      KTEVLSDLQHAIDILKEQWTKIDQRSNDTKSSSTQDAL-------------IKEIQDLEKGFRELS----
ATK3_ARATH      QVQLAREQTEKLAANDSLGKEKEARLSVE-----KAQAGLTEELGKAQG-DLQTANQRIQSVNDMYKLLQ
AGL19_ARATH     ----------------------------------------------------------------------
YHLA_SCHPO      ----------------------------------------------------SQLSQVKKSNDDL-----
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       -------------------------------------------LEKDNAIDRAEIAE--QKSRDANLRAE
TPM1_BOMMO      ---------------------------------------------------------IKKKMQAMKLEKD
TAXB1_XENTR     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ----------------------------------------------------------------------
SBCC_STAAM      ----------------------------------------------------------------------
SBCC_STAA9      ----------------------------------------------------------------------
SBCC_STAA2      ----------------------------------------------------------------------
SBCC_STAA1      ----------------------------------------------------------------------
RUFY3_RAT       --DRTAEGQALSEARKHLKEETQLRLDVEKELELQ--------ISMRQEMELA-MKMLEK---DVCEKQD
RUFY3_HUMAN     --DRTAEGQALSEARKHLKEETQLRLDVEKELEMQ--------ISMRQEMELA-MKMLEK---DVCEKQD
RAD50_METAC     ----------------------------------------------------------------------
RABE1_HUMAN     ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        ----------------------------------------------------------------------
MYH4_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     -----------------------------------------------------------KKLEDDILVMD
MRCKA_HUMAN     E-HYSKQLENELEGLKQKIEHQQEITKLKTDLE-KKSIFYEEELSKREGIHANEIKNLKKELHDLALNKE
LAML3_XENLA     RAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQ-----TIREQLDFQKNIHTQEVKEIKKRHDTRIVEID
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     KEDAEKFRQWKQKKDKEVIQLKERDRKRQYEL-----LKLERNFQKQSSVKTEEAAAANKRLKDALQKVT
IFA3_CAEEL      ----------------------------------------------------------------------
CNPD1_PEDPA     RQQELERVSNLTEDAKNLISETEAKLEKERALIIKEGLEDAE----------------------------
CCD62_HUMAN     ----------------------------------------------------------------------
CCD21_HUMAN     ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
TAXB1_PONAB     LTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLDKLKKAQHEREQLECQLKTE
SYCP1_HUMAN     ----------------------------------------------------------------------
SPD5_CAEEL      SINDKLNVSAILEAAKDLHNMSLNFSILEKSIVSQAAEASRRFTIAPDAEDVASSSLLNASYSPL-FKFT
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       ----------------------------------------------------------------------
RABE1_MOUSE     ----------------------------------------------------------------------
QN1_COTCO       YEKELSQLGQ-----ENYVLQSKLRSVEELSKE-KRWIHQTGTVSVPEE----KLAQIQKEMEDQEVIIQ
NDC80_CRYNE     AYDQEMVVTKSMDRFEGLLTDYNS-LAHQIGL-------------LDSSLDVPSLA----ANVNYNLDVD
MYSP_SCHMA      DLETFLDXXXXXXXXXXXXXQITEHKRLQLANEIEEIRSTLENLERLRKHAETELEEAQSRVSELTIQVN
KRT34_HUMAN     ----------------------------------------------------------------------
ION3_CARAU      KMKLEADLHNLVEDFKNKYTECENDFKVELEAKLESLSDEINFLRQ---IFEEEIRELQSQIKDTSVVVE
IFEA_HELAS      ----------------------------------------------------------------------
GOGA4_HUMAN     VKRQENLLKRCKETIQSH-KEQCTLLTSEKEAXXXXXXXXXXXXXKIKDLHMAEKTKLITQLRDAKNLIE
GOGA1_HUMAN     -----------------------------------------------------------------SEKMD
EDE1_YEAST      ----------------------------------------VNSLSKQASITNDKKSRATQELKRVTEMKN
DMD_PIG         LSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVT---ERKQQLEKCLKLSRKMRK
CYTSA_CHICK     GTLTSSVEGSAPGSMEDLLSQDEHTLSNSMDNLDSECSEVYQPLTXXXXXXXXXXXXXXXGVPSIERRKG
CEP63_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
AN30B_HUMAN     --------------------EDVSSVESTFSLFGKPTTENSQSTKVEEDFNLTTKEGATKTVRDIGIPQD
TEKT4_RAT       ----------------------------------------------------------------------
SMC6_YEAST      -------IAHLEEELTKEMGGDKDQMRQELE-QLEKANEKLREVNNSLVVSLQDVKNEERELRTISRSI-
SMC3_YEAST      LNEVINQMERLDGDYNNTVYSSE---------------QYIQELDKREDM----IDQVSKKLSSIEASLK
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------DKAIQGLTMALK
YNP9_CAEEL      EDETRKAIEKL-EKSKVTITELEQQADQTRQEHFKTVEDLASSRDKAE--------RLEKTLKVLK----
TPM1_CIOIN      -------------------------------------------LDKENAIDRAEQAETDKSAEDKATGLE
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
MYSP_ANISI      ---------------------------------------------KHQDVCLDYTEQIEQ-LQKKNSKID
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     KLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLNEEIERLKNK----IADSNRLERQLEDVALRQE
LVA_DROME       ----------------------------------------------------------------------
KIF4_MOUSE      XX-TEHTVSKLNQEIRMMKNQ-----RVQLMRQMKEDAEKFRQWKQQKDKEVIQLKERDRKRQYELLKLE
K2C5_BOVIN      RGRLDSELRNMQDLVEDFKNKYEDEIN-------KRTTAENEFVMLKKDVDAAYMAKVDALMDEINMFFD
HOOK3_XENLA     NTMYMQNTVSLEEELKRQVVELQNRLSEELEFEYKRLKEKIDSLQKEKDRLRSERDSLKETIEELRCV--
CL190_DROME     ----------------------------------------------------------------------
CC146_HUMAN     ------------------------TIPVQIGKEIEKITRKKVEMEKKKIVLEQEVKTLNDSLKKVENKVS
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       -------------------------------------------LEKDNAIDRAEIAE--QKARDANLRAE
SMC2_MOUSE      KEKLGRNVNLRA---MNVLTEAE-----------------------------------------------
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------
RUFY3_PONAB     --DRTAEGQALSEARKHLKEETQLRLDVEKELEMQ--------ISMRQEMELA-MKMLEK---DVCEKQD
ROCK2_RAT       ----------------------------------------------------------------------
ROCK1_BOVIN     VNEHKVTKARLTDKHQS-IEEAKSVAMCEMEKKLK---EERDAREKAEN----RVVQIEKQCSMLDVDLK
RIPL1_XENLA     ----------------------------------------------------------------------
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      NREIDEEKNHL----RLLASKNSDKALAETNIRLQEVTKELETLRMKNSNDLNEIHDLREENEGLTLKID
MYSP_CAEEL      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MRCKA_RAT       QISYSPGICSIEH--------QQEITKLKTDLE-KKSIFYEEEISKREGIHASEIKNLKKELHDLALNKE
GRDN_HUMAN      ESEVSRYKERLHDRVEELKEDNQVLLETKTMLQLEGTRARSDKLHELEKENL----QLKAKLHDMEMERD
DCTN1_DROME     ---------------KVALLEAQKT-SAELQAQLADLTEKLETLKQRRNEDKERLREFDK------MKIQ
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     AQDQCRDAQLRAQELEGLDVEYRGQLKEQISLAEKKMLDY-EMLQRAE----AQSRQEAERLREKLLVAE
CASP_ARATH      ---------------RNLAEENQKTMELALQDQLRQAKDSVSTMQK-----LHELAQ--NQLFELRAQSD
ANR62_HUMAN     EEERIKAEELYEKDIEELIMEEQYRTQTEVKKQSKLTLKSLEVELKTVRSNSNQLWQENHLMRDLRLEID
U634B_HUMAN     EKKKRRNVEELHQKVREKLTEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRL
U634A_HUMAN     EKKKRRNVEELHQKVREKLTEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRL
TRAF3_HUMAN     ----------------------------------------------------------------------
RICKA_RICFE     ------------------------------------------------------LAQENNALNTILSQVN
MYOJ_DICDI      STQVSTNVSHQKEKITTL----KSTIE-----------ELNKSIGKLQ----AEQKNKDDEIRKIQFELN
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      QELTINNVNYLEADVKQLLYQLQATKNKELEAKVKECLNNIKSLTKEENKEEKCQNLSDASLKYIELQEI
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     E-HYSKQLENELEGLKQKIEHQQEITKLKTDLE-KKSIFYEEEISKREGIHASEIKNLKKELHDSEGQQL
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ----------------------------------------------------------------------
KLP3_CAEEL      ----SLDFGNLSERLKNALSQMQKVARVN---------ELLETDEDYES---------------------
KINH_DROME      ----------------------------------------------------------------------
KIF4_XENLA      E-EAQRHLNDLLEDRKILAQDAQLKQKTDAG-------ERIPTKIRRRTYTVAELENLEEEA-SVTKQIE
K2C5_PANTR      RGRLDSELRNMQDLVEDFKNKYEDEIN-------KRTTAENEFVMLKKDVDAAYMAKVDALMDEINMFFD
K2C5_HUMAN      RGRLDSELRNMQDLVEDFKNKYEDEIN-------KRTTAENEFVMLKKDVDAAYMAKVDALMDEINMFFD
IFD1_CAEEL      ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     ----------------------------------------------------------------------
SAS6_DANRE      QQQKNSVEGN-AESKQLQISKLESTVK-------------------------------------------
RUFY3_MOUSE     --DRTAEGQALSEARKHLKEETQLRLDVEKELELQ--------ISMRQEMELA-MKMLEK---DVCEKQD
RHG29_MOUSE     ----------------------------------------------------------------------
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        LIETSERVQLLHSQNTSLINQKKSQLQTEVEEAVQECRNA-EEKAKKAITDAAMMAEELKKEQDTSAHLE
MYH7_MOUSE      LIETSERVQLLHSQNTSLINQKKSQLQTEVEEAVQECRNA-EEKAKKAITDAAMMAEELKKEQDTSAHLE
MYH4_PIG        ----------------------------------------------------------------------
K2C75_MOUSE     RGRLDAELRNMQEVVEDFKVRYEDEINKRAAAEN-------EFVGLKKDVDSAYMNKVE-----LEAKVD
K1C27_CAPHI     ----------------------------------------------------------------------
K1C27_BOVIN     ----------------------------------------------------------------------
K1C14_HUMAN     ----------------------------------------------------------------------
K1C13_ONCMY     -------------------------------------------------------------------KLE
EMIL3_HUMAN     NGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFLAANTSLDERERKVEAEVQ
CYTSA_PANTR     QSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRLAENARFEREQLLGVQQHLSN-TLKMA
CYTSA_HUMAN     QSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRLAENARFEREQLLGVQQHLSN-TLKMA
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------VNLELE
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------AQITDDENSLSTIAYKHT
OPTN_DANRE      QDEAESMKRNLQDRCKD-LEQDLGTLKTQLGDKQKDCLKVMESLTQDEKNNLNQLKDAYTKLFEDYSELQ
MYH1_BOVIN      ----------------------------------------------------------------------
MUKB_VIBVY      ----------------------------------------------------------------------
MUKB_VIBVU      ----------------------------------------------------------------------
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     ----------------------------------------------------------------------
KRT36_MOUSE     ----------------------------------------------------------------------
K2C75_HUMAN     EINKRTAAENEFVALKKDVDAAYMN-KVELEAKVK---SLPEEINFIHSVFDAELSQLQTQVGDTSVVLS
K1C18_ONCMY     ----------------------------------------------------------------------
K1C12_RABIT     ----------------------------------------------------------------------
IFEB_HELPO      ----------------------------------------------------------------------
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      LTSGMSPFGHAASAIRESRTREKKEMS-ELNDRLASYIEKVRFLE-------AQNRKMEKDLNLLRGKWD
ICR5_ARATH      -----------------------------------------------------EVRSLEKLVRQLEERVN
HOOK_AEDAE      ----------------------------------------------------------------------
GR1_ARATH       ----------------------------------------------------------------------
GOGC5_ARATH     QAAQEAQIRKLRAQIKGLITKLQSEEKVESIKRDKTATEKLETIEKHQAELTSQKDYYSNXXXXXXXXXX
GOGC4_ARATH     ---------------------------------------------------------------------D
DCTN1_CHICK     ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      KVEELSRIAELSEAKDIILADTEKDLAHDIATRIKEAREVKDRSNKIAKDLLAQAMQ-------------
CNPD_STRA3      KVEELSRIAELSEAKDIILADTEKDLAHDIATRIKEAREVKDRSNKIAKDLLAQAMQ-------------
CNPD_STRA1      KVEELSRIAELSEAKDIILADTEKDLAHDIATRIKEAREVKDRSNKIAKDLLAQAMQ-------------
CIP2A_HUMAN     ------------------------------------------TQAETEARTLASLREVERKNEELSVLLK
CENPH_HUMAN     ----------------------------------------------------------------------
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      ENQTTNDELNKLNKVLNERINALESERHETGDNSK-----ISELSKDELIQ--RINMLNSEIKEIEQAFQ
BIMC_EMENI      ----------------------------------------------------------------------
ATK2_ARATH      -------------------------------VQVQLAKEQTEKLAANESLGKEREARI--AVESLQAAIT
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     EKKKRRNVEEVHQKVREKLTEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRL
SMC6_MOUSE      QSVDIATLEDEAEEIKMQMVEKNMEQQKENMENLKSLKIEAENKYDTIKLKINQLSELADPLKD------
SBCC_CLOAB      ETENMAHV--LREKLKS-------------GEACPVCGSVHHIKEGFKEVDLKALETLKSELEGFEKKRK
SAS6_DROME      ----------------------------------------------------------------------
RBP2_PLAVB      ETDIDSLNTALDELLKKGRTCEVSRYKLIKDTVTKEISDDTELINTIEKNVKAYLAYIKKNYEDTVQDVL
NFM_HUMAN       ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------QPDLVPPESKSRNVEYYKAQCEKKNQTIRQLENTLL
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_HUMAN      QAENDASKEEVKEVLQAL--EELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTN
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
FPP6_ARATH      ----------------------------------------VETLS-PDCIDKVALPESKVVDKDSSQEIN
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CING_MOUSE      ------------------LDEAQRGL-ARLGQEQQALNRALEEEGKQREALRRSKAELEEQKRLLNRTVD
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     IAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKELFENLSEKLQ
ARK1_ORYSJ      LESTIKRLMEKEKGKNNILSEQIIHLETSLDENKQKQLENISNTN----ILADTTKSHEKKIRELLKQLE
YTTA_BACSU      ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     LTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLDKLKKAQHEREQLECQLKTE
TAF1_SCHPO      ----------------------------------------------------------------------
SYNE2_HUMAN     ------------EQLLESITESENKIQI-LNNWLEAQEERLKTLQKPESVISVQKLLLD--CQDIENQLA
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     LNEPLAKVSLLKDDLQGAQSEIEAKQEIQLRKELIEAQELART-SKQKCFELQALLQVEESTKQIQV-LQ
NFM_BOVIN       ----------------------------------------------------------------------
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     EEPTSMEVQPMTEELKQQKLNSHETTITQQSVSDSHLAELQEKIQQTEATNLNEMSYELKCAQESSQKQD
MUKB_EDWI9      SVRLNVNVRDSHAMLLNVLSEQQ-----------------------------------------------
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       VTELEEDLG----------TARRDLIKSE-ELSGKHQRDLREALAQKEDME-ERITTLEKRY------LA
HOOK_DROPS      YKKKLEDYNDLKKQVKIL--EERSADYVQQNAQF-------EEDAKRYANTKGQIELFKKEIQDLHTKLD
HOOK_DROPE      YKKKLEDYNDLKKQVKIL--EERSADYVQQNAQF-------EEDAKRYANTKGQIELFKKEIQDLHTKLD
EPI1_CAEEL      ----------------------------------------------------------------------
EFC4B_MOUSE     ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
BRE1A_CHICK     --------FDLDQGLGDLLSERKALVERERGEGLEPAFSFLATLSTSEEIESQLQERVESSRRAVAQIVT
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      ITETSADSTEVSSKGETLVQKTAGQMNT-IDHSVKAAEQVVKGL-EIKSKDITNILRVINGIADQTNXXX
TFB1_SCHPO      EEASDSKVVLKIKGQDQLLENNFVPSKNQVGLEPLPSLEALQHLYQEDSISLNHIEHDSDSLAEAAMQLQ
SMC2_CHICK      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      EKEVGSEVETLSIQVTSLFKELQETKLSEAELMKKRLQEKCQALERKNSATPSELNEKQELVKKLELQVE
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP2_DROME     --------------------------------------------------------RVSSSLHNVKRQLS
MYO2_YEAST      ----------------------------------------------------------------------
MYH7_CANFA      LIETSERVQLLHSQNTSLINQKKSQLQTEVEEAVQECRNA-EEKAKKAITDAAMMAEELKKEQDTSAHLE
MYH4_RABIT      ----------------------------------------------------------------------
MYH4_HUMAN      ----------------------------------------------------------------------
LAMA2_MOUSE     QIENTLKEGNILDEANQLLGEINSVIDYVDDIKTK-----LPPMSEELSDKIDDLAQEIKDRRLAEKVFQ
K1C27_RAT       ----------------------------------------------------------------------
K1C27_MOUSE     ----------------------------------------------------------------------
IF3T_TORCA      ----------------------------------------------------------------------
HOOK_CULQU      YKKKLEDYNDLKKQIKMLEERSAEYLKQNSDFE--------EEAKKYAGLK-GQVELYKKEIQDLHAKLD
HIP1R_HUMAN     --DTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQKPKSLDVRQEAVVDKEMAATSAAIE
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     -IEMATLDKEMAEERAESLQQEVDTLKDKVE-EHKIDLEILKHEIEEKGSDGAQNARLKEALRDLSASEK
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
TPM1_LIZAU      ---------------------------------IKKKMQMLK-LDKENALDRAEQAESDKASEDRSKQLE
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ----------------------------------------------------------------------
MRCKB_RAT       AVAEASKERKLSESFSKQMERELETLKVKQGGRPGATLEHQQEISKIRSELEKKVLFYEEELREASHVLE
LAMA1_HUMAN     -------------------------------------------------------------LEGVAEETD
KIF15_STRPU     ----------------------------------------------------------------------
K1M2_SHEEP      ----------------------------------------------------------------------
IM30_ARATH      ----------------------------------------------------------------------
GAS8_HUMAN      ---------------ESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNFERQVREIEAKYD
FAT1_SCHPO      ---------------------------------------------KNMQLELASLKQISAAIKDFKKEIN
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     NGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFSAANTSLDERERRVEAEVH
DYH1A_CHLRE     ----------------------------------------------------------------------
DMD_CANFA       ------------------------------------------------------------------LRVA
CROCC_HUMAN     ----------------------------------------------------------------------
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     QDQRRD---------AELRVHELEKLDVEYRGQAQ-AIEFLK-----EQISLAEKKMLDY---ERLQRAE
CLC4F_RAT       ----------------------------------------------------------------------
BPA1_HUMAN      GRQLNQTTGKAEEAMQ----EASDLKKIKRNYQLE-----LESLNHEKGKLQREVDRITRAHAVAEKNI-
ATI_CAMPS       ----------------------------------------------------------------------
ATI_CAMPM       ----------------------------------------------------------------------
ATI_CAMPC       ----------------------------------------------------------------------
CP250_MOUSE     LEEAQRDLAQRDHELETLRQEKQQTQDQEESMKLK-----------------------------------
IFA1_CAEEL      DTET------------------------------------------------------------------
PIBF1_HUMAN     KNQMALDLEQLLNHREELAAMKQILVKM------------------------------------------
AV71_ACAVI      KGETAS----------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SQNQKTELHVASGFDVQNQQASRIIQQLSDMRVFFEESSTASIKLADTKQTNGMLQEKVKIAEATLAQIN
CP135_MOUSE     STNSTSPNHLVSCVEKEKERA------LSELRRITAEKEALREKLKNIQERNAVGKSDL---EKTIEHLT
USO1_YEAST      AKNLKNELETKLETSEKEKEATETKQQLNSLRANLESLEKEHEDLAQLKKYEEQIANKERQYNEEISQLN
NUF1_YEAST      NNSDVQSLKLRSXXXXXXXXXXXXXXXXXXAE---EKDTQLEFKKNELKRTNELNELKIKSDEMDLQ---
SPO15_SCHPO     NELSESKNSLQTLCNAFQEKLAKSVMQLKENEQNFSSLDTSFKKLNESHQNHQTITKQLKDTSSKLQQLQ
CP135_HUMAN     YNEAQEELSALRKESTQTTAPHNIVSALSDLRRIMAEKEALREKLEHIEEVSLFGKSEL---EKTIEHLT
PUMA_PARUN      AANDR----VASLNTTINEQTSKI-RELNSHEHRLEED------LADSRATSSAIENDLGNATGRLRSSE
TSG10_MOUSE     ---QETAFNEKAHLEQRIEELECTVHNLDDERM--EQMANMTLM----KETITTVEKEMKSLARKAMDTE
HOOK_BRAFL      TV-QKEKQRIVNERDTETNEELHCMQLQQGKAMLYSTGSLAGIXLIRLQHENKMLKERLAVSQAMLDDAQ
SGM1_YEAST      --------------------------------------------------TDSSFFKLIKEKDDLIDQLR
MY18A_HUMAN     DQEEELD-EQAGTIQMLEQAKLRLEMEMERMRQTHSESRDEEVEEARQSCQKKLKQMEVQLEEATLSQVN
MYSP_DERFA      EYEEQLELNKCSSLEKQKSRLQSEVEVLMDLEKATRHAQQLEKRVAQLEKIN--LDLKNKLEEVTM----
CLIP1_MOUSE     MQDTVNKLHQKEEFNVLSSELEKLRENLTDMEAKFKEKDDREDQLVKAKEKENDIAEIMKMSGDNSSQLT
GOGB1_HUMAN     STKQDGDKSLSAVPDIHQDELERLKSQILELELNFHKAQEIYEKNLDEKNLNQLIEEFKKNADNNSSAFT
EEA1_HUMAN      QLTEKLKNQSESHKQAQENLHDQVQEQKAHLRA--AQDRVLSLETSVNELNSQLNESKEKVSQLDI-QIK
CC150_MOUSE     TMLQKDHLHLNKALEVKYTQAN---SELSASKAYLEQTEA---HLKEMKSILGKNEEELAQA------VK
KTN1_CHICK      XXXXXXXXXXXVSFQSLVDELQKVIHEKDGKIKSVEELLQAEIKVANKEKTVQALTQKIEALKEEVGNSQ
ODFP2_RAT       VQLADKDLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQSLEEKMREDRDSLVEFK
GCC2_HUMAN      KQCEASEKNIQKKYECELENLRKATSNAN------QDNQICSILLQENTFVEQVVNEKVKHLEDTLKELE
UACA_MOUSE      KLRDENEVLRRNLENVQNQMKADYVSLLADHRQGQEEIVSLHAEIKAQKKELDTIQECIKLKYAPLARLE
MY18A_MOUSE     DQEEELD-EQAGSIQMLEQAKLRLEMEMERMRQTHSESRDEEVEEAKLKQMEVQLEEEYEDKQKALREKR
TSG10_HUMAN     ---QETAFNEKAHLEQRIEELECTVHNLDDERM--EQMSNMTLM----KETISTVEKEMKSLARKAMDTE
NU211_SCHPO     VQNVSSQLSICNS---QLEQSNHIVDNLKSENLLLTDLSNLESKLSSLQQDNFHMKAQIESSQEYTATVD
KTN1_MOUSE      TENSTLTREVQELKAKQSDQVS-FVSLIEDLRVIHEKDGQIKXKVANKEKTVQALKQEIEVLKEEIGNAQ
MFP1_SOLLC      RDESKKELHA-------------IQKEYSEFKSNSDEKVASDATLGEQEKRLHQLEEQLGTALSEASKNE
RAI14_RAT       SQMQEAPDDSGDMKETMNRMVDELNKQVSELSQLYRE---AQAELEDYRKRKSLEDATEYIHRAEHERLN
CCD18_MOUSE     SKMEKEIIHLKRDGENKSMQLSQLDMVLDQTKTELEK-TTNSVKXXXXXXXXXXXXXXXXMQKREALENE
ANR26_HUMAN     KQNEETLTQTISQYNGR-------------LSVLTAENAMLNSKLENEKQSKERLEAEVESYHSRLAQSE
CE290_BOVIN     NERQRAE-HSQKMYEHVKTSLQQVEERNFELETKFAELTRINLELADSKTVSDADRQHILELEKSEMELK
HMW2_MYCGE      -QNQIQFKHQYQTYRDELSQLERKIQLTKQELV--DKESALRVKIDDADYINARLAELDDVAK----QLS
CE290_HUMAN     NERQRAE-HCQKMYEHLRTSLKQMEERNFELETKFAELTKINLELADSKAVSDADRQRILELEKNEMELK
UACA_CANFA      AINQNMK-------SVQDNSA----EILANYRKGQEEIVTLHAEIEAQKKELDTIQECIKLKYAPIISFE
TG278_CAEEL     SELEKTIAQLEIDNSSKSDQIEKLHLRVNDM---LDQMGTIKDELVKK-------NEEIKTISAKTAQLL
ODFP2_MOUSE     VQLADKDLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQSLEEKMREDRDSLVEFK
RAI14_MOUSE     SQMQEAPDDSGDMKEAMNRMIDELNKQVSELSQLYRE---AQAELEDYRKRKSLEDAAEYIHKAEHERLN
ODFP2_HUMAN     VQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSLVEFK
MYSP_OPIFE      ALSER--LDEAGGNSSQTHELKRREMEIGKLRKDLENAN-ASLEMAETSMR--------RRHQTALNELA
CE290_DANRE     ERNFELETKFAE-LTKLNLEAQRIERELRDE---LADSVSKHISDADRKRITEL--------EKTEANLR
NDC80_YEAST     NQNTQ-EITILSQLDEQDQRQERYELMVEKLLIYFTESYKSFLKLEDNYEPS--MQELKLGFEKFVHIIN
MYO1_YEAST      SQSLIKE----SKLKLENERLKDVINSKEEEIKSFNDKLSSSEEDLDIKLVT--LEKNCNIAMSRLQSLV
KI20B_MOUSE     LQEKSVSLRVQVQLVAEREQALSELSQIKDLEVIVETQKDECKRLVELEQS--ILEKESAILKL---EAN
GCC2_MOUSE      KENRVTQCEASENIPEKYQCESENLNEVASDAS--PESQNCSVALQEDPSAEQTVCDKVRQLEDSLKELE
ANT1_ONCVO      KVRKETTT-VQERYHIEDEERDNHQKKIDSMNALIDE-----------------LRSKLNDAERAMADLQ
CC110_MOUSE     ------------------------VAKIHYLQNYLKESLQNQKKMTELENENLALKTKMKPLVFTA----
TSG10_RAT       AFNEKAHL------EQRIEELECTVHNLDDERM--EQMSNMTLM----KETITIVEKEMKSLARKAMDTE
MYH15_HUMAN     AQLEITKK--------QETKFQKLHRDMEEATLHFETTS-ASLK---------------KRHADSLAELE
CE290_MOUSE     NERQRAE-HCQKMYEHLRTSLKQMEERNFELETKFTELTKINL---DAQKVEQMLRDELAVSDADRQRIX
TPR_HUMAN       SLNAEREVQVTAKTMAQHEE---LMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQ
MYO3_CAEBR      ------------------------------------------LKAGKEQEAMGELAEKIQKLEEAVQRGE
MRP4_STRPY      EQSRKIAA-LKSEAELKNQQALEALKQISDLNAQLKEAIEGYVQIQNASREIAAKQQELAAAKSQLEAKN
CENPE_MOUSE     SHTQGDLKHTNAVVEAQNQDLREKEHQLSQVKADLRETVDQMEQLKKKLEAQSSTLESREIEKLELTQQL
CCD18_HUMAN     NENRELKVRVAA----QNERLDLCQQEIESSRVELRSLEKIISQLPLKRELFGFKSYLSKYQMSSFS--N
CC150_HUMAN     TLTHNLQTLEEENKHLADQMASLELQQVTSDYHGLAQQKVEKITESKNKLANGKLQIKVK---------Q
MLP2_YEAST      LLDKHERKWMEEKADYERELISNI-EQTESLRV---ENSVLIEKVDDTAANNGSLETKLTTCKRELAFVK
MYH13_HUMAN     -----------------------------------EKTETANSKCASLEKTKQRLQGEVEDLMRDLERSH
CENPE_HUMAN     RDNLKT---IKEALEVKHDQLKEHIRETKIXXXXXXXXXXLNMKEKDNETTKIVSEEQFKPKDSALLRIE
Y147_TNAVC      SQSGKEDNDNHISQELQNAM-TQLDYSKNIIEEHVEQIQQLTAKNEDTERALNELQGDMRALEVDRSNIL
ICR2_ARATH      AKEGEAQAHIVSGTEKQLEIANLTLEMLSDGMKMSEACNSLTTELEQSKSEVRSLEQLVRLEEEDEARGN
CENPF_HUMAN     LQTQLKELNERVAALHNDQEACKAKEQNLSSQVECLELEKAQLLLDEAKNNYIVLQSSV-----------
MYH8_CANFA      QVKSEVDRKIA--------EKDEEIDQLKRNHIRVMESMQSTLD-AEIRSRNDALRVKKKM-EGDLIQLN
MYH3_RAT        EWKTKCEESQAE-LEAALKESRSLSTELFKLKNAYEE---ALDQLETVKRENKNLEQE--IADLT-EQIA
RAD50_RAT       RHQE----HIRARDSLIQSLAAHLELDGFERGPFSERQIKNFHELVRERQ-----EREAKTASQLLSDLT
APSB_EMENI      QRRDRS----IAGDSILDRSASRAQRPSSSISDRTGQSPIDDAEREDWELRNGQLRDQVSALKLENQAIR
ICR3_ARATH      SQNQFVE---TSALEEETDKTGSLVFQSVSQECDWEFSATAGERAGLAAVAHEIRQLKLQIEMVASSEAH
GOGA5_MOUSE     ----------------------------------------------------------------------
CP110_HUMAN     SELEKTQVAVXXXXQISQQQKGEIEWQKQLLRMTAESRALQSCVECLSKEKED-LQEKCDIWEKKLAQTK
MYSP_BLOTA      IDLQKTIKKQATGLQAHYDEVHRQLQQAVDQL--------------------GVTQRRCQALTAELEEVN
MYO2_CAEEL      DE-QAAVAKLQKGIQQDEARVKDLHDQLADEKXXXXEYDELTEQLEDQARATAAQIELGKKKDAELTKLR
MYH3_MOUSE      EWKTKCEESQAE-LEAALKESRSLSTELFKLKNAYEE---ALDQLETVKRENKNLEQE--IADLT-EQIA
MEDB_GIALA      AQIDELK-YGASNHNALVQEKRDLERHLADLRLSRQDTNSRLPQEIDRLRAE-IEDEKRNLPHMXXXXXX
DAPLE_XENLA     EEYEKKQLQKA--FDQSKEQVEKLDKMEKEVHRLEKQNEILTKKVTSIK----IVEEKMQGLEKENEVLE
CLIP1_CHICK     ------------------------LNKLQEAEIKVKELDVLQAKCNEQTKLIGSLTQQIRASEAALQKAN
TSG10_MACFA     ETNDELA-QIARERDILAHDNDNLQEQFAKAK---QENQALSKKLNDTHNELNDIKQKV---QDTNLEVN
MYSP_SCHJA      EMKRKLTMRITELEDVAERERLKAVSXXXXXXXXXXXXXDLQSEIESLSLENGELIRRAKSAESLASELQ
MYO4_CAEEL      ----------------------------------FTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELN
GOGA5_XENLA     ----------------------------------------------------------------------
F184B_HUMAN     AERKKLQREVEAQLEEVRKKSEKEIKQLEELNVKLQNSLLEVLRLEEFIQQNGAEESPQELGRQHCSILE
CEP63_MACFA     ------------------------------------------------------LQEKVKAADTQHA---
MYH3_HUMAN      ----------------------RLQGEVEDLMVDVERANSLAAAL-DKKQRNTKCEESQAELEASLKELS
EBH_STAES       NANKIIENAQPSVQQVSDEK-SKVEQALSELRADKQELQQAYNQLIQPTDLNNKKPASITAYNQRYQQFS
EBH_STAEQ       NANKIIENAQPSVQQVSDEK-SKVEQALSELRADKQELQQAYNQLIQPTDLNNKKPASITAYNQRYQQFS
CING_XENTR      TERKRMEDTLGEAAD-QEQELAFVKRDLGN-------------KLEEAQRSLKRLSXXXXXXXXXXXXXM
ZIP1_YEAST      LSSQKNQ--IISSLGTKEAQYEDLVKKLEAKNI---EISQISGKEQSLTEKNENLSNELKKVQDQLEKLN
SOJO_XENLA      KQVSKLEFEL----EKQRSMSEDMLQRTKDLHAANKELGLKTEEVQELCSTLNQVKLELKHTNVTLLQME
KI20B_HUMAN     DAKK---------------QIKQVQKEVSVMR---DEDKLLRIKINELEKKKNQCSQELDMKQRTIQQL-
IFA2_CAEEL      ------------------KEIRKLQDQLDELRKKFEEAQ------------RGRAEDRLKIDDVTLSNLE
CN145_MOUSE     KNNQKERDELKSQLCAALQQIENLRKELNDVALQEEELHCKEKKLNDIESHQAELELEVKNSLDTIHRLE
CING_SORAR      ------------------EDSKQALHQLQSQLEDYKEKSRREV--ADAQRQAKEWASEAEKSSGGLSRLQ
RB6I2_HUMAN     MLKSNGALSTXXXXXXMKQ-----------MEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQ
KIF15_HUMAN     -----------------NEQAFEAISE--ELRTVQEQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQ--
HMMR_MOUSE      XXXXXXXXXXXXXARLQQQLCSFQEEMTSEKNVFXXXXXXXXXXXDAVQQKEEQSERLVKQLESTAEQLT
DMD_MOUSE       ----KTMENVPAG----PEEITEVLESLENLMHHSEENPNQIRLLAQTLTDGGVMDELINEEEAVRKQKL
CLIP1_HUMAN     KEKENSLEAIRSKLDKAEDQ------HLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQ--
C144A_HUMAN     ------------------------------------------------KEKNDNLQKIIKLNEETLTELT
MYH6_HUMAN      --------------DEEMEQAKRNHQRVVD--------SLQTSLDAETRSRNEVLRVKKKM-EGDLNEME
CCD39_HUMAN     RLNQKNELTETISAQLELDKAAQDFRKIHNERIKQWENTIEQMQKRDGDIDNCAL-ELARIKQETREKEN
CASP_PONAB      YEEVKKELNILKSMEAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGRCAELQVRVTEAV-----
C144C_HUMAN     EEIALLRLEIDT---IKNQNKQKEKKYFEDIEVVKEKNDNLQKIIKRNEET---LTETILQYSGQLNNLT
RIPL1_MOUSE     --------------DVWRGEAQDLLSQIAQLQ---EENKQLMTNL--NHKDVGFSEEEFQKQEGMSERER
MYO3_CAEEL      ------------------------------------------LKAGKEQEAMGELAVKIQKLEEAVQRGE
MFP1_ARATH      TSNKELEEEKKTVLSL-NKEVKGMEKQILMER---EARKSLETDLEEAVKSLDEMNKNTSILSRELEKVN
KIF15_MOUSE     -----------------SEQALEAVSE--ELRTVQEQLSVLQVKLDEEERKNLKLQQNVDKLEHHSTQ--
GOGA5_HUMAN     ----------------------------------------------------------------------
DAPLE_HUMAN     KLQTQLEREKQSNQDLESEELIREKEQLSDMETLKADKARQIKDLEQEKRAMWSLRERSQVSEARMKDVE
CN145_HUMAN     ------------------------------------------------------------IRQWKLKHKK
CCD41_MOUSE     SAKLQAE-RLEKELQSSNEQNTCLISKLHRAD---REISTLASEVKELKHANKLEITDIKLEAA------
MYSN_DROME      RSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQ
MAD1_YARLI      AQNQKTEKKVATSIRQHTLAANEAKFLREQLKAYDDEEVTAA--GADVKQ--GRIDELEKLLEAVKNEKS
GOGA5_RAT       ----------------------------------------------------------------------
GOGA3_MOUSE     ESNKKLAL------ELEHERG----------------------KLTGLGQSNAALREHNSILETALAKRE
ROCK1_MOUSE     CXXXXXXXXXXXXXXXXXNRVVETEKQCSMLDVDLKQSQQKLEHLTENKE---RMEDEVKNLALQLEQES
FHAD1_HUMAN     LQNEVAELSQKVSETTTSRQNEKEISQ--KCQVLDEDIDAKQKEIQSLKSQISALQKGYKVLCQTLSERN
CCD67_MACFA     KQEILYQTHLIS-LDAQQKLLSEKCNQFQ------------------------------KQAQSYQTQLN
CC64B_XENTR     SEQRECGRESASAVQELSEQNQRLVEQLAQAS---QVEQAITLEMKSLKEENRDLTISRGQFAPCLQSLR
CASP_HUMAN      YEEVKKELNILKSMEAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGRCAELQVRITEAV-----
WIT2_ARATH      QKLKNTDLELKS----VNASKQEILVHLAEMENA-NESVKENLFEAESRAESG--EAKIKELDAANLELT
SCLT1_RAT       IANQE------KNWAVQLWQTAS--QELESVQKLYQEHMTAQIHVFENRKQKDQLQQLTKKLHVANENIE
HOOK1_CHICK     EKEQELDLQVAALQDEKNSLVSEN-EILNDRLEQLDDS---------LDDPNTVVAKKYFHAXXXXXXXX
GOGA5_DANRE     ----------------------------------------------------------------------
CGNL1_MOUSE     EENEKLQGRIAE----LERRAAQLQRQMEDVKG----------DEAQAKETLRKCESEVQQLEEALVHAR
CEP63_HUMAN     ------------------------------------------------------LQEKVK---ATNTQHA
YAF3_SCHPO      -----------------NERISAAADELSSMESI-NKNQANELKLAKQKCSN--LQEKINFGNKLAKEHT
RGP51_LYMST     ---------------------NRKVEDLQPIRDAYENELRQARKVIDE------LASSKGVAEGKLAGLQ
MYSS_CYPCA      -------------------------QRLQDAEESIEAVNSKCASLEKTKQR---LQGEVEDLMIDVERAN
MYH3_CHICK      ---KDTQIHLDDALRSQEEQVAMVERRANLLQAEIEELRAA---LEQTERSRKVAEQELLDASERVQLLH
MYH11_HUMAN     EMRQK-HAQAVEELTEQLEQFKRAKANLDKNKQTLEENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQ
MBO1_SCHPO      GLESRIKPDQSFNLSTPSPAPSNLITLQS-------RYSQALSELETTKRAFAALREKSKKTNYSVGAYN
LIPA_CAEEL      NQDQETRITTFESRFLTAQRESTCIRDLNDKLEHQLANKDAAVRLNEEKVHS--LQERLELAEKQLAQ--
IMH1_ASHGO      FADSKTEL------ERWQRTAANLEKQLERIRL-------------ETKRHDDNLESYIK----------
SDCG8_HUMAN     ---------------------------------------------ANTCNRVGGLCLKCAQHEAVLSQTH
SBCC_BACSU      TQNRQTEL----------KQQLKSLQVTSDERKSCQQAAEMALRIRQTEEQIKKEKKRSEELNLVLQKMN
MYSP_BOOMI      EYEEQLEALLTRCSNLEKQKSSEVEVLIMDLEKATAHAQNLEKRVAQLEKLN--IDLKSKVEELTI----
MYH6_MOUSE      -----------------NQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTNEALRVKKKM-EGDLNEME
GACN_DICDI      EQLEDAKVTI--------EQLKKHLNEEARERSILETYCTSEQKLQELEDINKSLTEE----KDSLGELL
FIL1L_MOUSE     KSKQEC-YSLKCNLEKEKMTTKQLSEELESLNARIKELEAIESRLEKTEIXXXXXXXXXXXXXVMLVERK
CING_DANRE      DSNMKTELEQAFGRNTQLQQSRRELQENQDQMVELRMDREGAXXXXNSPQSDSMLTVQAELSESQLLRQK
CASP_SCHPO      KQNTKEQKSGSSQDDLSNQQK----QQLDFMDSLNKKLST----------------ELESIKEASRKEME
CASP_MOUSE      DV-QRLQASLTKLRENSASQISQLEQQLN--------AKNSTLKQLEEKLKGQADYEEVKKELNTLKSME
UACA_HUMAN      RFKYFESDHLGSGSHFSNRKEDMLLKQ---GQMYMADSQCTSPGIPAHMQSRSMLRPELSLPSQTSYS--
UACA_BOVIN      ESEGKVKQHLTSDAATGNHRLMEELKQLKDMKVKYEGASAEVGKLRNQIKQNEMLVEEFKRDEGKLMEEN
TRIPB_HUMAN     SASRLTE-----QLDVKEEQIEELKRQNELRQEMLDDVQKKLMSLANSSE--------------------
SMC1A_MOUSE     PPHIKKALQYACG-------NALVCDNVEDARAFGGHQRHKTVALDGTLQKSGVISGGASDLKAKARRWD
RB6I2_MOUSE     MLKSNGAL-----------SSXXXXXXMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQ
KIF27_HUMAN     AAXXXXXXXXXXXXDIQNEKRANELEQSVDHMKY--QKIQLQRKLREENEKRKQLDAVIKRDQQKIKEIQ
HMW2_MYCPN      GQEKHKLLEARTQFDNRKQKQAELVKQLEQLTAAFNKEQEAKDRLANLEKQKEMLGDKVHQFDENSLNIS
GRDN_MOUSE      KLESELSRYKERLHDIEFYKA-RVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHEKAKLHDMEMERDM
CING_XENLA      EQLQSEVMHVKKENEGLAKESRRIQDQLKQVTVHQRERELSVLKGALKDEVSGRDRETEKLREALMTKRS
TPM_ECHMU       -----------------NDWLSKVKNIQTEVDTVQESLQEAISKLEETEKTNAEAEVAAMTRRIRLLEED
TPM_ECHGR       -----------------NDWLSKVKNIQTEVDTVQESLQEAISKLEETEKTNAEAEVAAMTRRIRLLEED
MIA3_MOUSE      ----------------------------------------------------------------------
CCD46_MOUSE     LQKHHTETKMEADYVVQMQSTNHMIKELEGVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELK
TEKT4_MOUSE     ----------------------------------FEESASTPETWAKFNQDNLLRAERERLASVNLRKLI
RAI14_HUMAN     SQTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEEKLMQLN
RAD50_METMP     TEEKKQELLEKYNSEIQNEQLSTILNKKEKMKVKLNEIDSFKLKYGELKEKNYSLKVEESIIETT-EKLN
MYSP_ONCVO      ALRKSLE------------------EQVKQLQVQIQEAEAAA--LLGGKRVIAKLETRIRDLETALDE--
MLP1_YEAST      SQVQDLQTRISQITRESTENMSLLNKEIQDL---YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTK
LIPA1_HUMAN     AQKEDMEERITT-LEKRYLAAQREATSVHDLNDKLEEIANKDSMHRQTEDKNRQLQERLELAEQKLQQTL
KINH_RAT        SEMEKEHLNKVQTANEVKQAVEQQIQQISSLRDEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKAVD
IFT74_HUMAN     -----------------------------------KESLEAEIAHSQVKQEAVLLHEKLYELESHRDQMI
FIL1L_HUMAN     ----------------EEQKATRLEKELQTQTTFHQDQDTIMAKLTNEDSQNRQLQQK-------LAALS
ANR26_MOUSE     ARDEWFRVKDKMNFDMSNQQLSKTERKLNSLEIEFHHTKTLALKHADLSQTQCQMKEKQESIEERLAQLQ
PU92_SCICO      -------------------------------------------------------------------QKN
MYH8_MOUSE      QEDLKEQLAIVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
MYH1_PIG        RKIAEKDEEI----DQLKRNHVRVVESMQSMLDAEIRSRNDAIRLK--KKMEGDLNEME-------IQLN
GOGA4_MOUSE     ----------------------------------------------------------------------
CNTLN_HUMAN     KRNQE-DVHTAESISYQ--------KLYNELHICFET----------TKSNEAMLRQSVTNLQDQLLQKE
CCD67_HUMAN     NNFEKLRLHQMK----QNKVPRKELPHLKEEIPF--ELSNLNQKLEEFRAKSREWDKQEILYQTHLISLD
CCD46_HUMAN     LQKQHTENKMESEYMAQTQSTNHMIKELARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVK
BRE1_USTMA      SARQDVEL-------TRRESDSRY----AEIQTLNEEVRTLKCKLHETQTKLTTLPEEVLLS--------
MYH8_HUMAN      NYRKETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLH
MYH13_CANFA     -----------------------------------ENTEAVSSKCASLEKTKQRLQGEVDDLMLDLERTS
KIF1_DICDI      ASDQKTLLLLLHDMEQGLTRASQTITQVTVLKKQLEDSKKSNEQLPTVEKQLSLMKDRLIQSENQLIDRE
KI15B_XENLA     VMDDIINEPIPPEMSEQAYEAIA-----EELRIVQEQVTALQVKLDEEESKNIKLEQQVNKLELCSTQIQ
CEP63_CHICK     --------------------------------------------------------------EAELQELM
WIT1_ARATH      ----------------------------------------------------------------------
WDR87_HUMAN     XXXXXXXXXXXXXVQVEDSLAKKQEKLAQEMKLALEKAMVQGKKLDIAKEEKALNLEMKRLAEEKMRLVE
SMC2_YEAST      RTMSKKETKLQENRTLLTEEIEPKLEKLNEKRMFLEFQSTVSYEYYNIKHKHTSIRETLENGETRMKMLN
MYSS_RABIT      D--------AVRGQDDHKEQLAMVERRANLMQAEIEELRAS---LEQTERSRRVADQDLLDASERVQLLH
KIF4_DICDI      -TNDKFEL----------------TKQLSDLKVEFDKSKQLSTRSSESNDTIKELQESI-ISKDKERQLT
K1C18_DANRE     --------------------------------------------------------EKVRILEQANSKLE
DESP_HUMAN      TIHQLTKEEDTSGYRAQIDNLTRENRSLS------EEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVS
CE152_HUMAN     AA--KLGIHPSDSEGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLL
BICD2_MOUSE     IQRGRLRDDIKE----YKFREARLLQDYSEL-----------------EEENISLQKQVSV----LRQNQ
YA046_MOUSE     -------------------------------------------KLRDEKESNGIMRKKFSSLQKEIEERT
Y658_HAEIN      SHDRHLLRNTVEEFYVHDKKVEEFKGDLEDYQKWLEQNSTSENKVSEKVGDNENSVQNRKEQKRREAELR
USO1_HUMAN      ----------------QNEQLTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQM---------
POF1B_MOUSE     -------------------------------------------------QMRGMSDKSLRLVLSTFSNIR
MYH2_HUMAN      RKIAEKDEEI----DQLKRNHIRIVESMQSTLDAEIRSRNDAIRLK--KKMEGDLNEME-------IQLN
IMH1_YEAST      ----------------------------------------------------------------------
CD158_MOUSE     -------------------------------RIFPVEDQLETLKSESQNKIELLLQQHQDRIEQLISEHE
CCD41_HUMAN     SANLRAE-RLEKELQSSSEQNTFLINKLHKAE---REINTLSSKVKELKHSN-----KLEITD-----IK
C102A_XENLA     TKNKDSDLDNSECWEIQNGGPSRSPRPRNWEDVSPSEDDTTKITALKLR-----LDESQKV----LLKER
SLMAP_RABIT     SLQSSFQLRCQQCEDQQKEEATRLQGELEKLR---KEWNVLETECHSLKKENVLLSSELQRQEKELHNSQ
ODFP2_XENLA     KSIESTKAHLQGQLRTREAENNRLSVQIRNLERNEAHQKEEIVKLME--QLTELKQKVDSEKEALKKSVR
MYSP_DIRIM      ALRKSLE------------------EQVKQLQVQIQEAEAAA--LLGGKRVIAKLETRIRDLETALDE--
MYH1_HORSE      QEDLKEQLAMVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
M12_STRPY       LNNLKAELKVTEQKQILDASRKGTARDLEAVRKSKKQQVEAALK---------QLEEQNKISEASRKGLR
IKIP_RAT        MLTQKL------------QNLNEKFQNITDLRTLVEMSDNTAVFKSEAKSTHSEVTLKINSAEQ---EIK
FKB15_HUMAN     QERSQAEEEIDEIRKSYQEELDKLRQLLKKTRVSTDQAAAEQLSLVQAEQTQWEAKCEHLLASAKDEHLQ
F184A_HUMAN     EQHNKDKLNL-------EEDKNQLQQELENLKEVLED------KLNTANQEIGHLQDMVRKSEQGLGSAE
ATG11_NEUCR     ------------------------------------------------------LESKLKTAESRVRRL-
Y328_MYCGE      --------------------------------------NVAQDKLATLEEVNLALNEKINDLENLLAKLQ
OV71_ONCVO      ----------------------KLIDELEEYKKRYDEALKAH--QADREVIDDLLVK--------LSNLE
MYH2_PIG        RKIAEKDEEI----DQLKRNHVRVVESMQSMLDAEIRSRNDAIRLK--KKMEGDLNEME-------IQLN
MYH2_CANFA      RKIAEKDEEI----DQLKRNHIRVVESMQTMLDAEIRSRNDAIRLK--KKMEGDLNEME-------IQLN
MFP1_TOBAC      EFKSISEKKVASDAKLLGEQEKRLHQLEEQLGTASDEVRKNNVLIADLTQEKENLRRMLDAELENISKLK
KINH_SYNRA      -------------------------------------------------------EEFIKRENELMDQIS
GCOM1_HUMAN     ------------------------------------ENSNIKDQIRNLQQTYEASMDKLREKQRQLEVAQ
CCD69_XENTR     VEARTLELQAQAQKDRDADIAKLLLEQAATIKVEMEE------KLAELQKSNE--QEKASLTETHQQLID
CCD41_RAT       SAKLQAE-RLEKELQSSNEQNTCLISKLHKAD---REISTLTSQVKELKHANKLEITDVKLEAA------
BRE1_CAEEL      AFRSAKEAR-AMLMSEEHQKTLKEIQCQSDIHSFYKVSHDSEVLRCEFETVKEEYNKTVKQSEATLNTLR
SBCC_STAS1      ----------------QNYKSTLAIEKNS---VTYLKNNLAEIETEINETDMKINEEMQRIGFTSIEQVE
MYH8_RAT        --------------------------------------------LEQTERSRKIAEQELLDASERVQLLH
ERC2_MOUSE      ----------------------------------------------------------------TLEEME
ERC2_HUMAN      ----------------------------------------------------------------TLEEME
ATG11_CANAL     EINEDYE---------------------------------------------------------------
SMC1_SCHPO      LENQLTSLSAAEKEFLKDMQEK---EQLKGLRLLPEDKEEYEGLRSEADKLNSNLLFKLQTLNRNIKVTS
RB6I2_RAT       TSDSKQHIEVLKESLTAKEQRAAILQEVDALRLRLEEKETMLNK--KTKQIQDMAEEKGTQAG-------
ODFP2_CHICK     VQLAEKDSYVAEALSTLESWRSRYNKVVKDKSDLELEMVTVNSRIADLLEQQATLEDKMREDRDALTSFR
MYSP_SARSC      ----------------------------------------------------------------------
MYSP_MYTGA      TRNQ---------LSVSERKRITIQQELEDARSLLEHAERATVRLTEVQQVTALTNDKRRMADIAAMQSD
HOOK1_DANRE     TVSLEEELRKANAARAQLETYKRQVQELH--KKLSDESRRADNLVFEMKK----LQEKYDALVKERERIS
CYTSA_DANRE     EQDNAEAQNVIAALKERNHHMERLLQERASMAAVLEECKAANNDQAELSRCRVLLQERQKVAEL----YS
CP250_MOUSE     -------------------------------------------------------QGELKVAQGKALQEN
CP135_DANRE     LLQEQMEQSLS---DVQH----RLSVKTNELQAAHQQIDKLEEKIADLSRHGSSQKDEVVILQNTIASLD
CI093_HUMAN     LEIIKNEFEVESAYEREKHNAQESFAKLNLLKEYFSKNKKLNEDIEEQKKVIIDLSKRLQYNEKSCSELQ
CD158_HUMAN     XXXXXXXXXXXXXRELEARVSDLELEKVKLVNAGSERLRAVK----DIKQERDQLLNEVKTSRSELNNLS
YA046_HUMAN     ----------------------------------------------------------------------
SMC4_YEAST      SYTEVTKLLKNEGIDLDHKRFLILVENIAQMKPKAEKESDDGL-LEYLEDIIGTANYKPLIEER-MGQIE
SBCC_LACLA      EFIADYSQIFPDSFDEVSIDES-LLNLTKSLELEEVKNDETKVKLADLESKKLELQEKVKDFEYSNQEFN
RAD50_HUMAN     ----------------------------------------------------------------------
POF1B_PONAB     -------------------------------------------------QMRGMSDKSLRLVLSTFSNIR
ODF2L_XENLA     --------------DLLNRQKTRLNELSSHLSMAHSETFLSSLKSSMHWPVEELTCDKVKLKDTDVAANS
MYO3_SCHPO      ELNEK-------------------LMRLDDELLLKQRSYDT--KVQELREENASLKDQCRTYESQLASLV
MYH6_MESAU      --------------------------------------------------------QRLQDAEEAVEAVN
MYH1_MOUSE      QEDLKEQLAMVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
IFT74_MOUSE     -----------------------------------KESLETEIAHSQVKQEAVLLYEKLYELESHRDQMI
IFA1_CAEEL      ----------------------------------------------------------------------
CCD68_HUMAN     TQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEM---DPSCCSLDL---------LMKKIKGKDLQLLEMN
BRE1_ASPFU      DDYAHTDLQLRSQYDINHLEATNI--QLREEAAKLRSERTAYRNQVDEETQNVIAEKEAQLAETDLARIN
ALM1_SCHPO      SDNMXXXXRLTNKFSSFCEQVKQRIPVVKQQRSEIVRNNIYMNFLSESLETSNNNLTKVQ-AELLSTKMR
VIME_ONCMY      RTNEKAEMQ-----HLNDRFASYI-----DKVRFLEQQN--KILLAELEQLKGLYEDEMRDLRRQVDQLT
TXND2_RAT       ----------------------------------------------------------------------
POF1B_HUMAN     -------------------------------------------------QMRGMSDKSLRLVLSTFSNIR
OPTN_XENLA      -----------------------------------KELQETNDKLNEAKQFKNSLQEKCILLDKRLQ---
MYS_PODCA       ----------------------------------------------------------------------
MYH2_HORSE      QEDLKEQLAMVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
MYH1_HUMAN      QEDLKEQLAMVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
MYH1_CANFA      QEDLKEQLAMVE------RRANLLQAEIEELRATLEQ----------TERSRKIAEQELLDASERVQLLH
KI21A_HUMAN     --------------------------------------------------------------QADLANIT
GRIP_ARATH      EVNETAE-RASSQHSSMQQELERTRQQANEMDAERQQLRSANNKLRDTEELRGSLQPKENKIETLQQSLL
EEA1_MOUSE      -KNSKSE------FEKENQKGKAAVLDLEQLQVQAESAXXXXXXXXXXXXXXXXTSQQLKIAQNTXXXXX
BRE1_CANGA      SNEEERELHQASNTDLTNESFLSKFQELAKEKDTFQEKISSDFELESLKAQNLALEKDLVRVRTTRDELI
Y4862_ARATH     AQNQNLRKRVEASLLEQVGVGEAIKQEKNELKVISHARSSDSEKMRDKDEMLESLQREVELLEQDSLRRE
TPM_LEPSA       NAMDKADALEAQARDA-NRKADKILEEVQDLK---KKPSQVETDFTTTKENLATANKNLEDKEKTLTNTE
SMC4_ARATH      -------------------------------------------------------------------ELN
ROCK2_HUMAN     ----RTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNQSALESERRDRTHGSLEEDLKNGKILLAKVE
OPTN_CHICK      QTNQEEESSEAIGSEVESLK--------KQICALFKELQEAHEKLKEAELIQKKLQEKCQ----TLEKVN
HOOK2_XENLA     TESLRAEKWLKEKFEALQKERERLIAERDSLRETNDENLAAEIVPAELRETVIRLQQENKMLCAQEASYH
FTM_HUMAN       QENRXXXXXXXXXXXXXXXXXXRIKLYNQENDINADELSEALLLIAQKEQKNGDLSFLVK----------
CAGE1_HUMAN     HTNRKQEVR------IQELQCSNL----------YLEKRVKELQMKITKQ-------QVFIDVINKLKEN
SMC4_DICDI      TKHLKTKV----------KKNNSVIEEETKKQAEFERST-----IIHKQDIVRFEKEYVELPK----ELI
SBCC_STAAW      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
SBCC_STAAT      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
SBCC_STAAE      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
SBCC_STAAC      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
SBCC_STAA3      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
PIBF1_HUMAN     HQKQLLTLRLDNQLAFQQKDASKYQELMK------QEMETILLRQKQLEETNLQLREKAGDVRRNLRDFE
KLPA_EMENI      SQKSLDAL------KAQHE------SELKELRRQFER-ELEDEKCARVRELN-QLHSKTAL-DAQLSQIE
GOGC3_ARATH     ETQRER--------DKARQELKRLKQHLLXXXXXXXXXXXXXXRLIEERQTNEYQRSQISHLEKSLKQ--
GOGA5_CAEEL     ----------------------------------------------------------------------
CK5P2_PANTR     SKEKXVE--------ELNSEIEKLXAAFAKAREALQKAQTQEFQGSEDYET--ALSGKEALSAALRSQNS
CK5P2_HUMAN     SKEKKVE--------ELNSEIEKLSAAFAKAREALQKAQTQEFQGSEDYET--ALSGKEALSAALRSQNS
ATG23_DEBHA     SKTQEIKLTKIDNLTEENKNSGRELQQYKD------DVEELTNKLNNYNNARSDLDDKINRLQEGLNKSN
ARK2_ORYSJ      ----------------------------------------------------------------------
SCLT1_HUMAN     --------------ELENERYEAIVRARNSMQLLEEANLQKSQALLEEKQK----EEDIEKMKETVSRFV
ROCK1_RABIT     QSQQKLE-HLTENKERMEDEVKNLLEQESNKRLLLQNELKTQAFEADNKQEINTLLEAKRLLEFELAQLT
ROCK1_PANTR     QSQQKLE-HLTGNKERMEDEVKNLLEQESNKRLLLQNELKTQAFEADNKQEINTLLEAKRLLEFELAQLT
ROCK1_HUMAN     QSQQKLE-HLTGNKERMEDEVKNLLEQESNKRLLLQNELKTQAFEADNKQEINTLLEAKRLLEFELAQLT
RIPL1_XENTR     --------------DVWRGEAQDLLNQIAQL----QEENKQLVSNLSQKDIN-LTEEEFQKHEGMSERER
MYH7_MESAU      --------------------------------------------------------QRLQDAEEAVEAVN
MYH2_BOVIN      --------------------------------------------------------------EEHVEAVN
LIN5_CAEEL      ------------------------------------------------------LEQMLGDLEDDKTKLS
KIF4A_HUMAN     RNFQKQKTEEAAAANKRLKDALQKQREVADKRKETQEGTAARVKLEDRKQDVAQLKEKKKLRRRTFSLTE
KIF15_RAT       -----------------SEQALEAISE--ELRTVQEQLSVLQVKLDEEEHKNLKLQQNVDRLEHHSTQ--
K1C1_CARAU      ----------------------------------------------------------------------
GEK_DROME       A------------ITLWERQMAEIIQWVSD-----EKDARGYLQALATKMTEEL--EYLKHV-GTFNNNG
ERC2_RAT        ----------------------------------------------------------------TLEEME
DYHC_NEUCR      FNNEKLRVKMRNEFLANPEFTFEKVNRASKACGPLVQWVEAQVNYAEILDRVGPLREEVMLLEEQALQTK
BPA1_MOUSE      ARNRQLE-----GISVVAQEFHGTLEPLNEWLTAVEKKGTQAPKLEEQISQHKALQEDILLRKQSVDQAL
NFL_XENTR       ----------------------------------------------------------------------
NDC80_MACFA     ----------------------------------------------------------------------
NDC80_HUMAN     ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
LMNA_XENLA      -------------------------------------SPTRITRLQEKEDLQG-LNDRLAVYIDKVRSLE
LIPA2_MOUSE     MEERITTLEKRY---LSAQRESTSIHDMNDK--LENELANKEAILRQMEEKNRQLQERLELAEQKLQQTM
HOOK_DROAN      NESSK---NVKLEFDNKNLESKNLLKERDNLREVVDELKCGQLSSSSALAGNTVSTELQPLATVKLQRLE
FLIP1_HUMAN     EEEEKLKAITSKSKEDRQKLLKLEVDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLTQRIEELE
CYTSA_MOUSE     EQDNKEAQEMIGALKERSHHMERIIESKAALAATLEEATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
CUX1_MOUSE      QREAETLREQLSSANHSLQLASQ-IQKAPDVAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTQLN
CP250_HUMAN     CQQE------------------------------------------------------------------
CEP63_PONAB     SEIQ----HLSSKLERANDEIERLTMRVNDLXXXALQEEKRELKAALQSQENLILQEKVK---ATDTQHA
CE63A_XENLA     ----------------------------------------------------------------------
BRE1_YEAST      --------------DLTHKKYSEIINHESVISKLTVEKTKADQKYFAAMRSKDSILIEIKTLSKSLSKSN
ATK3_ARATH      EYNSSLQLYLQGDLDEAHETIKRIIENIGNLKGQFEQLAASKASQEDIMKQKGELVNEIASLKVELQQVK
AGL19_ARATH     --------------------------------------NATSRQVTFSKRRNGLLKKAFELAEVALVIFS
YHLA_SCHPO      ---QKSSRDVAANL-------SDVKAKVSEIRKAYDEELAKAKQISLDIETNKAQTEQVNILEATLNALQ
Y474_MYCPN      ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TPM_LEPDS       KSEEEVR-----GLQKKIQQIENELDQV-------QESLT---------QANTKLEEKEKTAEGDVAALN
TPM1_BOMMO      NAMDKADTCEQQARDA-NLRAEKVNEEVRELKKLAQVEEDLILNKNKLEQANKDLEEKEKQLTATEAEVA
TAXB1_XENTR     -----------------------------------EELGKLQICLADKEKMNKELLQNSSNKE-------
SYCP1_MOUSE     ----------------------------------------------------------------------
SBCC_STAAN      ------------------------------------------IESFDDDKIKGLLELATQQIDKLIENIP
SBCC_STAAM      ------------------------------------------IESFDDDKIKGLLELATQQIDKLIENIP
SBCC_STAA9      ------------------------------------------IESFDDDKIKGLLELATQQIDKLIENIP
SBCC_STAA2      ------------------------------------------IESFDDDKIKGLLELATQQIDKLIENIP
SBCC_STAA1      ------------------------------------------IESFDDDKIKGLLELATQQIDKLIENIP
RUFY3_RAT       A-------------------LVSLRQQLDDLRALKHELASSDLGVKQKSELNSRLEEKTNQMAATIKQLE
RUFY3_HUMAN     A-------------------LVSLRQQLDDLRALKHELASSDLGVKQKSELNSRLEEKTNQMAATIKQLE
RAD50_METAC     -----------------------------------KEESSAREKVNAVSKDLALLLKEGETGSQALCELE
RABE1_HUMAN     -----------------NDQLEKTMKDKQELEDFIKQSSEISALVLRAQASEILLEELQQGLSQAKRDVQ
MYSP_BRUMA      ----------------------------------------------------------------------
MYO5A_MOUSE     ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH4_RAT        --------------------------------------------------------QRLQDAEEHVEAVN
MYH4_MOUSE      --------------------------------------------------------QRLQDAEEHVEAVN
MYH11_MOUSE     DQNSKL-----------SKERKLLEERVSDLTTNLAEEEEKAKNLTKLKSKH---ESMISELEVRLKKEE
MRCKA_HUMAN     IMILKDKLXXXXXXXLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEII
LAML3_XENLA     S-GRRVEFESKLAEALQELRRDH-EQQILEYKEHLEKNFSAKLENAQLAAAKNSDYASATREEIMATKLR
KLP2_SCHPO      ----------------------------------------------------------------------
KIF4B_HUMAN     DKRKETQSHGKEGIAVSTEEAKRHLNDLLEDRKILAQDV---VQLKEKKESRENPPPKLRKCTFSLSEVH
IFA3_CAEEL      ------------------KEIGKIKDQLDELRKKFEEAQ------------KGRAEDRLKIDEVTLSNLE
CNPD1_PEDPA     ----------------------------------------------------------------------
CCD62_HUMAN     ------------------------------------------------------LEARNETLSNTLVELS
CCD21_HUMAN     ------------------------------------------------QKTEALSREKIDL-EKKLSASE
ATG11_PICST     ---------------------------------------------------------------------S
TAXB1_PONAB     KDEKELYKVHLKNTEIENTKLMSEVQTLKNL-----DGNKESV-ITHFKEEIGRLQEKENLQRTFLLTTS
SYCP1_HUMAN     -----------------------------------QETSDMTLELKNQQED---INNNKKQEERMLKQI-
SPD5_CAEEL      SNSDIVEKLQNEVSELKNELE---MARTRDMRSPLNGSSG---RLSDVQINTNRMFEDLEVSEATLQKAK
SBCC_STAAS      ------------------------------------------IESFDDDNIKGLLGVATQQIDKLIENIP
SBCC_STAA8      ------------------------------------------IESFDDDNIKGLLEVATQQIDKLIENIP
RIPL1_HUMAN     ----------------------------------------------------------------------
RABE1_RAT       -QVKKLQLMLRQAND-QLEKTMKEKQELEDLRQSAEDSSHQISALVLRAQASEVLLEELQQSFSQAKRVQ
RABE1_MOUSE     -----------------NDQLEKTMKEKQELEDFLKQSAEISALVLRAQASEVLLEELQQSFSQAKRDVQ
QN1_COTCO       GYQQENERLYKQMKDLQIQNKKNEEQMYKENQCLMSELIALREKVERINIQSQIVRESEPARNQSFTELI
NDC80_CRYNE     LGAEELEEVKAVGV----RMRSTIWQALQTCRETFRQEANGTIALEDQKEEVGNLEVRLKIAEDAQSQIA
MYSP_SCHMA      TTNDKRRLEGDIGVMQADMDDAINAKQASEDRAI--RLNNEVLRLADELRQE---QGNYKHAEALRKQLE
KRT34_HUMAN     ------------------------------------------------------LQQKILCAKAENARVN
ION3_CARAU      MDNSRNLDMDAIVAEVRAQYEDIANRSRAEAEMWYK-SKYEEMQTSATKYGDDLRSTKTEIAD-------
IFEA_HELAS      -------------------------------------------ELAQARKVIDELSSTKGVSEAKVAGLQ
GOGA4_HUMAN     QLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERLEKALSTAQKTRRKLK
GOGA1_HUMAN     QLEKEKNILTAQLQEMKNQSMN-LFQRRDEMDELFQQQELSKIKLLKKEESLGKMEQELEARTRELSRTQ
EDE1_YEAST      SIQIKLN-NLRSTHDQNVKQTEQLEAQVLQVN---KENETLAQQLAVSEANYHAAESKLNELTTDLQESQ
DMD_PIG         EMNVLTEWLAATDTELTKRSAVEGMPSNLDSEVVWGKATQKEI-----EKQKFHLKSISEIGEALKMVLG
CYTSA_CHICK     SSGNASEVSVACLTEEENQHSTATLQELADLQQITQELNSENERLGEEKVIESLCQQSDKL-EHFSRQIE
CEP63_MOUSE     -----------------------------------------SLQSQETFILEAKMQEKL---QTTLKAVG
ATK1_ARATH      ------------------EQMTDIIKRLKVCVKWFQQAD----------ETHVQEKENLKVSESSEQKYN
AN30B_HUMAN     QTNKMPTSELGRKEDTKSTSDSEIIS-VSDTQNY--ECLPEATYQKEIKTTNGKIEESPEFEPATEMQNS
TEKT4_RAT       ----------------------------------FEES-------ASTPETWGKFTQDVRAERERLASVN
SMC6_YEAST      -QNKKVELNIAKGNDTFDRNMDRLLRTIEQRKNEFETGSLVTIRKGFEKWTRSIQRAISSSLNAFVVSNP
SMC3_YEAST      IKNA-TDLQQAK------LRESEISQKLTNVNV----------KIKDVQQQ----------IESNEEQRN
RUFY2_PONAB     -------------------------------------------------------------------QLR
RUFY2_HUMAN     -------------------------------------------------------------------QLR
PMFBP_MOUSE     ---------------------------------------------------NSLREKEAELEKLQCTTKE
CUX1_HUMAN      ------------------------------------------------------LGQQLQLKVQRLHDIE
CK5P2_MACFA     SKEKKVE---------------ELNSEIEKLSAAFAKAREA-LQKAQTQEFQGSENYEAALSEALLTELS
YNP9_CAEEL      SELTESEKAHTTAIDELQSSSSKLIQRLDELRLMRSSRDTAEQKIKDIE----IAKEKVDLLQNERQRSE
TPM1_CIOIN      EELQGLQKRLKATEDELDTSQEKL-------RTAIENLENAEKKAADAEQEVASLNRRITLVEEELAQER
TAXB1_MOUSE     ----------------------------------------------------------------------
SDCG8_MOUSE     ---------------------------------------------AEAQKRETSAYEQVKHAVQMTEEAN
ROCK2_MOUSE     ------------------------------------------------EKTAKELEEEIKSVESTLRQLE
MYSP_ANISI      RERQRLQIELTATID-QLQKDKHVAEKMAQK--FEQQTIELSNKVEDNKHVNDLAQQRQRL-QAENSDLL
MYO2_SACBA      ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MRCKB_HUMAN     REDSTQRLR---GLEKQHRVVRQEKEELHKQLVEASERLKSQAKLKDAHQQR-------KLALQEFSELN
LVA_DROME       -------------------------------------------------------------ALAEYEQLN
KIF4_MOUSE      RNFQKTEEAAAANKRLKDQKQKEVAEKRKETQSRGMESTAARMKMVSTEEANGLLEER-KILAQDVAQLK
K2C5_BOVIN      AELSQMQTHVSDTLSMDNNRSLDLDSIIAEVKAQYEDIANRSTKYEELQQTAGRHGDDLRNTKHEISEMN
HOOK3_XENLA     -QAQEGQLTSAGLMPLGNQEAAEIVTPEIKEKLIRLQHENKMLKINQEGSDN----EKISLLQSLLDDAN
CL190_DROME     -----------------------------------ELKSTQSNLEAKSKQANGSLEEEAKKSGHLLEQIT
CC146_HUMAN     AIVDEKENVIK---EVEGKRALLEIK---------EREHNQLVKLLELAREN----EATSLTERGILDLN
TPM_MIMNO       ----------------------------------------------------------------------
TPM_DERPT       KSEEEVRALQKKIQQIENE-LDQVQEQLSAANTKLEEKEKAQTAEGDVAALNRRIQERLKIATAKLEEAS
SMC2_MOUSE      ----------------------------------------------------------------------
SEC2_SCHPO      ----------------------------------------------------------------------
SBCC_STAAR      ------------------------------------------IESFDDDKIKGLLEVATQQIDKVIENIP
RUFY3_PONAB     A-------------------LVSLRQQLDDLRALKHELASSDLGVKQKSELNSRLEEKTNQMAATIKQLE
ROCK2_RAT       ------------------------------------------------EKTAKELEEEIKNVESTLRQLE
ROCK1_BOVIN     QSQQKLE-HLIENKDRMEDEVKNLTLQL-------EQESNKRLLLQNELKTQAFEADNLKGLEKQMKQ--
RIPL1_XENLA     --------------DVWRGEAQDLLNQISQLQ---EENKQLLTNLSH-KDVN-LTEEEFQKHEGMSERER
RIPL1_BOVIN     ----------------------------------------------------------------------
PCP1_SCHPO      SITKEKDRLIIKSYEVNVSELNGTIDELKDKEETYNEVMNAQYKDNDLRRFHESINKLQDREKELTSNLE
MYSP_CAEEL      -------------------------------------------------QKQAEYEEQIEIMLQKISQ--
MYH11_CHICK     ----------------------------------------------ETRTHEAQVQEMRQKHTQAVEELT
MRCKA_RAT       IMVLKDKLXXXXXXXLLTEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEII
GRDN_HUMAN      MDRKKIXXXXXXXXXXXXAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNE---LTSSRLLKLE
DCTN1_DROME     EQLQEFRTKIMGAQASLQKELLRAKQEAKDAIEAKEQHAQEMADLADNVE---MITLDKEMAEEKADTLQ
CTRO_MOUSE      ----------------------------------------------------------------------
CLIP2_MOUSE     NRLQAAE-------SLCSAQHSHVI-----------ESSDLSEETIRMKETVEGLQDKLNKRDKEVTALT
CASP_ARATH      EETAGKQSEVSLLMDEVERAQTRLLTLEREKGHLRSQLQTANEKKSDNIDSNSMLENSLTAKEKIISELN
ANR62_HUMAN     TQNQETENKYFKDIEIRNEEAKTITRYSKELNVLMDENTMLNSELQKEKQSMSRLETEMESYRCRLAAAL
U634B_HUMAN     MQDEIARLRLEKD-TIKNQNLEK--KYLKDFEIVKRKHEDLQKAL---KRNGETLAKTIACYSGQLAALT
U634A_HUMAN     MQDEIARLRLEKD-TIKNQNLEK--KYLKDFEIVKRKHEDLQKAL---KRNGETLAKTIACYSGQLAALT
TRAF3_HUMAN     --------------------------------------------------------QQIKAHEASSAVQH
RICKA_RICFE     EQNKKLQGLI----EIQNETKELEKEHNRSLPWFKRLVKTVSVKYIFVKSEEQLTNEAIKYNNKILKDID
MYOJ_DICDI      DQKQQFTRQTKEFSDLQSQQS--IDRQKSE------------ITIHSLERTNETLKSDFERVQQSLKQQE
MYO5A_RAT       ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYO2_SCHPO      HENLLLKVSDLENYKKKYEGLQLDLEGLKDVDTNFQELSKKHRDL--TFNHESLLRQSASYKE-KLSLAS
MYH7_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ALNKKDKLXXXXXXXLLTEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEII
MNS1_RAT        ----------------------------------------------------------------------
KRT34_MOUSE     ------------------------------------------------------LQQKILCAKSENARL-
KLP3_CAEEL      ----------------------------------------------------------------------
KINH_DROME      ----------------QSQYAEQLKEQVMEQEELIREYETLQSEMARIQQENESAKEEVKEVLQALEELA
KIF4_XENLA      SLETEMELRSAQIADLQQETISNIMEAKCALKYLITE--LVSSKVAGSKLESSVKQNRAHVADLQ-KNIF
K2C5_PANTR      AELSQMQTHVSDTSVVLSMDNNRNLDLIAEVKAQYEEIANRSTKYEELQQTAGRHGDDLRNTKHEISEMN
K2C5_HUMAN      AELSQMQTHVSDTSVVLSMDNNRNLDLIAEVKAQYEEIANRSTKYEELQQTAGRHGDDLRNTKHEISEMN
IFD1_CAEEL      -------------------------------------------KVSSAKQNIRKLEPEITTAIRTLASSL
FBF1_MOUSE      -------------------------------------------------------QRQMAMAEQERDQ--
ATI1_VARV       ----------------------------------------------------------------------
TRAF3_MOUSE     --------------------------------------------------------QQIKAHEASSAVQH
SAS6_DANRE      ----------------------------------------------------------------------
RUFY3_MOUSE     A-------------------LVSLRQQLDDLRALKHELASSDLGVKQKSELNSRLEEKTNQMAATIKQLE
RHG29_MOUSE     --------------------------------------------------------------KGNFSPIE
P115_MYCHR      ----------------------------------------------------------------------
MYH7_PIG        RMKKNMEQTIK---DLQHREAEQIAXXXXEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEE
MYH7_MOUSE      RMKKNMEQTIK---DLQHREAEQIAXXXXEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEE
MYH4_PIG        --------------------------------------------------------QRLQDAEEHVEAVN
K2C75_MOUSE     SLTDQINFYRM----IYEAELSQMQNQVSDTSVVLSMDNNRSLDLAEVKEAESWYQTKYEELQVTLRNTK
K1C27_CAPHI     -----------------------------------------------------------QIISATTSNAN
K1C27_BOVIN     -----------------------------------------------------------QIISATTSNAN
K1C14_HUMAN     ----------------------RLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDKILTATVDNAN
K1C13_ONCMY     AANAELELKIRQFMESKTSPSSR------DYSAFYAIIADLQDKIQAATRVNGGIY--LSIDNAKLAADD
EMIL3_HUMAN     AIQEQVSSQ-GSRLQAGHRQVLNLRGELEQLKAGVAKVASGLSRCQDTAQ---KLQHTVGHFDQRVAQV-
CYTSA_PANTR     EQDNKEAQEMIGALKERSHHMERIIESKAALAATLEEATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
CYTSA_HUMAN     EQDNKEAQEMIGALKERSHHMERIIESKAALAATLEEATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
CF174_MOUSE     ----------------------------------------------------------------------
CEP57_BOVIN     ----------------------------------------------------------------------
CCD45_MOUSE     ----------------------------------------------------------------------
CACO1_PONAB     ----------------------------------------------------------------------
AV71_ACAVI      ------------------------------------------------------------------AEIN
ACTNB_DICDI     LQEKSNQL-VDKSNQLSTMQASELMEKIGGLMNDLTDIPTQDIKEKDEIIANLKIESELKCFQDDFNALQ
TARA_HUMAN      ----------------------------------------------------------------------
SYA_SILST       ---------VKDGARVDSAKAGESVQIILNQTPFYGESGGGAARITDTKKVEGLF---LHIAEVTEGEIA
RAD50_THEAC     KYEQLDEEYRSMHLEDLRQKAMAVISNIGDIEALRKQKDEVSKKLKDAERTHEIESEFPDINSYTPSYIG
OPTN_DANRE      EEKKKRESCVSDDYDELQTRFATAEKALADKQQKIDEMKMELFQKEKDLETISVFQAQAEIYSSDFYAER
MYH1_BOVIN      --------------------------------------------------------QRLQDAEEHVEAVN
MUKB_VIBVY      -----------------------------------------------------------------LNQVQ
MUKB_VIBVU      -----------------------------------------------------------------LNQVQ
MIA3_BOVIN      ----------------------------------------------------------------------
LAMC1_DANRE     --------------DKVNQQR----QKLLDLQNLID-----SLDNTETTVSDKAFEDRLKEAEKTIMDLL
KRT36_MOUSE     ------------------------------------------------------LQQKILLTKSENARL-
K2C75_HUMAN     MDNNRN-------LDLDSIIAE-VKAQYEDIRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMN
K1C18_ONCMY     ------------------------------------------------EQANGKLELKIREAEKRGPDVN
K1C12_RABIT     ------------------------------------------------------------------ASIG
IFEB_HELPO      -------------------------------------------ELAQARKVIDELSSTKGVSEAKVAGLQ
IFD2_CAEEL      ----------------------------------------------------------------------
IFA4_CAEEL      STSVKVETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALE
ICR5_ARATH      SRDSSSSMEVEELKEAMNLSRQEITQLKS------------AVEAAETRYQEEYIQSTLQIRSA-YEQTE
HOOK_AEDAE      ----------------------KVVDSLKD-ELLQAETARDDLKMKSAMQEKEIADLQVKIDEAEIAQLK
GR1_ARATH       ------------------------------------------VELLQVKGLDELSEDGINMIVSEVKSLK
GOGC5_ARATH     XXXXRTNNEARSELENRLKEASMLVQALEELRQTLSKKEQQAVYRED--MFRGEIEDLQRRYQAS--ERR
GOGC4_ARATH     SESHKKEKEFAEMLEERTRSASAQARELEKER---EKSANLQILLQEERKQNETFKEELQSL-----RLD
DCTN1_CHICK     -------------------------------------------EMADTADAIEMATLDKEMAEERAESLQ
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_STRA5      ----------------------------------------------------------------------
CNPD_STRA3      ----------------------------------------------------------------------
CNPD_STRA1      ----------------------------------------------------------------------
CIP2A_HUMAN     AQQVESE---RAQSDIEH-----LFQHNRKLESVAEEHEILTKSYMELLQRNESTEKKNKDLQITCDSLN
CENPH_HUMAN     ------------------------------------------------------IEAKIEDLENEIEEVK
CACO1_HUMAN     ----------------------------------------------------------------------
BRE1_DEBHA      ETRENSLSKLMSVTDQENMVKKLTIEKTKADQKYF-----ASMRLKDSLSSNKILKTQINKSQELVSKLN
BIMC_EMENI      ---------------ISEEQRAKIESMESSLRHKVQELLTLTSKFNDLKKDN----------DDTLAALC
ATK2_ARATH      EELAKTQGEL--------QTANQRIQAVNDMYKLLQEYNSSNIKRGEKERTGGNLKGQFKALQDQLAASK
Z518A_HUMAN     ----------------------------------------------------------------------
U634C_HUMAN     MQDEIARLRLEKD-TIKNQNLEK--KYLKDFEIVKRKHEDLQKALKRNEET---LAETIACYSGQLAALT
SMC6_MOUSE      ------ELNLADS-EVDSQKRGK--QHYEDKQK--EHLDTLNKKRRELDMKEKELQEKMSQAR----QIC
SBCC_CLOAB      FENEEIVMCEAS-IKVEEKNIKKLNESINNLGEEFKEVSLESME----KKFNYL---KEKVNKFNLEKIQ
SAS6_DROME      ---------------INEQRSNELERNRRAISGFQAQLDKASLEKAELKSAQEQAEKRCQTLSEELSCCK
RBP2_PLAVB      TLNEHFNTKQVSNHEPTN----------------FDKSNKSSEEL-----TKAVTDSKTIISK-------
NFM_HUMAN       ------------------------------------------------------LEQQNKEIEAEIQALR
MYH6_RAT        ------------------------------------------LKSAETEKEMANMKEEFGRVKDALEKSE
MTS1A_DANRE     SNNRRFEAHLYAEHDEVMKQRRDLSQELVTLREELVSSGHSCERLEQEKEDDGVLQKVQEQHRLDLADLE
LMNA_CHICK      ----------------------------------------------------------------------
LIPB1_MOUSE     -QNQMTNGHLPGNGDVYQERLARLENDKESLSVLTDQVEAQGEKIRDLEFCLEEHREKLNATEEMLQQEL
KINH_HUMAN      HQKKRAAEMMASGIAVGNND----VKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTXXX
ICR1_ARATH      ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGA      -------------------------------------------------------------------RLS
FPP6_ARATH      EPGVPCDENRVSGYDSKLQEIEELRSEKEKMAVDIEQLQESEQLLADIRSQFDSAQRSNRLADTQLRCMT
CNPD_DESHY      ----------------------------------------------------------------------
CIP2A_MOUSE     ----------------------------------------------------------------------
CING_MOUSE      RLNKELEQI--------GDDSKLALQQLQAQMEDYKEKARKEV--ADAQRQAKDWASEAEKNSGGLSRLQ
CGNL1_HUMAN     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
BPAEA_HUMAN     T-FLETKTQALTEVDVPGKDVTELSQYMQETSEFLEHKKHLEVSLLKEISSHGLPSDKALVLEKT-----
ARK1_ORYSJ      DERSRSAS--------MNDHLNVLQQQLSDAQNYFQKNIACELE-KQLSRTTEEFASQISSLEERIADLI
YTTA_BACSU      ------------------------------------------------------------LAEPDTAAAN
TUFT1_BOVIN     ----------------------------------------------------------------------
TAXB1_HUMAN     KDEKELYKVHLKNTEIENTKLMSEVQTLKNL-----DGNKESV-ITHFKEEIGRLQEKENLQRTFLLTTS
TAF1_SCHPO      ----------------------------------------------------------------SIVPLN
SYNE2_HUMAN     IKSKALDELKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQVNQLKTSMQSVLQEWKIYDQLYDEVN
SPAG5_MOUSE     ----------------------------------------------------------------------
SLMAP_HUMAN     AQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDASLQEELKKVRAELER--
NFM_BOVIN       ------------------------------------------------------LEQQNKEIEAEIQALR
NDC80_MOUSE     ----------------------------------------------------------------------
MYOME_HUMAN     GTIQNLKETLKSR-ERETEELYQVIEGQNDTMAKLREMLHQS-QLGQLHSSEG-----TSPAQQQVALLD
MUKB_EDWI9      ----------------------------------------------------------------------
LZTL1_PONAB     ----------------------------------------------------------------------
LZTL1_HUMAN     ----------------------------------------------------------------------
LIPA4_RAT       AQREATSIH-----DLNDKLENELANKESLHRQCEEKARH--------------LQELLEVAEQKLQQTM
HOOK_DROPS      SESSK---NVKLEFDNKNLEGKNLALQRAKDSLLKERDNLRELKCGHLSSNSGLTGTAV--SRELQPPAT
HOOK_DROPE      SESSK---NVKLEFDNKNLEGKNLALQRAKDSLLKERDNLRELKCGHLSSNSGLTGTTV--SRELQPPAT
EPI1_CAEEL      -----------------------------------------------------------KRAEELAAYLN
EFC4B_MOUSE     ----------------EEAQFQMLMDRLGAQKVLEDESDVRQLWLQLRKDEPHLLSNFEDLLTTIFAQLQ
BRE1_CRYNE      --------------------------------------------------------------QARCLKLE
BRE1A_CHICK     MYDKLQEKVDVLSHKLNSGDISLMEEAVLELNSYLSHENGRLQELADTLQEKSKLQEKVETAESRV----
ATG11_EMENI     ----------------------------------------------------------------------
TLPA_BACSU      XXXXXXXXXXGEGFSVVAEEVRKLAVQSADSAKEIESLISEIVKEIHTSLN--VLQSVNKEVETGLVMTD
TFB1_SCHPO      SMREKHEFETASNIDIKNEIVLCHTVTIEFLHQFWNANTTFPDKKAMAPLQNALLNSKKRV-EAIASQAQ
SMC2_CHICK      SELQRVDAKVRSDLDHRKQNLNSEENRLKELIKIMQETSXXXXXXXXXXGLNGLQEESKKDAEALASAQQ
ROCK2_BOVIN     ------------------------------------------------------LEEEIKNVESTLRQLE
RF1_BORBZ       ----------------------------------------------------------------------
RF1_BORBU       ----------------------------------------------------------------------
OPTN_MOUSE      SMRSEIKMEQAKTEEEKSRLATKLLQEHNKALKTIEELTKQQAEKVD-KMLLQELSEKLELAEQALASKQ
NIN_MOUSE       ----------------------------------------------------------------------
NIN_HUMAN       -----------------------ILVKQKDVLSHGEKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQ
MYSP2_DROME     TLNQRTVEFYADS----SKQTSIEIEQLN-ARVIEAETRLKT----EVTRIKKKLQIQITELEMSLDVAN
MYO2_YEAST      --------------------------QIGNTKIFFKAGMLAYLKLRSNKMHNSMIQKKIRAKYYRKQYLQ
MYH7_CANFA      RMKKNMEQTIK---DLQHREAEQIAXXXXEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEE
MYH4_RABIT      --------------------------------------------------------QRLQDAEEHVEAVN
MYH4_HUMAN      ------------------------------------------------------LEESTLQHEATAAALR
LAMA2_MOUSE     AESHAAQLNDSSAVEAKNISATAAFRAYSNIKDYIDEAAQGATKLATSPQ--GLLKEDAK------GSLQ
K1C27_RAT       ---------------------------------------------------------RTQIISATAQNAN
K1C27_MOUSE     ---------------------------------------------------------RTQIISATAHNAN
IF3T_TORCA      -------------------------------------------------------------------QIS
HOOK_CULQU      SETMKTEFELQAKLSAVQREKENLLSERDALREACDELKCGQAAEDSESGRNTMSKEHSNDVRERIERLE
HIP1R_HUMAN     DAVRRIERHASSGVKLEVNE--RILNSCTDLMKAIRLLVTTSTSLAATQQTEGLISASKAVGWGATQLVE
DYTN_HUMAN      ----------------------------------------------------------------------
DCTN1_XENLA     QEHIKVQKQMETELDTLRQQKEKLQEEASHMEKTIDEAALGAEEMVETAERNLDLEEKVRELRETVSDLE
CNPD_LACLA      ----------------------------------------------------------------------
CE63B_XENLA     ----------------------------------------------------------------------
BPS2_ACIAM      ------------------------------------------------------LQTKIKQIEDEIARLE
TPM1_LIZAU      DDLVALQKKLKGTED----ELDKYSEALKDAQ---EKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQ
STIM1_HUMAN     ----------------------------------------------------------------------
STIM1_BOVIN     ----------------------------------------------------------------------
OMPA_THEMA      ------------------------------------------------------LEEKVNILDTLASQIG
MRCKB_RAT       VKNVKKEVHESESHQLALQKE---VLMLKDK---LEKSKRE--RHSEMEEAIGAMKDKYERERAMLFD--
LAMA1_HUMAN     NLQKKLTRMLASTQKV-NRATERIFKESQDLAVAIERLQMSITEIMEKTTLNQTLDEDFLLPNSTLQNMQ
KIF15_STRPU     ----------------------------SPLRSHSTNSLPPSGDILVTNSSPAMSEEGIIDEEMPEHVIE
K1M2_SHEEP      ------------------------------------------------------LQQKILCGKSENARL-
IM30_ARATH      -------------------------------------------------------EDPEKILEQTVIEMN
GAS8_HUMAN      KKRRKTELHEVE--ERKNGQIHTLMQR-------HEEAFT------DIKNYYN---------DITLNNLA
FAT1_SCHPO      AFNEKGSLDFQFGRGFVLSSKDRIEREVKNVVEKFDEVND-QIEL----MRSDVLLRKVRPGLDQTSQLN
EZRA_BACP2      ----------------------------------------------------------------------
EMIL3_MOUSE     TIQEQISSQ-GSRLQAGHRQVLNLRGELEQLKAGMANVARGLSRCRDTAQTVGHFDQRVAQVEGACERLG
DYH1A_CHLRE     -----------------------------------------------------------------LAMVN
DMD_CANFA       SMEKQSNLHKVL-MDLQNQQLKELNDWLXXXXXXXXXXXXXPLDIEDLKQQHKVLQEDLEQEQVRVNSLT
CROCC_HUMAN     ----------------------------------------------DPEAVRGALREFLQ----ELRSAQ
CNPD_LACLS      ----------------------------------------------------------------------
CNPD_LACLM      ----------------------------------------------------------------------
CLIP2_HUMAN     AQGKQEVESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEV----
CLC4F_RAT       -----------------------------------EEAQSEIQALRGSLQSSNDLGSRTQFLQHSMDNIS
BPA1_HUMAN      -QHLNSQIH--SFRDEKELERLQICQRKSDLKEQFEKSHEQLLQNIKAEKENN---DKIQRLNEELEKSN
ATI_CAMPS       --------------------------ELSRLRRDIKECDKYKEDLDKAKATISNYVSRISTLESEIAKYQ
ATI_CAMPM       --------------------------ELSRLRRDIKECDKYKEDLDKAKATISNYVSRISTLESEIAKYQ
ATI_CAMPC       --------------------------ELSRLRRDIKECDKYKEDLDKAKATISNYVSRISTLESEIAKYQ
CP250_MOUSE     ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VENAILKETESSLRNDVSALQKEVESLQNQLADACQSSEDRHELSKLRIQFKEISAVLDDATAKLKAKEE
CP135_MOUSE     YINHQLENEKYELQSKMLMMKETVESLENKSKLQAQSSHQKTEMTSLRIVSEQLQRSLDDCQHRLSIKRG
USO1_YEAST      DEITSTQQENESIKKKNDELEGEVKAMKSTSEE--QSNLKKSEIDALNLQIKELKKKVESETVKIKEKEK
NUF1_YEAST      -----LKQKQ----NESKRLKDELNELETKFSEGSQSSAKENELKMLKNKIAELEEEISTKNSQLIAKEG
SPO15_SCHPO     LERANFEQKESTLQEDVDSLEKNIQTLKEDL----RKSEEALRFSKL--EAKNLREVIDNLKGKHETLEA
CP135_HUMAN     CVNHQLESEKYELKSKVLIMKETIESLENKLKVQAQSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRG
PUMA_PARUN      EHNAILQSENRKSKTEIEALKHQIDTIMN-TKESCESEEQNEKIEKLRIEYREKTKEVDRLKEVEKTFEL
TSG10_MOUSE     SELGRQKAENNSLRLLYENTEKDLSDTQRHLA------KKKYELQLTQEKIMCLDEKIDNFTRQNIAQRE
HOOK_BRAFL      ARTNEL-ETENRLANQILELQGQLEDMQTEQEEVGSPAKDQDSVA-LRKKLEEHMEKLKDADSQLQKKKE
SGM1_YEAST      KEGAKLAETELRQSNQIKALRTKVKDLEYEVSESAQSVENYNELQSL---YHNIQGQLAEATNKLKKQKE
MY18A_HUMAN     RRDF---ESEKRLRKDLKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMED
MYSP_DERFA      ----LMEQAQKELRVKIAELQKEYEKLRDQRDQLARENK------KLTDDLAEAKSQLNDAHRRIHEQEI
CLIP1_MOUSE     KMNDELRLKERSVEENASFLQKSIGEVTLKAEQSQQQAARKHXXXXXXXQCQDLKAKYEKASSETKTKHE
GOGB1_HUMAN     ALSEERDQLLSQVKSMVTELRAQVKQLEMNLAEAERQSQTAHD-NLLTEQIHSLSIEAKSKDVKIEVLQN
EEA1_HUMAN      AKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQ------ELNKITTQ-------LDQVTAKLQDKQE
CC150_MOUSE     CRDAALKESQ-KLKGDLKALEKKVGNFQKQLAEAASHSKMQGALEKVQIELGRRDSEIAGLKKERSLNQQ
KTN1_CHICK      LE----MEKQVSITSQVKELQTLLKGKENQVKEALLEEKEKEIVQKLKGQQDTVAQLVQDLESRLRGEEE
ODFP2_RAT       LENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNKSQVMKTRLEADEVAAQLERCDKENKMLKD
GCC2_HUMAN      SQHSILKDEVTYMNNLKLKLEMDAQHIKDEFF---------HEREDLEFKINELLLAKEEQGCVIEKLKS
UACA_MOUSE      ECERKFKATEKGLKEQLSEQTHKCRQRDEEVKKGKQENERRADLAALQKELQDRNXXXXXXXXXXXXXSG
MY18A_MOUSE     ELESKLSESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKAMED
TSG10_HUMAN     SELGRQKAENNSLRLLYENTEKDLSDTQRHLA------KKKYELQLTQEKIMCLDEKIDNFTRQNIAQRE
NU211_SCHPO     SMNSRILELSNDLRVANSKLSECSDDVRRL---TLQNSFDLREHQTLVLQLQSITELKQDITLQRTVRNQ
KTN1_MOUSE      LEKAHQLSVTSELQNLLRGKEEQVNSMKAALEDRDRGLTGRGTCAQVTPQFEELESV-------LKEKDN
MFP1_SOLLC      VLIADLTREKENLRRMVDAELDNVNKLKQEIEVTQESLENRSEVSDITVQLEQ----LRDLSSKL---ER
RAI14_RAT       LSRTKAEESLSDMRSQYSKVLNELTQLK-QLVDAHKENEHLEVITTLRTMAKEMEEKTVTLQEHLASKEG
CCD18_MOUSE     LQNAELKSTLRQLQELRDVLQKAQLSLEEKYTTTAELRECKMEIEDKKQELIEMDQALKERNWELKQRAA
ANR26_HUMAN     TSKRELELAFQRARDECSRLQDKMNFDVSNLKDSQQLFKTESKLNSLEIEFHHTRDALREKTLGLERVQK
CE290_BOVIN     VEVSKLKEISDIAKRQVEILEKEVESLRTQLLDYQAQSDEKALIAKLHQHVVSLQASEAAALGKVESVAS
HMW2_MYCGE      FQDGITKQNAQHVEDKLVALNKEKDRLQSALIDINKLQQENELFAKLEHQQNEFEQKQSDSLLKL---ET
CE290_HUMAN     VEVSKLREISDIARRQVEILNKEVESLRMQLLDYQAQSDEKSLIAKLHLQLSEATALLESITSKLQKMEA
UACA_CANFA      ECERKFKATEKELKEQLSKLKKEIFTLQKDLKDKNVLIENSHDMERLNRKAEELNKQLKDLLQKYSEIKT
TG278_CAEEL     ESNTV--ESETKLASVTEEREKEIQSFQTQI-----SEKDNEVLTK--------AERINELETCLKEREV
ODFP2_MOUSE     LENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNKSQVMKTRLEADEVAAQLERCDKENKMLKD
RAI14_MOUSE     LSRAKSEEALSEMKSQYSKVLNELTQLK-QLVDAHKENEHLQVITTLRTTAKEMEEKISALTGHLANKEA
ODFP2_HUMAN     LENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNKSQVMKTRLEADEVAAQLERCDKENKILKD
MYSP_OPIFE      AEVENLQKQKGKAEKDKNSLIMEVGNVLGQLDGALKAKQSAEKLEGLDAQLNRLKGLTDDLQRQLNDLNA
CE290_DANRE     IEVSKLREVSDVAKMQVSALEKEVESLRRQVLDYQAESDEKALIAKLHQHIVALQLSETTAISRLEATNT
NDC80_YEAST     TDIANLQTQNDNLYEKYQEVMKISQKIKTEKWKALKSDSNKYEVNAMKQKSQEWPGKLEKMKSECELKEE
MYO1_YEAST      TENSDLRSKNENFKKEKAALNNQLKNKESELL------KMKEKIDNHKKELATFSKQRDDAVS-------
KI20B_MOUSE     LKECEAKHQDHIRTNDLSAFREEVTRLANNLHDTLQSKEEENEISKLKEELAANSILTQNLKADLQKKEE
GCC2_MOUSE      SQHSILKDEVTYMNNLKLKLEMDAQHIKDEFF---------HEREDLEFKINELLLAKEEVVEKLKYERE
ANT1_ONCVO      NRDSILERENNDWKEKSDALNMELDRLRDELLSVRRDAE------------KEINRYNTDLQT---AARN
CC110_MOUSE     --QSLIQKVEAH-EKQLKSLAEEKSALQSKLSKAEEENKDLRELKKIVSTYNVLGGMLEEKNSQLSLEKQ
TSG10_RAT       SELGRQKAENNSLRLLYENTEKDLSDTQRHLA------KKKYELQLTQEKIMCLDEKIDNFTRQNIAQRE
MYH15_HUMAN     GQVENLQQVKQKLEKDKSDLQLEVDDLLTRVEQMTRAKANAEKLCTLEERLHEATAKLDKVTQLANDLAA
CE290_MOUSE     XXSDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKALIAKLHLQISEATALLESVTSKLQKMEA
TPR_HUMAN       EANAELSEKSGMLQAEKKLLEEDVKKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
MYO3_CAEBR      IARSQLETQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLATLESKLTDITGQLEDMQERHEDLTR
MRP4_STRPY      AEIEALKQQDASKTEEIAKLQSEAATLENLLGSA------KRELT-------ELQAKLDTATAEKAKLES
CENPE_MOUSE     NENTLVTKENDSLKIMDEALREERDQLRKSLQQTARDLENQEKLRIAHMNLKEHQETIDRLMETMSEKTE
CCD18_HUMAN     KEDRCIKLVISELRIKLAIKEAEIQKLHNQLSQSLITCNDSQESSKLKLGGHQVESVKDQNQHTMKQYEK
CC150_HUMAN     LEEQVQSFTDTSLQND--HLRKMNKYLQTKYAQA------NSELSAKRVHLQQADAHLKEVKSILERSKE
MLP2_YEAST      QKNDSLEKTINDLQRTQTLSEKEIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQE
MYH13_HUMAN     TACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSELFKMRNAYEEVVDQLETLRRENKNLQE
CENPE_HUMAN     IEMLGLSKRLQESHDEMKSVAKEKDDLQ-RLQEVLQSESDQ-----LKENIKEI-------VAKHLETEE
Y147_TNAVC      TENASLNDELTSMKDDIDIMQRKFTQLQN---DYYSTSXXXXXXXXXXXXCNATNVEIKQELRTLKSELL
ICR2_ARATH      ANGDSLKEEINVARQEISQLKSAVEVTERRIQSTLQIRTAYEQVDEVKSGYAQREAELGEELKKTKAERD
CENPF_HUMAN     --NGLIQEVEDG-KQKLEKKDEEISRLKNQIQDQEQLVSKLSQVEGEHQLWKEQNLELRNLTVELEQKIQ
MYH8_CANFA      HANRLAAESLRNYRNTQGILK----DTQLHLDDALRGQEDKEQLAMVERRANLLQAEIEELRATLEQTER
MYH3_RAT        ENGKSIHELEKSRK------QMELEKADIQMXXXXXXXXXXXXXXKLRIQL-ELTQVKSEIDRKIAEKDE
RAD50_RAT       DKEALKQRQMDEMRDKKSGLGRMIE-LKTEILTKKQT-----ELRNVRNELQQ----LEGSSDRILELDQ
APSB_EMENI      QE---LEELDKAYSADVEQAEEDIQTLQQERDQAMQVAEERDAFQELRAEAQEELDALGD---ELDQKIE
ICR3_ARATH      VKQAELYNSEVQLRGNLMDTLFHVENFRNQLKD-CEISXXXXXXXXXXXXXXXXNA--KKAVEELKSDGE
GOGA5_MOUSE     -----------------------VQSLNQEMASLLQSKETQEELNKARVRVRELRAQVDDLTEAVAAKDS
CP110_HUMAN     RVLAAAEENSKMEQSNLEKLELNVRKLQQEL--------DQLNRDKLSLH-NDISAM----QQQLQEKRE
MYSP_BLOTA      LEQALAKRAAEQMHEEAVVRVNELTTINVNLASA---------KSKLETEFSALQNDYDEVHKELRISDE
MYO2_CAEEL      RD---LEESGLKFGEQLTVLKKKIQELSDQI-EQLQKQKGRIEKEKMQREFDESSAALDQ-EAKLRADQE
MYH3_MOUSE      ENGKSIHELEKSRK------QMELEKADIQMXXXXXXXXXXXXXXKLRIQL-ELTQVKSEIDRKIAEKDE
MEDB_GIALA      XXXXXXXXXTIRRRGNTSGVMAEIENIQRQIDDANSSASSEHELRMLRAEVE-----------TLRAQKS
DAPLE_XENLA     GENIVLKKSLDTLQN-VTIKLEVLESENKQLDE--ENLELRRAVEAMRFSCAKSTQIXXXXXXALGKKSE
CLIP1_CHICK     SEGKLLQAAEKQIQNKVSNLTKELQGKEQKLLDAVNQVKDSXXXXXXXXXXXFTSAVMQETINKLNQKEE
TSG10_MACFA     KLKNILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTL-KLE---------LITAEAEGNRLKE
MYSP_SCHJA      RELTIEVNTLTSQNNQLESENMRLKSLVNDLTDKNNALE--RENRQMNDQVKELKSSLRDANRRLTDLEA
MYO4_CAEEL      DQTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKHQIRSLQDEMQQ----QDEAIAKLNKEKK
GOGA5_XENLA     -----------------------VQSLNQEMASLIQSKETQEELNEARTRMRELRAQVDDLSEAMAAKDS
F184B_HUMAN     TQDPCLKLDETSPRG---------EEYQDKLAAEEGTSSDEEERTKVLL--KEGSDPQPPLGSLLKEKTS
CEP63_MACFA     VEAIRLREESLAEKKYTSQGQGDLDSVLSQL-NFTHTSEEQAEVTRLEGSLESVSATCKQLSQELMEKYE
MYH3_HUMAN      TELFKLKNAYEEALDQLETVKRENKNLEQEIADLTEQIAENHELEKSRKQIEELTQVKSEIDRKIAEKDE
EBH_STAES       NEDRILKEQNPSVADVNNALNKEVQQKLNEARALLQNKEDNSALVRAKEQLQQAQQTKDDYNSKQQAAQQ
EBH_STAEQ       NEDRILKEQNPSVADVNNALNKEVQQKLNEARALLQNKEDNSALVRAKEQLQQAQQTKDDYNSKQQAAQQ
CING_XENTR      KQKDHLKKTKNELEEQKRLLDKSMDKLTRELDN--MSNESRGSLQVLQSQLEEFREKSRREIGXXXXXXX
ZIP1_YEAST      NLNITTKENKISSQNEVKALVSENDTLKQRIQQLVEIKENEQQLQKLNVEVVQLKAHELELEEQNRHLKN
SOJO_XENLA      EELVSLKNKEEKNASMLKLLQMDMQKTQVELKKACELEEKLHIAEKDSKRTEEMETQLSGMQKELDGYTK
KI20B_HUMAN     ---------KEQLNN-----QKVEEAIQ-QYERACKDLNVKEKIIEMRMXXXXXXXXXXXXXXXXXAKLE
IFA2_CAEEL      AEINLLKRRIALLEEEVARLKKENFRLTS-------------ELQRVRIELDQETLLRIDNQNKVKTILE
CN145_MOUSE     NELKRQSKSQSQIKAEKIHLEEEITELKKS------QSQDKVKLLEMQESIKDLSAIRADLANKLXXXXX
CING_SORAR      DETQRLRQTLQASQADLDTARLDKELLAQRLQGLEQEAE-----KKRRSQ--------DDRTRQVKSLEE
RB6I2_HUMAN     AEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVQTEVDALRLRLEEKETMLNKKTKQIQDMAE
KIF15_HUMAN     -----MQELFSSERIDWTKQQEELLSQLNVLEKQLQETQTKNDFLKSEVH--DLRVVLHSADKELSSVKL
HMMR_MOUSE      RLDNLLREKEVELEKXXXXXXXXXXXXXEKYNDTAQSLRDTAQLESVQEKYNDTAQSLRDVTAQLESEQE
DMD_MOUSE       LEQSI--QSAQEIEKSLHLIQESLEFIDKQLAAYITDKVDAAQMPQ------EAQKIQSDLTSH-EISLE
CLIP1_HUMAN     -----LKATEEKLL-DLDALRKA-------------SSEGKSEMKKLRQQ--------------------
C144A_HUMAN     AENKILNSELENGKQNQERLEIEMESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRLHDKMKV---
MYH6_HUMAN      IQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENNLLQAELEELRAVVEQTERSRKLAEQ
CCD39_HUMAN     LVKEKIKFLESEIGNNTE-FEKRISVADRKLLK-CRTAYQDHETSRIQLELDSLKATVNRTSSDLEALRK
CASP_PONAB      -------ATATEQRELIARLEQDLSIIQSQRPDAEGAAE--HRLEKIPEPIKEATALFYGPTAPASGPEG
C144C_HUMAN     AENKMLNSELENGKENQERLEIEMESYRCRLAAAVHDCDQSQTARDLKLDFQRTRQEWVRLHDKMKV---
RIPL1_MOUSE     QVMKRLKEVVDKQRDELRAKDREVEALQQQQTRLMKINHDRHRVTVVEAQGKALIEQKVELEADLQTKEQ
MYO3_CAEEL      IARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLATLESKLSDITGQLEDMQERNEDLAR
MFP1_ARATH      TH-------ASNLEDEKEVLQRSLGEAKNASKEAKENVEDAHIL--------------------------
KIF15_MOUSE     -----MQELFSSERSDWTKQQQEHVTQLSDLEKQLQDAQTKNEFLKCEVH--DLRIVLNSADKELSLVKL
GOGA5_HUMAN     -----------------------VQSLNQEMASLLQSKETQEELNKARARVEKLRAQVDDLTEAVAAKDS
DAPLE_HUMAN     KENKALHQTVTEANGKLSQLEFEKRQLHRDLEQAKEKGXXXXXXXXXXXXXRKVTS-LETATEKVEALEH
CN145_HUMAN     LERALEKQSETELTGKNNQILKEKDELKTQLYAALQ-------------QIENLRKELNDVLTKRALQEE
CCD41_MOUSE     -------RAKSELERERNKIQSELDGLQSD-NEILKSTVEHHKVEKDRELIRKVQAAKEEGYQKLMVLQD
MYSN_DROME      EDLXXXXXXXXXXXXXXXDLSEELEALKNELLDSLDTTAAQQELRSKREQ--------ELATLK-KSLEE
MAD1_YARLI      VLEGELKEARSEQGCTVAAGTKRPRADDSVSSEVI--SEYTRKLQTLQQEFDEVS-----VEARLLAKTK
GOGA5_RAT       -----------------------VQSLNQEMASLLQSKETQEELNEARVRVRELRAQVDDLTEAVAAKDS
GOGA3_MOUSE     ADXXXXEEEDRQMKQLVQALQMEVNSLKEQMAAA------RIEAGHNRRHFKAATLELSEVKKELQAKEH
ROCK1_MOUSE     NKRLLLQKTQAFEADNLKGLEKQMKQEINTLLEAKRLLE--FELAQLTKQYRGNEGQMRELQDQLEA-EQ
FHAD1_HUMAN     SENAITSGMVSSLQKDILAKDEQVQQLKEEVSHLKSQNKDKHQLEALGSRCSVLKEELEDAHRELREAQE
CCD67_MACFA     GKKQCLEDSSS-----------EIPRLICDPDPNCEIGEDEFIIEKLKSAVSEIALSLQDENQKLKMYQR
CC64B_XENTR     SENALLLEKKKEMESQTKQLQEENDNVQNQL---------------------------------ISAKE-
CASP_HUMAN      -------ATATEQRELIARLEQDLSIIQSQRPDAEGAAE--HRLEKIPEPIKEATALFPAAPASGALPEG
WIT2_ARATH      EELNFLKDADDKKTKKVNSLEKQVRELEVQVQNSKVSSENQEQQNMLYSAIWDMETLIEDLKSKASKAES
SCLT1_RAT       MTNHHFLKTVTEQNMEIEKLRKQLRQAKLDLRVAVTKVEELTKVTELQEQMLKKEEDIMSAQGKEEASDR
HOOK1_CHICK     XXNFRLEAAKDDYRVHCEDLEKQLIELQHR----------NNELTSLA----EESRALKDENDILRAAAD
GOGA5_DANRE     ----------SSLNQEMASLIQRAKDMQEEVLGRARADKWNSDQSRVDRTVRELSSQVDDLTEALSAKDG
CGNL1_MOUSE     KEE---KEATCARR----ALEKELEQAQRELSQVSQEAEQKEQLRKLKNEMESERWHLDKTIQKLQKEMA
CEP63_HUMAN     VEAIRPREESLAEKKYTSQGQGDLDSVLSQL-NFTHTSEDQAEVTCLEGSLESVSATCKQLSQELMEKYE
YAF3_SCHPO      EKISSLEKDLEAATKTASTLSKELKTVENDSLKSVSNDDQNKEKSVNNEKFKEVSQALAEANEKLNARDE
RGP51_LYMST     DEIGSLRELIVTYESQAKDYRKKIDSLGNQL------GEFEGELQSLRLRV----GSLEDENAKLRELLE
MYSS_CYPCA      SLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSELFKMKNSYEEALDHLETLKRENKNLQQ
MYH3_CHICK      TQNTSLINTKKKLESDISQIQSEMEDXXXXITDAAMMAEELKKEQDTSAHLERMKKNLDQTVKDLQHRLD
MYH11_HUMAN     SKCSDGERARAELNDKVHKLQNEVESVTGMLNEAIKLAKDRQKLNKLRQLEEERNSLQDQLDEEMEAKER
MBO1_SCHPO      EDRNVLSNMLDNERREKEALLQELESLRVQLSETLQRSNEKQENDRLVKQVEELTVALN--SGKMNAVEA
LIPA_CAEEL      ----SLKKAES-----LPSVEAELQQRMEALTAAEQKSVSAEEIQRLDRNIQELSAELERAVQRERMNEE
IMH1_ASHGO      -ENGKLSER-------LEVLQEKYDSLQNL------KSNSGDQVSAIRKQCEELNSKLKEATKRVMSLED
SDCG8_HUMAN     TN--VHMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYE------QVKQVLQISEEANFEKTKALI
SBCC_BACSU      EENTLVQKTEAEENNIIQAYEAETESLTRMTEEARKSQHTLHEKARVALLTKELAQKLTDPSASVHETYE
MYSP_BOOMI      ----LLEQSQRELRQKVAEIQKEYEKMREQ-RDALQ-----RENKKLVDDLSEAKSQLADAIRRLHEYEL
MYH6_MOUSE      IQNRIASEAQKHLKNS----QAHLKDTQLQLDDAVHANDDLKENNLLQAELEELRAVVEQTERSRKLAEQ
GACN_DICDI      NE---FKETNKNQANDINSLKNDIKDVTEKQT---KTELERDELNKVKVKLEK---DIETTRIELKSTND
FIL1L_MOUSE     TMSEKLKQTEDKLQSTTSQLQAETEKLIEETKRALKSKTDAEE------KMYSVTKERDDLRNKLKAEEE
CING_DANRE      LEDTLLTALKGALKDEVASHDKEMEALREQFSQDMDAL--RHSMETVSQSQLEIEEERQKVNASILAMEE
CASP_SCHPO      THCATIQTLENEVK-EARKVKEESLTLANKFSDY---DEIKRELSVL----KQIEFSGEHATHENTSLES
CASP_MOUSE      FAPSEGAGTQDSTKPLEVLLLEKNRSLQSENATLRISNSD------LSGRCAELQIHLTEATAKAVEQKE
UACA_HUMAN      -ENEILKKELEAMRTFCESAKQDRLKLQNELA---------HKVAECKALALECERVKEDS-------DE
UACA_BOVIN      KRGRKLTEMEGQLKDLSAKLALSIPALSNELNEKAKKLIDEREYERSLNETRPLKRELENLKAKLAVKPE
TRIPB_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     -EKAVLKEKKGRLTEEL----KEQMKAKRKEAELRQVQSQAHGL-QMRLKYSQ-SDLEQTKTRHLALNLQ
RB6I2_MOUSE     SEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVQTEVDALRLRLEEKETMLNKKTKQIQDMAE
KIF27_HUMAN     LKTG-QEEGLKPKAEDLDACNLKRRKGSFGSIDHLQKLDEQEEVEKVLNQRQE----LEELEADLKKREA
HMW2_MYCPN      KK---LAERELAIKFK----EKELEAAQKQL------SLDNNNNAGLKLQLDKLSESLKTERLELEASKE
GRDN_MOUSE      DRKKIXXXXXXXXXXXXAQKQSMDESLHSELAEAPQKSLGH-----------EVNELTSSKLLKLEMENQ
CING_XENLA      YEELV--KINKRLESEKTDLERVRQVIENNLQESREENDDRRKILGLEAQLKETNTFCDDLQRAESRLKD
TPM_ECHMU       FEQSSGRLTETSTKLDDASKAAE-ESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAAR
TPM_ECHGR       FEQSSGRLTETSTKLDDASKAAE-ESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAAR
MIA3_MOUSE      ---------------------------------------------------KQISEKLENIKKENAELMQ
CCD46_MOUSE     TRRNILHKEKEHLVNDY---EQNVKLLKTKYDSDINLLRQEHALS----------------TSKTSGVIE
TEKT4_MOUSE     --DCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKTDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSH
RAI14_HUMAN     VSRAKAEDALSEMKSQYSKVLNELTQLK-QLVDAQKENEHLQVITTLRTAAKEMEEKISNLKEHLASKEV
RAD50_METMP     ELTGKINEY-SSLNDEISLIENKLKNLENDYKNCNYSSQTKNDESEFLTKKLELSKIIGDYDS--SKIEN
MYSP_ONCVO      -ETRRHKETQGALRKKIKEVQMQVDE-EHKMFVMAQDTADR-LLEKLNIQKRQ----LGEAESLTMANLQ
MLP1_YEAST      AEN--------------DQLRKRFDYLQNTI---LKQDSKTHETLNEYVSCKSKLSIVE--TELLNLKEE
LIPA1_HUMAN     RKAETLPEVEAELAQRVAALSKAEENIEERLRQEAQLEEKNQELQRARQREKEHNKRLSDTVDKLLSESN
KINH_RAT        QEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQT---LHNLRKLFVQVKKSAEVDSDDTGGSAAQKQ
IFT74_HUMAN     AEDKSIMEEREKLLKQIKDDNQEIASMERQLTDTKEKNQFIEEIRQLDMDLEEHQGEMNQKYKELKKREE
FIL1L_HUMAN     RQIDELEETNRSLRKAEEELQDIKEKISKGEYGNAGIMAEVEELRK---------RVLD-----MEGKDE
ANR26_MOUSE     SENTLLRQQLDDAANKAESKDKTIVNIQDQFQDV---------LTRFQAESQRHSLRLEDRNQELVS---
PU92_SCICO      TEN--LKETIEQLKKELAEAQKALEKCKKELADCCTITQLQEKLERCRGRERDLQCQLDECKKKLNICNN
MYH8_MOUSE      TQNTSLINTKKKLENDVSQLQSEVEEVKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLD
MYH1_PIG        HANRMAAEALRNYRNTQGILK----DTQIHLDDALRSQEDKEQLAMVERRANLLQAEIEELRATLEQTER
GOGA4_MOUSE     ---SISEQQELTVRRAEKALKDELSRLGALLDERDEHLRERQRVQDLEAHLQKSAGELQQALAKLDLLHS
CNTLN_HUMAN     QENAKLKEKLQESQGDYSAQVPHRPSLSSETLMVSQKSEIEYLQEKLKIANEKLSENISATSAEGKHKEP
CCD67_HUMAN     AQQKLLSEKCNQFQKQAQSYQTQLNGKKQCLEDSCEINEDEFIIEKLKSAVNEIALSLQDENQKLKMYQR
CCD46_HUMAN     ARRNTLHKEKDHLVNDYEQNMKLLQTKQEHALSASKASSMIEELNKFQMEKSHLKHIYEKKAHDLQSEQK
BRE1_USTMA      --SALYRELQTLLRNAQQDLQSSKEAMQALETEATALREDRAAFQ--QTVEAEAASRSEDLEKLIKAKEA
MYH8_HUMAN      TQNTSLINTKKKLENDVSQLQSEVEEVKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLD
MYH13_CANFA     TARAILDRKQRDLDKVLAEWKQKLDGSQAELEAAQKGSRSLSEIFKMQNAYEEVVDQLETLRRENKNLQE
KIF1_DICDI      CENTILSDXXXXXXXXXXXXDSKLSLLENNVAEYANGMAFSREFSQHHTDSGSISGKFNRRSKQISAEEQ
KI15B_XENLA     ---ELFNSERSNWNKEQQAFIAQIKSLEKQQQDN-KNQEDKSEVHDLRVVLRELSAVKGEYSLFREKQEK
CEP63_CHICK     KQDIMVAHKKAEWEGQTQALEACLGVREQELSSARAALEEKHEVGKLRQQLEDMEAAKQDLVREYEQQLK
WIT1_ARATH      ------RNTERELEMKLYSSEQDVVYMEEVTEDAFSRWLEADNAAEVKGTSKEMSGKLQILQFNLSGSFK
WDR87_HUMAN     GKETLSKETETSRQRKMTQVEQELFERKLSLEEKILLHEDRSEIAKGKLEFTRGQRIFVQGQRKLAKASR
SMC2_YEAST      EFVKKTSEEIDSLNEDVEELQKEKELHKEGTISKLENKENGNEISRLKTSLSIKVENLNDTTEKSKALES
MYSS_RABIT      TQNTSLINTKKKLETDISQIQGEMEDIXXXITDAAMMAEELKKLERMKKNMKDLQQRLDEAQLALKGGKK
KIF4_DICDI      SEQLVKLTDQINLKTEYNDLNSQCQQLTKTLQNVKSSNEQ---------QEQSIVSLESQTSAKIKSLEL
K1C18_DANRE     LKIREALEKRGPDVHDYSRFQPIVDELRKKIFDATTNN------ARLVLQIDNARLAADDFRVKYESEEA
DESP_HUMAN      QRK---QQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNEIERLKLIDKETNKCLEDENARLQRVQY
CE152_HUMAN     GSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEVETKTDTSEKPKNQLPESSTSDVVRDDILLLKNEIQ
BICD2_MOUSE     VEF-------EGLKHEIKRLEEETEYLNSQLEDA--------------IRLKEISEQLEEALETLKTERE
YA046_MOUSE     NDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKYDLKKKNQELEKFKFVLD---YKIKELKK
Y658_HAEIN      QQTAPLRKKITQLEEKMNKFSSELANIENQLADTLYNAENKEKLTALLAQQVDVKKALDDVETEWMTAQE
USO1_HUMAN      --NGIQPXXXXXXXXXXXXXKRNQELLQSQLTEKDSMIEN--------MKSSQTSGTNEQSSAIVSARDE
POF1B_MOUSE     EELGHLQNDLTSLENDKIRLEKDLAFKENQM------KEYEELLASVRANNRQQQQGLQDSSAKCQSLEE
MYH2_HUMAN      HANRMAAEALRNYRNTQGILK----DTQIHLDDALRSQEDKEQLAMVERRANLLQAEIEELRATLEQTER
IMH1_YEAST      -----IKESSSKQNEEVKTVKLELDDLRHKNATMIEAYEAKNELSKIELLSKKVEHLKNLCTEKEKEQTT
CD158_MOUSE     VEITGLTEKASSARSQANSVQSQLEIIQEQARN--QNSMYMRQLSDLESTVSQLRSELRESK---RMYED
CCD41_HUMAN     LETARAK---SELERERNKIQSELDGLQNEILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQD
C102A_XENLA     EDKMLLNKTIEKMEAEISQWKMKCEELNKSRQEAVKQLRERHELGRISEDLQDELGVRSSMDKKLAELRA
SLMAP_RABIT     KQSL-------ELTSDLSILQMTRKELENQMG----SLKEQH----LR-DSADLKILLSKAENQAKDVQK
ODFP2_XENLA     AQKQRAERSEETLE----MLNRQLVGNDSELAKALSSAETYNKLMKESSQHEEEVAVLSNRLKGLLGESE
MYSP_DIRIM      -ETRRHKETQGALRKKIKEVQMQVDE-EHKMFVMAQDTADR-LLEKLNIQKWQ----LGEAESLTMANLQ
MYH1_HORSE      TQNTSLINTKKKLETDISQLQGEMEDIXXXITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLD
M12_STRPY       RDLDTSREAKKQVEKDLANLTAELDKVEKQISDASRQGL-RRDLDASREAKKQVEKALEEANSKLAALEK
IKIP_RAT        LLTERLKDLESTLRNIRTVSRQEEEDL---LRVEAQLSSDTKAVEKLEEEQRTLLARDEDLTDKLSSYEP
FKB15_HUMAN     QYQEVCAQRD-AYQQKLVQLQEKCLALQAQITALTKQNEQHKELEKNKSQMSGVEAAASDPSEKVK----
F184A_HUMAN     GLIASLQDSQERLQNELDLTKDSLKETKDALLNVLEQERQQHE-ETIAAMKEEEKLKVDKMAHDLEIKWT
ATG11_NEUCR     -EDLLHRQTQASRPNVGNLFQNSISSLRNPRA-VDDRSRSLDGLETLIHRTQQLETELNTERERCVVLER
Y328_MYCGE      ADHEILQESYGKLKTDFEKLKK------NKLNDANEQYQD------LLSAFEETNSELEKAKQSLSASDS
OV71_ONCVO      AEINLLRRRVSNLEEEVSRIKKDNLYFVNELNKA-RANLDQETLNRIDFQ-NQVQTLLEEIDFMRRVHDQ
MYH2_PIG        HANRMAAEALRNYRNTQGILK----DTQIHLDDALRGQEDKEQLAMVERRANLLQAEIEELRATLEQTER
MYH2_CANFA      HANRMAAEALRNYRNTQGILK----DTQIHLDDALRGQEDKEQLAMVERRANLLQAEIEELRATLEQTER
MFP1_TOBAC      LEVQVTQETLEKSRSDASDIAQQLQ----QSRHLCSKLE--AEVSKLQMELEETRTSLRDETKRXKKTNE
KINH_SYNRA      EKETELTNREKSLREEMGYYKEQEQSVTKE------NQQMTSELSELRLQLQKVSYESKENAITVDSLKE
GCOM1_HUMAN     VENQLLKKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK--------EALLEETNSFLKAIEE
CCD69_XENTR     ----SLQERVDELKTQLASFQEKMKRVEESVQDYRRHIQDEQEIQSLHFVIEMKSELIREQDKRLRSHK-
CCD41_RAT       -------RAKSELERERNKIQSELDGLQSD-NEILKSTVEHHKVEKDRELIRKVQAAKEEGYQKLVVLQD
BRE1_CAEEL      SMNRSLKSEKIRLREKDKQSQKDINTLKSELTDKCVSNAPPEDVNKIRQEYESLCKEVKRLGA--MEKQE
SBCC_STAS1      KVTAQASEKQN-LEKEIETFKKEKQSYELYIAQLKAETNNKKDTQQLKERFEEMQQVYETASTKMEFNSK
MYH8_RAT        TQNASLINAKKKLENDVSQLQSEVEEVIQRITDAAMMAEELKKLERMKKNMKDLQHRLDEAQLALKGGKK
ERC2_MOUSE      LRIETQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKENIHLRE
ERC2_HUMAN      LRIETQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKENIHLRE
ATG11_CANAL     ----------------------------------------------------------------------
SMC1_SCHPO      QSKDSLTSIVGDLESKIKSLHESVSSLDTERADKIESLEEKHDQQKKRLTYSELFHKTQELNEELQSCLQ
RB6I2_RAT       -EIHDLKDMLDVKERKVNVLQKKIENLQEQLRD------KEKQMSSLKERVKSLQA--------------
ODFP2_CHICK     MENERLKASVVPMEEKLNQAHVEVQQLKSSVRNYEDLIETKSQVLKTRMEAADVAAKLEKCDNEKKALKD
MYSP_SARSC      ------------------------------------------ENKKLTDDLAECKSQLNDAHRRIHEQEI
MYSP_MYTGA      LDDALNGQRAAEERAD--RLQAEVNRLADELRQEQDNYKNAESLRKLEIEIREITVRLEEAEAFAQREKR
HOOK1_DANRE     IERDTLRETNEELR------CTQAQQDQLLLAGKYQTGSPSHDAEMLPIEYREKFIRLQHENKMLRLQQE
CYTSA_DANRE     IHNAGDKSDIHQLLEGVRLDKEEAEAKASKLQD---------DLGHARSEV----ACLQDTLNKLDAEYR
CP250_MOUSE     L--ALLAQTLSNREREVETLQAEVQELEK------QREMQKAALELLSLDLKKRSREVDXXXXXXXXXXX
CP135_DANRE     REKDTLQDAVDQKTESVVLLQQEVHRKEETLLE-------------VRLTVTDLENSLNQLQAVLSSRER
CI093_HUMAN     EELVMAKKHQAFLVETCENNVKELESILDSFTVSGQWTSGIHKLERLRRTLTDYQNKLEDASNEEKACNE
CD158_HUMAN     EEYEVLKRTTNKLKMQLKSAQSELEQTRNTLKSMKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKE
YA046_HUMAN     ------KESNLRLKGETGIMRKKFSSLQKEI------EERTNDIETLKGEQMKLQGV-------IKSLEK
SMC4_YEAST      NLNEVCLEKE----NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRFQFK-----LLQSNSKLASTLE
SBCC_LACLA      IENLNAEITEIGITETSYNLIRK----RNRLMEKADLFE--KHLSELMAQLSDIKIKISSQTASLNSFES
RAD50_HUMAN     -----LRQVRQTQGQKVKEYQMELKYLKQYKEKACE----------IRDQITSKEAQLTSSKEIVKSYEN
POF1B_PONAB     EELGHLQNDLTSLENDKMRLEKDLSFKETQL------KEYEELLASVRANNHQQQQGLQDSSSKCQALEE
ODF2L_XENLA     VETLIEKLKDSSLRAD------NVSSL-----DAIDISKQNDLLWKELETFRHIRGILE-----------
MYO3_SCHPO      SKYS---ETESELNKKEAELQKEITEYRDQLHKAFQNPEKTHEANQLSERIKEISEMLEQSIAKLRRKNS
MYH6_MESAU      AKCSSLEKTKHRLQNEIEDLMVDVE--RSNAAAAALDKKQRNELFKLKNAYEESLEHLETFKRENKNLQE
MYH1_MOUSE      TQNTSLINTKKKLETDISQIQGEMEDIXXXITDAAMMAEEERMKKNLEQTVKDLQHRLDEAQLALKGGKK
IFT74_MOUSE     AEDKSMMEERERLLKQVKEDNQEIASMERQLTDIKEKNQFSEEIRQLDMDLEEHQGEMNQKYKELKKREE
IFA1_CAEEL      -------------------------------------------------------------------EKK
CCD68_HUMAN     KENEVLKKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLE------------KEQ
BRE1_ASPFU      ARDELL--ADQQMRKAAQEQEKIATTKVQELADAAQARINESEVDRLRLQ-------LDNT----KAAHT
ALM1_SCHPO      QEACYLQLTAS--RTQCSDLSREVICLMAEL-DHLNETKSRNVPATVQVALDEYASSIKEAVSKTLELRE
VIME_ONCMY      NEKAHVEVDRDNMGEDIERLR---EKLQDEMI---QKEEAEHNLQSFRQDVDNASLARLDLERKVESLQE
TXND2_RAT       ----IFKPSEDSIQSKKGDMPKSSEDIQSKKDDTAKSLEDT-------IQSKNGDMPKSSEDPIQSKKDD
POF1B_HUMAN     EELGHLQNDMTSLENDKMRLEKDLSFKDTQL------KEYEELLASVRANNHQQQQGLQDSSSKCQALEE
OPTN_XENLA      -ENQVDLEEKQSLRYSIKKLELQVESQESEILEQNKTEAEKNQLGILQVSYDKLNSEYQE----LRIREE
MYS_PODCA       -----LSEKDEELEGLRKNHQRQMESLQNTIDSESRSKAEQQKLKKYDADMMELESQLESSNRVAAESQK
MYH2_HORSE      TQNTSLINTKKKLETDISQLQGEMEDIXXXITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQQRLD
MYH1_HUMAN      TQNTSLINTKKKLETDISQIQGEMEDIXXXITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLD
MYH1_CANFA      TQNTSLINTKKKLETDISQIQGEMEDIXXXITDAAMMAEELKKLERMKKNMKDLQHRLDEAQLALKGGKK
KI21A_HUMAN     CEIAIKQKLIDELENSQKRLQEKLMMLQHKIRDT-QLERDQQNLGSVESYSEEAKKVRSEYEKKLQAMNK
GRIP_ARATH      DKDQILEDLKKQLQTELSAKQKNLEGLEAQVVDALSERDKAAEISSLQVLLAEKESKIXXXXAHLKSEEK
EEA1_MOUSE      XXXXXXXGTINQLKQSAEQKKKQIEALQGEVKNAVSQKTXKGKLSALQSNYEKCQADLKQLQSDLKSVEE
BRE1_CANGA      SKVAILEETSKSLKQALDILRDQWEKIEFRNNQSPSSDALLKEIQDLESAFKELSSLTHKKYSEYLNHES
Y4862_ARATH     LEDVVLAHMERELQN-----EREICALQQKDQDLCEVKHEXNEVNMLRKTWEKLTARQILTAVETESKKM
TPM_LEPSA       SEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAADEASRMCK----------VLENRSQQ---DEE
SMC4_ARATH      KQLETLNESRSGVVQMVKLAEKERDNLEG-LKDEAETYMLK-ELSHLKWQEKATKMAYEDTVAKITEQRD
ROCK2_HUMAN     LEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNXXXXXXXXXRTLKQKVE
OPTN_CHICK      SAAATELEEKQQLIYTIKKLELQVESVQAEVLEQAKTQDEKTRYSSLQDAYNKLLAELTEAISEMKVKEH
HOOK2_XENLA     ERLCDLQESESRLQQQIKGLKAQVEELQKQLREQGNRAEDS---SQLKRKLEEHLEMLHDAHSELQKKRE
FTM_HUMAN       VDSEINKDLERSMRETHAETVQELEKTRNMLI-------MQHKINKYQMEVEAVTRKMENLQQDYELKVE
CAGE1_HUMAN     VEELI--EDKYKIILEKNDTKKTLQNLEEVLANTQKHQESRNDKEMLQLQFKKIKANYVCLQERYMTEMQ
SMC4_DICDI      VEEKKLESMLNSLKGEVTELQREMEEKQKQLLPWSKKHSETSELAVLSKDFNGATQNLDDAIKALEDAKT
SBCC_STAAW      LLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFKEQQPEIEGIEAKLKLLQE
SBCC_STAAT      LLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFKEQQPEIEGIEAKLKLLQE
SBCC_STAAE      LLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFKEQQPEIEGIEAKLKLLQE
SBCC_STAAC      LLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFKEQQPEIEGIEAKLKLLQE
SBCC_STAA3      LLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFKEQQPEIEGIEAKLKLLQE
PIBF1_HUMAN     LEEQYIKEDQLSIPEYVSVLRKEICELQNILAE---------ELSTNKNQLKQLTETYEEDRKNYSEVQI
KLPA_EMENI      LDKTITREDLQSLRTELDRERKNTNNLRQNLDTAASNSESTISALKARIEFLE-----------------
GOGC3_ARATH     ---AISNQEDNRLSNDIRKLKDTVDDLNQKLTNCLRTIESKN------VELLNLQTALGQYYAEIEAKED
GOGA5_CAEEL     -----------------