[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01300

[Show Plain Result]


## Summary of Sequence Search
    1::908
   73::980       0.0 100%  980 aa  ATG13_COCIM RecName: Full=Autophagy-related protein 13;
   73::943     e-154  51%  974 aa  ATG13_EMENI RecName: Full=Autophagy-related protein 13;
   77::943     e-148  46%  974 aa  ATG13_PENCW RecName: Full=Autophagy-related protein 13;
   73::943     e-143  46%  974 aa  ATG13_ASPOR RecName: Full=Autophagy-related protein 13;
   79::930     e-143  49%  958 aa  ATG13_ASPFU RecName: Full=Autophagy-related protein 13;
   74::950     e-128  45%  958 aa  ATG13_ASPNC RecName: Full=Autophagy-related protein 13;
   34::882     e-107  42%  905 aa  ATG13_SCLS1 RecName: Full=Autophagy-related protein 13;
   77::909     6e-87  43%  929 aa  ATG13_PHANO RecName: Full=Autophagy-related protein 13;
   22::275     1e-35  40%  715 aa  ATG13_YARLI RecName: Full=Autophagy-related protein 13;
   77::295     2e-28  38%  779 aa  ATG13_PICST RecName: Full=Autophagy-related protein 13;
   50::374     3e-26  32%  758 aa  ATG13_SCHPO RecName: Full=Autophagy protein 13;AltName:
   38::282     1e-25  39%  761 aa  ATG13_CANAL RecName: Full=Autophagy-related protein 13;
   23::263     1e-24  37%  701 aa  ATG13_PICAN RecName: Full=Autophagy-related protein 13;
   31::284     2e-23  31%  837 aa  ATG13_DEBHA RecName: Full=Autophagy-related protein 13;
   14::225     1e-18  31%  669 aa  ATG13_PICGU RecName: Full=Autophagy-related protein 13;
   14::345     7e-15  27%  654 aa  ATG13_VANPO RecName: Full=Autophagy-related protein 13;
   12::263     1e-12  29%  684 aa  ATG13_KLULA RecName: Full=Autophagy-related protein 13;
   69::250     3e-11  35%  659 aa  ATG13_ASHGO RecName: Full=Autophagy-related protein 13;
   48::281     1e-07  30%  738 aa  ATG13_YEAST RecName: Full=Autophagy-related protein 13;
   48::281     1e-07  30%  738 aa  ATG13_YEAS7 RecName: Full=Autophagy-related protein 13;
   13::120     1e-06  28%  660 aa  ATG13_CANGA RecName: Full=Autophagy-related protein 13;
    1::908

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQNYHTKAALVILHSRVDLSPATYHGVIRTNKWFNVEVNETEDLKDSLGVWKYSNCTDSRPPPLIIEVYL
ATG13_COCIM     IQNYHTKAALVILHSRVDLSPATYHGVIRTNKWFNVEVNETEDLKDSLGVWKYSNCTDSRPPPLIIEVYL
ATG13_EMENI     --NYHTKAALIILHSRVELPPAKNSNVPRVNRWFNVELEETDALKDQLKTWRTCDATDNRPPPMIIETYL
ATG13_PENCW     ISNYHTKAALIILHSRVALPPSFNKGSERVNRWFNVELDDTDVLREPLRPWRTCDATDNRPPPLVIETYL
ATG13_ASPOR     ISNYHTKAALIILHSRIELPPSFNKGTPRVNRWFNVEIEDTDVLREQLRTWRTCDATENRPPPLIIETYL
ATG13_ASPFU     ---------------------------------FNVEIEDTDILREQLRIWRTCDAIENRPPPLIIETYL
ATG13_ASPNC     --NYHTKAALVILASRIDLTRSDDTPKIKVNRWFAIDLEDIDALREQLRFWRINDVSEQPPPPLIIETYL
ATG13_SCLS1     IQNFHTKAAIIVLGARVGLPVVTKEGTKKVNKWFQIETDDTDAYRDELHTWRMCGGFQNRPPPLIIETYL
ATG13_PHANO     IQNFFTKSALSIVSSRVIL-PTSFNGDIRQNKWFNVILDDSDELQLRLTEWKTMDAMAGQHPPLYIEVYL
ATG13_YARLI     VQNFFSKATQVVVQARLNLREQRQSGKHKLNKWFNLETDELEAYREDLKLWRTIDIYNDKMPPVVVETYL
ATG13_PICST     ----------------------------KINRWFNLHIQNSQDLKDDLKLWK-SNHLQSMPP-MIIETYL
ATG13_SCHPO     ------KTGLIILESRLNVGTSRPRESSKNNKWFNLEIVETELYAEQFKIWKNIELSPSRKPPMVLHTYL
ATG13_CANAL     IQKFFTKAAQIILESRATTTPSLYEESSKINKWFNLYMTNIPDCKDDLKLWKGVDLTTI--PPMIIETYI
ATG13_PICAN     IQNFFLKAAHVIFHFRVALQPDDSYGAMGNNRWFNLDLGNYEIPRTELSLWRNKDILSL--PPLVLETFL
ATG13_DEBHA     IQNFFSKSVQIVLQSRIQSESHNKEEQLKVNKWFNLHMYNDNLPKEELKLWKNINDV-SQMPPMIIEVYL
ATG13_PICGU     --NFFLKTSQMILQAR----SLDEHGKGKLNKWFNLHTFNSDDLRSELRLWR-STIDLTAVPPMIVETYL
ATG13_VANPO     IHNFFLRSTLLICSSKLNKNQHLLEEIQK----FDSDLNEKPDLPKTINEWFHDE-NERNLPPLVIETLL
ATG13_KLULA     INNFFLKSALLLEQSKVAHNFDTEEALRDGNHLFNIETRGDPLLEAQIQPWITFDGVKTMPP-LVIETYL
ATG13_ASHGO     -------------------------------------------------------------PPLVIEMFL
ATG13_YEAST     --------------------------------WFEDHSELVSELPEIISKWSHY---DGRKPPLVVETYL
ATG13_YEAS7     --------------------------------WFEDHSELVSELPEIISKWSHY---DGRKPPLVVETYL
ATG13_CANGA     IQNFFLKSAGLVTTVESNRYSLDDTSIEFDDEWFDMNIDVLHDLPPIIDKWTNFDGTQELPP-LVIETFL


                         .         .         *         .         .         .         .:140
query           DLTQLTNNQSLVIIDDSGKRWDVVEALATYGCLDNSRTSKSGVILERWRIXXXXXXXXXXXXXXSILPTV
ATG13_COCIM     DLTQLTNNQSLVIIDDSGKRWDVVEALATYGCLDNSRTSKSGVILERWRIXXXXXXXXXXXXXXSILPTV
ATG13_EMENI     DTAGLTNNQTLVALDDNGKRWDVTESLXXXXXXXXXXXXXXXVILERWRVELGDMPGKLPSDLGAILPTV
ATG13_PENCW     DTKGLTNNQSLVILDENGKRWDVRESLAA---LQGARSENDEIILERWRIELGESSSRLPADLGSILPTV
ATG13_ASPOR     DTKGLTNNQTLVALDENGKRWDVLEALAASQQAHPVRASSDDVILERWRVELGDTSNALPADLGSILPTV
ATG13_ASPFU     ETKGLTNNQSLVILDENGKRWDVLEALTASGQASPVRPPHSNVILERWRVELGSASSKPPSDLGSILPTV
ATG13_ASPNC     DTKDLTNNQSLVALDEQGKRFDVLESLSSEAHAKGPVSSRSDVILERWRVELGNTPNKALPADLSILPKI
ATG13_SCLS1     DTSHLTSSQRLVIVDDLGKRWDALDALSN-SC--GSNDGRSEVILERWKIELRDIPGEQPYDFGSTLPTI
ATG13_PHANO     DISGLGHKQSLVVHDEDGKRWDVAAALAQPTSRASSRPARTQIVIERWKIYVGDIDSVHPSDLTEPLPNV
ATG13_YARLI     DMRHLSPNQTLVLEDAFGKRWN-----ASFG------GRKTEVVLERWVIEIQRPDPQAGGATTSPLPMA
ATG13_PICST     DLRQLTSSQTIVLNDDNGNPWAVAK----------SGGKKQEVVLERWLIEFDHTDASGSIVDE--LPLI
ATG13_SCHPO     DISDLSKNQTLSVSDGTHSH-----------AINFNNMSTMKIVLERWIVNLDGEALSTPLE----LAVL
ATG13_CANAL     DLRNLPADQTLVLMDDEKHPWTVAK----------SRGKKQEVVLERWLIEFEPNTTDATVMVEE-LPLS
ATG13_PICAN     DLRGLSSNQTLMLDDVIVKT-----------------SKKSEIVLERWLIEFDLSTFDNEVME---FPSI
ATG13_DEBHA     DLRQLTAIQTVILRDDNGNPWTVAK----------GGSKKHEVVLERWLIEFDANTVSGTIVDE--LPLI
ATG13_PICGU     DLGNLPQGHTLALKDEHGNLWPVTK----------GGSKKTEVVLERWLVEFDPNEFGTIEE----LPYI
ATG13_VANPO     DLKKLSPNHFVTLRDDDGNVWNVCKG-----------TKKSEIVLERWLIELDNTSAAFQSYRGTIDSTI
ATG13_KLULA     DLRALQPNHMVYLHDADGNPWMVCKG-----------GKKTEIVLERWLVELDKQTIDDSIDSND-PENL
ATG13_ASHGO     DLRRLGPQHTVVLKDQDGNPWNVCKG-----------GKKSEIMLERWLVELDVGXXXXXXXXXXXXXXI
ATG13_YEAST     DLRQLNSSHLVRLKDHEGHLWNVCKG-----------TKKQEIVMERWELDNSSPTFKSYSEDETDVNEL
ATG13_YEAS7     DLRQLNSSHLVRLKDHEGHLWNVCKG-----------TKKQEIVMERWELDNSSPTFKSYSEDETDVNEL
ATG13_CANGA     DLHLLPSSYTVRLRDDESHLWAV-----------SKGNKKSEIVLERWLI--------------------


                         +         .         .         .         .         *         .:210
query           YKKSIVVFRSLYAYSKLLPAWKYSKRHSKIRPNPALSLKYRILQGPGGQIRSTNDPLTVPLHPGNGPVVD
ATG13_COCIM     YKKSIVVFRSLYAYSKLLPAWKYSKRHSKIRPNPALSLKYRILQGPGGQIRSTNDPLTVPLHPGNGPVVD
ATG13_EMENI     YKKSIILFRSLFTYSKFLPAWKFIKRNGRSRAHPALRVKYRIFSGHARDL-SKQDHLTMPLFEGDTKVVD
ATG13_PENCW     YKKSIVLFRSLFTYSKFLPAWRFSKRNKKLRQSPALQIKYRVVDGSVARDDLSLDHLTAPLSEGSEKVVD
ATG13_ASPOR     YKKSIVLFRSLFTYSKFLPAWKFAKRNGRLRANPALRIKYRIIIGSPNQVSSKPDHLTMPLYESSSKVVE
ATG13_ASPFU     YKKSIVLFRSLFTYSKFLPAWKFAKRNGRLRSNPALQIRYRILDGRTASDRRQVDHLTVPLYEGNTKVVE
ATG13_ASPNC     YKQSIVTFRTLFTYSKLLPAWKLAKRNGRLHAHPALQIRYRILAGKPNPDDSRPDRLTTPLFDSSNKVVE
ATG13_SCLS1     YKKCIVFFRSLYSTAKLVPAWKFKKSLGKNSPTNSLIINCRITTGDTQPRRI--DGLKQPILDHSGPVTS
ATG13_PHANO     YKKAVVLFRGLYANLRLLPAFKYNKSMAKQPANTSLKLNYRILN--GASERPQLDTLSLPLCPSTDPITE
ATG13_YARLI     YKKCILLFRSLYTYCRLLPAWTLQKRLSKSKLSTSLRIGCRVLNG-SQPISSRGRVGLSKLIAGSSESLQ
ATG13_PICST     YKQAIILFRSIYGFARLMPAFKLKKRKSSTKLN-KLTIGNKILDGKQPISSKGRIGLSKTIIPRQMLTTD
ATG13_SCHPO     YKKLVVLFRSLYTYTHLMPLWKLKSKIHKLRAH-GTSLKVGCALSTDDVLSNDXXXXXXXXXXXXXXXXX
ATG13_CANAL     YKQAIVLFRSIYGFTRLMPAFKVKKNLQN-----KLPLGNKILDG--------NQPISSKGRIGSKPIIN
ATG13_PICAN     YKKIIILFRSLYLLAGLLPSYRLRDKLVKSKSNSAIHVSCRILDGSKGRIGLSKKLLSEEEHTSSKKLQP
ATG13_DEBHA     YKQAIILFRSLYGYTRLMPTF----XXXXXXXXXXXXIGCKILDGKQPISSKGRIGLSKSIIPHQMLTTE
ATG13_PICGU     YKQAIILCRSIYTIIRIMPA------ASLRNQSPHYVLANKIVDGSKPISSKGRIGLSKTIIP-HQMLTD
ATG13_VANPO     RKQIVLLARYLVTLIQILPSNELEENLTKNSTNLILSLKRKVIDG--------SKPILSKGRIGSKPIIS
ATG13_KLULA     HKQLVLLFRYLYTLTQLLPANDITKPHNSQQP-ALINVQTRLLDG--------SKPILSKGRVGSKPIIA
ATG13_ASHGO     YKQLVLLFRYLYTLTQLLPANEYARLHGPSNQGPLINIGTRILDGSKGLSRSIIATYTNVINETNASHLE
ATG13_YEAST     SKQLVLLFRYLLTLIQLLPTTEYNGPQNEGSSNPITS------TGPLVSIRTCSKPILSKGRIGSKPIIN
ATG13_YEAS7     SKQLVLLFRYLLTLIQLLPTTEYNGPQNEGSSNPITS------TGPLVSIRTCSKPILSKGRIGSKPIIN
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TYSFGVTDSPAGPLSALVTYRTNCDFRVDDSEALLSSRFMGVDERFFKPSLPSEDNFAAAGQEHGSLPVQ
ATG13_COCIM     TYSFGVTDSPAGPLSALVTYRTNCDFRVDDSEALLSSRFMGVDERFFKPSLPSEDNFAAAGQEHGSLPVQ
ATG13_EMENI     TYSFGVTDSPAGPFSVQVTYRTCCDFRVDDSEALLSSQFMGADDEIFQPSLPSGGLDARVTPEVGSAPLT
ATG13_PENCW     TYSFGVTESPAGPFSVQVTYRTNCDFRVDDSEALLSSRFMGADDEIFRPSLPSDD-VNRPNPEIGSVPVE
ATG13_ASPOR     TYSFGVTDSPAGPFSAQVTYRTSCDFRVDDSEALLSSRFMGADDEIFRPSLPTRVDSKVPPPEIGSLPQE
ATG13_ASPFU     TYSFGVTDSPAGPFSVEVTYRTNCDFRVDDSEALLSSRFMGADDEIFRPSFPSRDNRRASNAEPGSAPLE
ATG13_ASPNC     TYTFGTTESPVGYLSIQVTYRTSCEFRVDDSEALLSSRFMGADDEVFRPSLPSESNLKAANSGVGSAPVE
ATG13_SCLS1     TYVLGATDTPAGQIFAEVTYRNDCNFRVDDSESILSSRFMGADEHFFTPSLAAKGDLSTKQTEIGSLPAH
ATG13_PHANO     TAHIGSTNSPIGPLCISVEYRDACEFSVEDSESLLSDQFMGLDDTYL------EQKPRAAAPVPGSLPVD
ATG13_YARLI     TFSFDPVEIPSGVFKISVSYRVNCNFAVDDSEAMLSSQFLRIDE--------------------------
ATG13_PICST     SHHFQPIQTSLGTLKISIAYRNHCDFCIHDNEEVLSTHFISMD---------------------------
ATG13_SCHPO     XXXXXPVGTPAGDFRISVQYRKNCHFEVHDSDALLSNQLLSADKHQLAASNNSQD--FEDGKQYDQPP--
ATG13_CANAL     TRTFQPVHTSLGTLKISVAYRMDSEFCLHENEELLSSHFHKRDE--------------------------
ATG13_PICAN     VLT------PIGALRVSVSYRTNCNFQVSDTEEALSSQFM------------------------------
ATG13_DEBHA     SHHFLPIQTTLGTLKISIAYRNHHEFSIHDNEELLSTHFVNIDD--------------------------
ATG13_PICGU     THTFSPIETSLGTLKVSVAYRSHCEF--------------------------------------------
ATG13_VANPO     TYSNVINETPLGLLRISVSFRHDCRFEVNDSSDNVASNTTNIHQHLEPLHNKNYTNTSLSISPHSHIALE
ATG13_KLULA     SYSNTMNETTFGSLRITVSYRKDVDFYVIDSDDL--------QKRYMTPSLSNE----------------
ATG13_ASHGO     QKKITPISTGYGSLRITVSYRRDCNFDVNE----------------------------------------
ATG13_YEAST     TYSNALNESPAGLLRVSVSYRRDWKFEINNNDELFSARHASV----------------------------
ATG13_YEAS7     TYSNALNESPAGLLRVSVSYRRDWKFEINNNDELFSARHASV----------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KRDVGRPDLGQAYGSMSTFHQVGATTGASPISALRAARELAAGXXXXXXXXXXXXXXXQAGRVAALSGEG
ATG13_COCIM     KRDVGRPDLGQAYGSMSTFHQVGATTGASPISALRAARELAAGXXXXXXXXXXXXXXXQAGRVAALSGEG
ATG13_EMENI     RRTVEDPDLSRAYGSLSTFHHVGPTTGASPIXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXTLANDT
ATG13_PENCW     RKAVENPDCTRAYGSLSTFHQVGPTTGASPISTLRAMRDSGAGSPSPTDSPKRLLPPAKSGRAGQIAGEG
ATG13_ASPOR     RRTIEDPDPGRAYGSLSTFHQVGPTTSASPISALRAKGKLGTXXXXXXRKALAVAKASPVGRAAALASEG
ATG13_ASPFU     KRTVEEPDPGRAYGSLSTFHHVGPATGASPISALRAARESVTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ATG13_ASPNC     KRTVEDPDPSRAYGSLSTFHHVGPTTSASPISALXXXXXXXXXXXXXXXKPVEVVKASPLGRAAVLANES
ATG13_SCLS1     KHLTDDSGPVQTYGSLSTFHGNAPPRGSSPMSALRAQRPIGSDTSSPPVGSLPYSRPSLTSKGSLKSFEG
ATG13_PHANO     KLNTQEPDVGQAYGSLSTFHQVGPPTGTSPISALRAARDMPSSSPIETPPQKLPPNHRTAGSKSSLRSND
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     -----------------------------PSFATRLAK--------------------QSDPNSLLQSEI
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     RNSIGKKDLNSKTGSVGTINQIRTTSNPSVIATLRAQR--------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NHLIQRRPSISIQPFKAPPLSASPALVDSPVGSQPKNSAPRVGPMDITSSARQMPPPHGTPTTSRRSAHV
ATG13_COCIM     NHLIQRRPSISIQPFKAPPLSASPALVDSPVGSQPKNSAPRVGPMDITSSARQMPPPHGTPTTSRRSAHV
ATG13_EMENI     NPNVARRPSISFQPFKAPPLSASPSLVDPPLSASPRTTG--AGRTSL-SDSRHMPPPSVTTSSRKPPSFG
ATG13_PENCW     SSNFQRRPSVSFQPFKXXXXXXXXXXXXXXXGMSPRNMSSRI-PTGTSADSRVMXXXXXXXXXXXXXXXX
ATG13_ASPOR     SPGVVRRPSISFQPFKXXXXXXXXXXXXXXXXXXXXXXGPRPHPPMAASARKSFPA-------------V
ATG13_ASPFU     XXXXXXRPSISFQPFKAPPLSASPSLIDPPLGASPRSRPIVSAP---SSEPKHMPPPSVAASGRKTGQXX
ATG13_ASPNC     SPGVARRSSISFPPFKAPPLSASPSLVDPPLGMSPR-SGTMTRPQ--FPESKNMPPP-SMAASARKSLPL
ATG13_SCLS1     MAL-ARRTSLSFQPFKAGSLSSSPSRATYAGETLPASSLPRASGISALAQARNRSSTAGMPATLRGGXXX
ATG13_PHANO     TSSFQRRTSVSFQPFKXXXXXXXXXXXXXXXXXRPTSAFGRIVPNSL-NQPRNRTSLNALPQAALRAPSL
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     QHLAQAAPLVTIHPFKSPSLSASPGSNFDNMSISPKVAVNR-----------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXXPRPAPISKYSSSFSHRRGRLSSGGASKTDDDNNXXXXXXXXXXXXHPGSGTSADPATT
ATG13_COCIM     XXXXXXXXXXXXPRPAPISKYSSSFSHRRGRLSSGGASKTDDDNNXXXXXXXXXXXXHPGSGTSADPATT
ATG13_EMENI     PDXXXXXXXXXXXRPTPMSRYSSAFSHRRGRPSSGGINKLEDD-NXXXXXXXXXXXXQPGSGLLAEITGT
ATG13_PENCW     XXXXXXXXXXXXXXXXXXXRYSSSFSHRRGRLSA-GANRLEDDNS-SGRASATSSNAQPGSGLLTEATGT
ATG13_ASPOR     QDNXXXXXXXXXXXXXXXXXXXXXXXHRRGRPSSGGINKLEDD--XXXXXXXXXXXXQPGSGLLAEPTGT
ATG13_ASPFU     XXXXXXXXXXXXXXXXXXXXXXXXFSHRRGRPSSGGINKIEDD-XXXXXXXXXXXXXQPGSGLLAEVTGT
ATG13_ASPNC     XXXXXXXXXXXXXXXXXIARYSSAFTHRRGRPSSGNINRIDDENS-SGKTSATSSNPQPGSGLLAEATGT
ATG13_SCLS1     XXXXXXXXXXXXXXXXXIARYSSSFTHRRSRPSYGGASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ATG13_PHANO     NDNAIXXXXXXXXXXXXITRYSSSFGHRRGKFSTGG-SKTEED-ALSSGKGSATSSLQRGSDTLNXXXXX
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SSGSLQADEDNISDFLKMLEMGKDLLSRKDSKSLDKNTKRTSAALSRFQKMRDXXXXXXXXXXXXXXXXX
ATG13_COCIM     SSGSLQADEDNISDFLKMLEMGKDLLSRKDSKSLDKNTKRTSAALSRFQKMRDXXXXXXXXXXXXXXXXX
ATG13_EMENI     SSDSIHADDENISEFLKMLDLRKDLLSPSSQTAMDNHSRRASAALSRFRGMKXXXXXXXXXXXXXXXXXX
ATG13_PENCW     SAESIQADDENISEFLKMLDSKKDLMNSSTSASIQPGPSTTAAALARFRGMRDSNAALXXXXXXXXXXXX
ATG13_ASPOR     SADSIHADDENISEFLKMLDLRKDLLNTSGSAALDXXXXXXXXXXXXFQRMRXXXXXXXXXXXXXXXXXX
ATG13_ASPFU     SADSLHADDENISEFLKMLDLRKDXXXXXXXXXXDXXXXXXXXXXXXFQRMRDXXXXXXXXXXXXXXXXX
ATG13_ASPNC     SADSIHADDENITEFXXXXXXXXXXXXTSNXXXXXXXXXXXXXXXXXFQRMRDXXXXXXXXXXXXXXXXX
ATG13_SCLS1     XXXXLQTDDDNISDFLKLLDSKKTLQSFEPSGEASK--KRATAQLSKFQSMRDSHNALTDXXXXXXXXXX
ATG13_PHANO     XXXXXXXXXXNISDFLKLLEAKKDLKSRSDSSTRDATMRKTTAQLGKYQRMRDSHAQLSDXXXXXXXXXX
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXKQLPNXXXXXXXXXXXXXXXXXXXXXXHTQHIPAVPSRLSSNSVVDYXXXXXXXXXXXXXXXXX
ATG13_COCIM     XXXXXXKQLPNXXXXXXXXXXXXXXXXXXXXXXHTQHIPAVPSRLSSNSVVDYXXXXXXXXXXXXXXXXX
ATG13_EMENI     XXXXXXKQLSGVPGIAGTSISTASSPGGKAISPHTPHTPAIPSRLSSNSIVD----------NTTTRLHG
ATG13_PENCW     XXXXXXKQLPPMVAGTSISTASSPGKPMSXXXXXXXXXXAIRSRLSSNSVAD------DIETDHHSRLPR
ATG13_ASPOR     XXXXXXXXXXGVPPMVAGTSISTASSPGKPISPHTPHTPAIPSRLSSNSIVDY-----THSEGNGTELSQ
ATG13_ASPFU     XXXXXXKQLSGVPPMVAGASVSTASSPGKPISPHTPHTPAIPSRLSSNSIVDY----NDHGHSDGRLLHG
ATG13_ASPNC     XXXXXXXXXXGVPPMVAGTSISTASSPGKPISPHTPHTPAIPSRLSSNSIVDY-----------GNERGR
ATG13_SCLS1     XXXXXXXXXXXVPPMVAATSISAASSPGKPISPHTPHTPAIPSRLSANSIAEYDQPRRVTRRSRTTEARL
ATG13_PHANO     XXXXXXXXXXXXPAMIHGTSISTASSPGKPISPHTPHTPAIPSRLSANSIIEY-----------------
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           XXXXXXXXXANDEPRLKRDESTANAIDXXXXXXXXXXXXXXXXXXXXXXXXPPVEDDLGDFLPFGMRSLS
ATG13_COCIM     XXXXXXXXXANDEPRLKRDESTANAIDXXXXXXXXXXXXXXXXXXXXXXXXPPVEDDLGDFLPFGMRSLS
ATG13_EMENI     DNGSPVEEDASDETTTERLPSTVTAIPIPTSPATIFPSTFXXXXXXXXXXXXHAIDD--DEI-FTMRSVS
ATG13_PENCW     IHHDPPLEEHSSAENTRAPSSTAGAID--IPTSPRIFNPXXXXXXXXXXXXPIVTSDDDEIFPFGIRSLS
ATG13_ASPOR     GHGSPLDENTSDGTTMEHGPSAVNAIDIPTSPRLFPPVYRRSSSAAHRPRTVAVDDD--EIFPFN-RSVS
ATG13_ASPFU     GPTSLPEDTTGEETALVHRPPTVTAIDIPTSPRLFPPTYXXXXXXXXXXXXXXXDEE--EIFPFNMRSVS
ATG13_ASPNC     EQPSSVGDYTPEGPTIPHRPSTVNAIDIPTSPGLXXXXXXXXXXXXXXXXXVATDDD--EIFPFNLRSVS
ATG13_SCLS1     EDVQD-----NDH----SNDAGTNAIDIPTSPRPYYPHARRSSSVAQQHRALAIDDDLGD-LPFGVRSIS
ATG13_PHANO     ----------------------------------------------------------------------
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAEDRSTLSLSELVRQQESSVPASDTNALQQQNQKDTRTGQSIVDESPSRIDNVPGTSSPRQYQPRFAH
ATG13_COCIM     LGAEDRSTLSLSELVRQQESSVPASDTNALQQQNQKDTRTGQSIVDESPSRIDNVPGTSSPRQYQPRFAH
ATG13_EMENI     LGAEEPSHTTLGALQRQQDYE-PIGTNIAPLESGARSSGGDDGNVLRGPTRLSGPTVATSPYSHHPRISH
ATG13_PENCW     LGADESANATLGATXXXXXXXXPAEDRSGPSVSTTGPYRDSASLRGQM-SGPTSASASSNPHVYQPRFAX
ATG13_ASPOR     LGAEERSNLSLGALHRQHEYESSDTATHRAQREPRPMSSNEDAVV--PPSSITRGQGTPGPXVYQPRFXX
ATG13_ASPFU     LGAEERTNVSLSTLHRRHEYHNAATNPTALPSPAKRETRSGDATVS---GQTPELSSSANHNLYQPRLGQ
ATG13_ASPNC     LGAEERSHNSLSALQRQHDLEGAKSNTQPTRREQRPPLASEDXXXXTSLSGPTVAPSPSNNHVYQPRFSL
ATG13_SCLS1     LGADDREPPSLSTLL------------NIGQASDDVESPTGQ-----SPSLLQPAPRISEG-------ST
ATG13_PHANO     ----------------------------------------------------------------------
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           GRGRGSFGHPQPHVSAASSLGRASPIPNVTDADRERYIGSGNNGGTAVPPDTRRGSSHRFSFNRHLGTPA
ATG13_COCIM     GRGRGSFGHPQPHVSAASSLGRASPIPNVTDADREGYIGSGNNGGTAVPPDTRRGSSHRFSFNRHLGTPA
ATG13_EMENI     SRGRXXXXXXXXXXXXXXXXXXIHPYPAEREAERDANAGASH----XXXXXXXXXXXXXXXXXHNLPQAA
ATG13_PENCW     XXXXXXXXXXXXXXXXXXXXXXXXXTPHLAERDQDRDXXXXXXXXXXXTLEIRRGSGQRPSTGRTLSGQA
ATG13_ASPOR     XXXXXXXXXXXXXXXXXXXXXXXXXIPGLAERESERGNGSGSNSVTSAMEDXXXXXXXXXXXXXXXXQSA
ATG13_ASPFU     FRSRXXXXXXXXXXXXXXXXXXXXXIPTLTERXXXXXXXXXXXXXXXXTTEERRGFGRRVSAGRNYPPPS
ATG13_ASPNC     -CXXXXXXXXXXXXXXXXXXXXXXXXXDLAERDHDRDVASGSNSGTSTVED-XXXXXXXXXXXXNIPPPS
ATG13_SCLS1     AMSRQTSSSLEAHDSEVPQLSRFSGPGSANSPYRPRIGKTGGRGVT--PPQTGSFSSXXYSFSRGIG--A
ATG13_PHANO     ---------------------------------------------------------------------A
ATG13_YARLI     ----------------------------------------------------------------------
ATG13_PICST     ----------------------------------------------------------------------
ATG13_SCHPO     ----------------------------------------------------------------------
ATG13_CANAL     ----------------------------------------------------------------------
ATG13_PICAN     ----------------------------------------------------------------------
ATG13_DEBHA     ----------------------------------------------------------------------
ATG13_PICGU     ----------------------------------------------------------------------
ATG13_VANPO     ----------------------------------------------------------------------
ATG13_KLULA     ----------------------------------------------------------------------
ATG13_ASHGO     ----------------------------------------------------------------------
ATG13_YEAST     ----------------------------------------------------------------------
ATG13_YEAS7     ----------------------------------------------------------------------
ATG13_CANGA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           NMDEDEPLLFAMSDFGASRRSLEEGRKXXXXXXXXXXXXPSTELQPAAETRSEGGPPSVSRGRYRAWP
ATG13_COCIM     NMDEDEPLLFAMSDFGASRRSLEEGRKXXXXXXXXXXXXPSTELQPAAETRSEGGPPSVSRGRYRAWP
ATG13_EMENI     QVEEDEPLLFAMSDFGASRRSFEEGRQ-----------------------------------------
ATG13_PENCW     -PEDDEPLLFAMSDFGASRRSLDEGR------------------------------------------
ATG13_ASPOR     QLEEDEPLLFAMSDFGASRRSFEEGK------------------------------------------
ATG13_ASPFU     QVEEDEPLLFAMSDFGASRRSFEEGRQ-----------------------------------------
ATG13_ASPNC     QVEEDEPLLFAMSDFGASRRSFEEGR------------------------------------------
ATG13_SCLS1     YEADDEPLLFDMSEIGISRRSIDEPR------------------------------------------
ATG13_PHANO     NLDDDEPLLFQMSEIGASRRSLEE--------------------------------------------
ATG13_YARLI     --------------------------------------------------------------------
ATG13_PICST     --------------------------------------------------------------------
ATG13_SCHPO     --------------------------------------------------------------------
ATG13_CANAL     --------------------------------------------------------------------
ATG13_PICAN     --------------------------------------------------------------------
ATG13_DEBHA     --------------------------------------------------------------------
ATG13_PICGU     --------------------------------------------------------------------
ATG13_VANPO     --------------------------------------------------------------------
ATG13_KLULA     --------------------------------------------------------------------
ATG13_ASHGO     --------------------------------------------------------------------
ATG13_YEAST     --------------------------------------------------------------------
ATG13_YEAS7     --------------------------------------------------------------------
ATG13_CANGA     --------------------------------------------------------------------