[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01629

[Show Plain Result]


## Summary of Sequence Search
    1::694
  107::364     8e-31  33%  367 aa  RID1_SCHPO RecName: Full=GTPase-binding protein rid1;
  203::338     2e-04  26%  393 aa  RTN2_YEAST RecName: Full=Reticulon-like protein 2;
 1477::1627    9e-04  27% 1792 aa  RBBP6_HUMAN RecName: Full=Retinoblastoma-binding protein 6;AltName:
    1::694

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RID1_SCHPO      ----------------------------------------------------------------------
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxVEEEMSLYTPRGYSPSSQRNFYDFQQPSLTKRPDSKWRPKSEYGSSSTSSVK
RID1_SCHPO      ----------------------------------------------------------------------
RTN2_YEAST      ------------------VVEKTEPYIDKIIPPQTDEGSYSTSISNENKSSTSQ-RNKSGLSSSEFDNMN
RBBP6_HUMAN     -------------------------YDTREYSSSKRRD----EKNELTRRKDSPSRNKDSASGQKNKPRE


                         +         .         .         .         .         *         .:210
query           DILQSIHRRSPSAGSVKSNASRTHPLAERPPSEKRKSSNGNRGSRVMAAIAAFSAKDKNFDKPKPVDPKE
RID1_SCHPO      ----------------------------------------------------------------------
RTN2_YEAST      DT-------SASKSGKDSYSTSQYNRAEYPVSQNENIGTLKSGKQEIPTEKDFNNRHENFSKPKTYDPRT
RBBP6_HUMAN     E------RDLPKKGTGDSKKSNSSPSRDRKPHDHK---------------ATYDTKRPN-EETKSVDKNP


                         .         .         .         +         .         .         .:280
query           IDSEFERLLDARNIPHNMRDRMRSLNTNIKADFINKNQIEGECSSASASAQRQFVTTSHKRTKSKDxxxx
RID1_SCHPO      ----------------------------------------------------------------------
RTN2_YEAST      VDIEEELAAHQRELEQNLKD--------------------------------------------------
RBBP6_HUMAN     CKDREKHVLEARNNKESSGNKLLYI-LNPPETQVEKEQITGQIDKSTVKPKPQL---SHSSRLSSD----


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
RID1_SCHPO      ---------------------------------------PDDFISYIVNT-KIDSIDESIIHKLALLLRN
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWRXXXXXXXXXXXXXCIKALCTTSPALHQLCKIGDDLFPTL
RID1_SCHPO      EQVIWVEKFIHNGGFGVVFCTIDKISRLEWREELHDSILEQLLLCVKAMCTVQRGLECLSQSTYNVERLI
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LRMLFGEEKKGPSEFATRNXXXXXXXXXXXXATFEEVATRARTILSYMHDPKPPKESAPLPFIAEMHQAR
RID1_SCHPO      SLLL---SKKQPCDFVVRELVQIVHSFYKAHLDKEEGAMQVFSLFSIKDD-----KDEEVEFLKNVRVDR
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PYQLWCKEMSNVTKEVFWIFLHHFNVVPVAKAEDSSLPFIQRYFXXXXXXXXXXXYIGGVEWDATNYLAT
RID1_SCHPO      PFRRWIIELEDVSRNVFWVWNHDSNVIDLEK------QYNQVY-------EAPLGFIGGIETEATSYVAA
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RID1_SCHPO      HIHLINELLEGLP-LEKRQRKRLELQLSGLERIMGLRFR-------------------------------
RTN2_YEAST      ----------------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RID1_SCHPO      ----------------------------------------------------------------
RTN2_YEAST      ----------------------------------------------------------------
RBBP6_HUMAN     ----------------------------------------------------------------