[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01668

[Show Plain Result]


## Summary of Sequence Search
    1::628
   40::597       0.0  54%  612 aa  AMYG_ASPOR RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
   38::625     e-172  58%  639 aa  AMYG_ASPSH RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
   38::626     e-171  58%  640 aa  AMYG_ASPNG RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
   38::626     e-171  58%  640 aa  AMYG_ASPAW RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
   38::625     e-161  59%  639 aa  AMYG_ASPKA RecName: Full=Glucoamylase I;       
   80::611     e-159  53%  626 aa  AMYG_NEUCR RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
   42::593     e-149  50%  616 aa  AMYG_HORRE RecName: Full=Glucoamylase P;       
   42::446     2e-68  38%  450 aa  AMYG_SCHPO RecName: Full=Probable glucoamylase;       
  185::611     5e-68  37%  624 aa  AMYG_ARXAD RecName: Full=Glucoamylase;         EC=3.2.1.3;AltName:
  193::594     2e-64  38%  604 aa  AMYG_RHIOR RecName: Full=Glucoamylase 1;         Short=Gluc 1;     
   56::515     3e-59  37%  519 aa  AMYH_SACFI RecName: Full=Glucoamylase GLA1;       
   56::515     7e-58  36%  519 aa  AMYG_SACFI RecName: Full=Glucoamylase GLU1;       
   92::546     2e-49  35%  549 aa  AMYG_YEAST RecName: Full=Glucoamylase, intracellular
  350::693     6e-42  39%  768 aa  AMYI_YEAST RecName: Full=Glucoamylase S2;       
  349::692     6e-42  39%  767 aa  AMYH_YEAST RecName: Full=Glucoamylase S1;       
  478::556     5e-15  44%  569 aa  AMY_STRVL RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
  474::548     6e-15  47%  566 aa  AMY_STRLM RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
  474::548     6e-15  47%  566 aa  AMY_STRGR RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
  595::681     1e-14  38%  692 aa  CDGT_BREBE RecName: Full=Cyclomaltodextrin glucanotransferase;     
  612::700     4e-14  37%  711 aa  CDGT_BACST RecName: Full=Cyclomaltodextrin glucanotransferase;     
  606::692     1e-13  38%  703 aa  CDGT_BACS2 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  606::692     6e-13  34%  704 aa  CDGT_BACOH RecName: Full=Cyclomaltodextrin glucanotransferase;     
  506::570     2e-11  42%  605 aa  AMY_THECU RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
  456::538     4e-11  38%  551 aa  AMYB_THETU RecName: Full=Thermophilic beta-amylase;       
  622::699     2e-10  32%  710 aa  CDGT_THETU RecName: Full=Cyclomaltodextrin glucanotransferase;     
  615::702     2e-10  31%  713 aa  CDGT2_BACCI RecName: Full=Cyclomaltodextrin glucanotransferase;    
  614::699     2e-10  30%  712 aa  CDGT_BACS3 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  615::700     2e-10  30%  713 aa  CDGT_BACS0 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  615::700     3e-10  31%  713 aa  CDGT_BAC11 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  615::702     4e-10  30%  713 aa  CDGT_BACS8 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  615::706     7e-10  33%  719 aa  AMYM_BACST RecName: Full=Maltogenic alpha-amylase;       
  620::706     2e-09  33%  718 aa  CDGT_BACLI RecName: Full=Cyclomaltodextrin glucanotransferase;     
  625::701     4e-09  34%  714 aa  CDGT1_PAEMA RecName: Full=Cyclomaltodextrin glucanotransferase;    
  625::702     1e-08  31%  713 aa  CDGT2_PAEMA RecName: Full=Cyclomaltodextrin glucanotransferase;    
  630::706     4e-08  30%  718 aa  CDGT1_BACCI RecName: Full=Cyclomaltodextrin glucanotransferase;    
  630::706     9e-08  30%  718 aa  CDGT_BACSS RecName: Full=Cyclomaltodextrin glucanotransferase;     
   72::155     1e-06  25% 1196 aa  PWD_ARATH RecName: Full=Phosphoglucan, water dikinase,
  574::643     2e-06  25%  655 aa  CDGT_KLEOX RecName: Full=Cyclomaltodextrin glucanotransferase;     
  463::537     2e-05  29%  548 aa  AMT4_PSEST RecName: Full=Glucan 1,4-alpha-maltotetraohydrolase;    
  466::528     1e-04  32%  551 aa  AMT4_PSESA RecName: Full=Glucan 1,4-alpha-maltotetraohydrolase;    
   86::157     3e-04  31% 1206 aa  PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase,
   20::102     6e-04  35%  331 aa  EPM2A_CANFA RecName: Full=Laforin;         EC=3.1.3.48;       
    1::628

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYALQSILDNIGDDGAKVQGAHAGIVVA
AMYG_ASPOR      -------------------------------------------FSRQAILNNIGADGQSAQGASPGVVIA
AMYG_ASPSH      --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
AMYG_ASPNG      --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
AMYG_ASPAW      --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
AMYG_ASPKA      --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
AMYG_NEUCR      ----------------------------------------------------------------------
AMYG_HORRE      --------------------------------------------ALQGALNNIGPDXXXXXXXXXXXXXX
AMYG_SCHPO      --------------------------------------------AMGHMLNNIGDSGMHAKDINPGCIIA
AMYG_ARXAD      -----------------------------------------------------------IPGAAPGTVIA
AMYG_RHIOR      -------------------------------------------------------------GSATGFIAA
AMYH_SACFI      --------------------------------------------SLYYLLQNIAYPEGQFNDGVPGTVIA
AMYG_SACFI      --------------------------------------------SLYYLLQNIAYPEGQFNNGVPGTVIA
AMYG_YEAST      --------------------------------------------SIEKIFENIGPS-AVYPSISPGVVIA
AMYI_YEAST      --------------------------------------------SIERIFENIGPS-AVYPSILPGVVIA
AMYH_YEAST      --------------------------------------------SIERIFENIGPS-AVYPSILPGVVIA
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
AMYG_ASPOR      SPSKSDPDYFYTWTRDSGLVMKTLVDLFRGGDADLLPIIEEFISSQARIQGISNPSGALSSGGLGEPKFN
AMYG_ASPSH      SPSTDNPDYFYTWTRDSGIVLKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
AMYG_ASPNG      SPSTDNPDYFYTWTRDSGLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGGLGEPKFN
AMYG_ASPAW      SPSTDNPDYFYTWTRDSGLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGGLGEPKFN
AMYG_ASPKA      SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
AMYG_NEUCR      ------PDYWYTWTRDAALVTKLIVDEFTNDNTTLQNTIQAYAAAQAKLQGVSNPSGSLSNGGLGEPKFM
AMYG_HORRE      XXXKANPDYFYTWSRDSALTLKMIIDEFILGNTTLQTIIEQYIHAQAVLQTVSNPSGTLPDGGLGEPKFM
AMYG_SCHPO      SPSTDSPDYYYQWVRDSALTIMTILDRFFEGDKGLEPIIVKYMDEMVRLQKVPNPSGDFYAGGLGEPKFN
AMYG_ARXAD      AQSYSEPDYAYTWVRDASLVMDVVNRLYSSAKSEEKRQLYEKILFQYAKAGAQEQNDPTAISGMGEPKFY
AMYG_RHIOR      SLSTAGPDYYYAWTRDAALTSNVIVYEYLSGNKTILNVLKDYVTFSVKTQSTSTVCNCL-----GEPKFN
AMYH_SACFI      SPSTSNPDYYYQWTRDSAITFLTVLSELEDNNFNTTKAVEYYINTSYNLQRTSNPSGSFDDEGLGEPKFN
AMYG_SACFI      SPSTSNPDYYYQWTRDSAITFLTVLSELEDNNFNTTKAVEYYINTSYNLQRTSNPSGSFDDEGLGEPKFN
AMYG_YEAST      SPSQTHPDYFYQWIRDSALTINSIV-SHSAG--PAIETLLQYLNVSFHLQRSNNTLGTNDTVALGDPKWN
AMYI_YEAST      SPSQTHPDYFYQWIRDSALTINSIV------SHSADPAIEQYLNVSFHLQRTNNTLGTNDTVALGDPKWN
AMYH_YEAST      SPSQTHPDYFYQWIRDSALTINSIV------SHSADPAIEQYLNVSFHLQRTNNTLGTNDTVALGDPKWN
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
AMYG_ASPOR      VDETAFTGAWGRPQRDGPALRATAMISFGEWLVENGHTSIATDLVWPVVRNDLSYVAQYWSQSGFDLWEE
AMYG_ASPSH      VDETAYAGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
AMYG_ASPNG      VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEE
AMYG_ASPAW      VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEE
AMYG_ASPKA      VDETAYTGSWGRPQRDGPALRATAMIGFGQVLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
AMYG_NEUCR      VDLQQFTGAWGRPQRDGPPLRAIALIGYGKWLVSNGYADTAKSIIWPIVKNDLAYTAQYWNNTGFDLWEE
AMYG_HORRE      VDGTRFNGPWGRPQRDGPALRAIALMTYSNWLIKNGQFAEAKTKIWPIIANDLSYVGQYWNQSGFDLWEE
AMYG_SCHPO      VDGTSYDGDWGRPQNDSPALRAIAFIKYMNYLFENGKEVHEVTVWIEAVLADLDYTANHWTEASFDLWEE
AMYG_ARXAD      LNNTAFTGSWGRPQNDGPATRAITLIEFANAYLANGREQLYDSDKYPQVKKDLQFVASNWSSPSFDLWEE
AMYG_RHIOR      PDASGYTGAWGRPQNDGPAERATTFILFASYLTQTKDASYVTGTLKPAIFKDLDYVVNVWSNGCFDLWEE
AMYH_SACFI      TDGSAYTGAWGRPQNDGPALRAYAISRYGKLVLTDSGDSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEE
AMYG_SACFI      TDGSAYTGAWGRPQNDGPALRAYAISRYGKLVLTDSGDSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEE
AMYG_YEAST      VDNTAFTEDWGRPQNDGPALRSIAILKIIDYIKQSGTDLGAKDIFDDIVRWDLRFIIDHWNSSGFDLWEE
AMYI_YEAST      VDNTAFTEPWGRPQNDGPALRSIAILKIIDYIKQSGTDLGAKDIFDDIVRWDLRFIIDHWNSSGFDLWEE
AMYH_YEAST      VDNTAFTEPWGRPQNDGPALRSIAILKIIDYIKQSGTDLGAKDIFDDIVRWDLRFIIDHWNSSGFDLWEE
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
AMYG_ASPOR      VQGTSFFTVAVSHRALVEGSSFAKTVGSSCPYCDSQAPQVRCYLQSFWTGSYIQANFGGGRSGKDINTVL
AMYG_ASPSH      VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
AMYG_ASPNG      VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPEILCYLQSFWTGSFILANFDSSRSGKDANTLL
AMYG_ASPAW      VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPEILCYLQSFWTGSFILANFDSSRSGKDANTLL
AMYG_ASPKA      VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSRRSGKDTNTLL
AMYG_NEUCR      VNSSSFFTIAASHRALVEGSAFAKSVGSSCSACDAIAPQILCFQQSFWSNSGIISNFVNYRSGKDINSVL
AMYG_HORRE      TYASSFFTIQNQHRALVEGAQLAHDLGVTCTGCD-QAPEVLCFLQSFWNGKYIVSNINNGRTGLDGNSIL
AMYG_SCHPO      IKDVHYFTLAVQKRAMQDGTAFAKRIGAQAALYQRTIEPIDLKLGEFWPGMGVIKGYKGDRSGLDCSTLL
AMYG_ARXAD      EESAHFYTRLVQRKALLLGADFANDMGDHSDKLKTQASKLSDTLPEFWDSARILYEYGGKYSYKDISVVL
AMYG_RHIOR      VNGVHFYTLMVMRKGLLLGADFAKRNGDXXXXXXXXXXXXXXXISSFWVSSNQSVTGGVSKKGLDVSTLL
AMYH_SACFI      NQGRHFFTSLVQQKALAYAVDIAKSF--DDGDFANTLSSTASTLESYLSGSHIVENQQNSRQGLDSATYI
AMYG_SACFI      NQGRHFFTSLVQQKALAYAVDIAKSF--DDGDFANTLSSTASTLESYLSGSHIVENQQNSRQGLDSATYI
AMYG_YEAST      VNGMHFFTLLVQLSAVDKSLSYFNASERSSPFVEQTRRDISKFLYNYIVGTPMIAD--TLRSGLDISTLL
AMYI_YEAST      VNGMHFFTLLVQLSAVDRSLSYFNASERSSPFVEQTRRDISKFLNGFINGKNYIVEADTLRSGLDISTLL
AMYH_YEAST      VNGMHFFTLLVQLSAVDRSLSYFNASERSSPFVEQTRRDISKFLNGFINGKNYIVEADTLRSGLDISTLL
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
AMYG_ASPOR      GSIHTFDPQATCDDATFQPCSARALANHKVVTDSFRSIYAINSGRAENQAVAVGRYPEDSYYNGNPWFLT
AMYG_ASPSH      GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
AMYG_ASPNG      GSIHTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYNGNPWFLC
AMYG_ASPAW      GSIHTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYNGNPWFLC
AMYG_ASPKA      GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFQS
AMYG_NEUCR      TSIHNFDPAAGCDVNTFQPCSDRALANHKVVVDSMR-FWGVNSGRTAGKAAAVGRYAEDVYYNGNPWYLA
AMYG_HORRE      GAISTFDIDAYCDSPTLQPCHSQSLANFKVLTDTFRNLYTINAGIPEGQGVAVGRYAEDVYMGGNPWYLI
AMYG_SCHPO      ASLYS---------NEF---DMHILPTLLKLQETMTRDYPVNQGWK----QAMGRYPEDVYDGGNPWFIC
AMYG_ARXAD      GVMHGY-----ANDNVFSYTNDQILATAYQVSTSFLDVYKVANTTSDESGIPVGRYPEDVYDGGNPWYLT
AMYG_RHIOR      AA-----NLGSVDDGFFTPGSEKILATAVAVEDSFASLYPINKNLPSYLGNSIGRYPEDTYNGGNSWFLA
AMYH_SACFI      GPLLTHD-IGESSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAYSA--GAAIGRYPEDVYNGGNPWFLA
AMYG_SACFI      GPLLTHD-IGESSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAYSA--GAAIGRYPEDVYNGGNPWFLA
AMYG_YEAST      NTVHDAPSASHLPFDINDPAVLNTL-HHLML--HMRSIYPINDSSKNATGIALGRYPEDVYDGGNPWVLA
AMYI_YEAST      NTVHDAPSASHLPFDIDDPAVLNTL-HHLML--HMRSIYPINDSSKNATGIALGRYPEDVYDGGNPWVLA
AMYH_YEAST      NTVHDAPSASHLPFDINDPAVLNTL-HHLML--HMRSIYPINDSSKNATGIALGRYPEDVYDGGNPWVLA
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
AMYG_ASPOR      TLAAAEQLYDALYQWDKIGSLAITDVSLPFFKXXXXXXXXXXXXXXXXVYKDIVSAVKAYADGYVQIVQT
AMYG_ASPSH      TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIVSAVKTFADGFVSIVET
AMYG_ASPNG      TLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGXXXXXXXXXXXIVDAVKTFADGFVSIVET
AMYG_ASPAW      TLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGXXXXXXXXXXXIVDAVKTFADGFVSIVET
AMYG_ASPKA      TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALXXXXXXXXXXXXXXXXXXIVSAVKTFADGFVSIVET
AMYG_NEUCR      TLAAAEQLYDAVYVWKKQGSITVTSTSLAFFKDLVPXXXXXXXXXXXXXXXAIINAVTTYADGFVDIVAQ
AMYG_HORRE      TTAAAEFLYDAVAQWKARHVLTVDETSLAFFKDIYPEVTVREYKSANSPFAQIMDAVTAYADSYVAIAEK
AMYG_SCHPO      TSSXXXXXXXXXXXXDNKGLPELTEYNIHFFM---KFAEFGDPYN----WSVIRKNMHTYADNFLKAVAE
AMYG_ARXAD      TMAMAEFLYRSVQEFEDAGSIIISDTSLPFFASSVDHKAGAKYNKNDQSFKTSLKSLTGWGDAFMRRAKY
AMYG_RHIOR      VTGYAELYYRAIKEWIGNGGVTVSSISLPFFKKFDSSATSGKYTVGTSDFNNLAQNIALAADRFLSTVQL
AMYH_SACFI      TAYAAQVPYKLVYDKSASNDITINKINYDFFNSGYQSSDSVTIKSGSDEFNTVADNLVTFGDSFLQVILD
AMYG_SACFI      TAYAAQVPYKLAYDKSASNDITINKINYDFFNSAYQSSDSVTIKSGSDEFNTVADNLVTFGDSFLQVILD
AMYG_YEAST      TCTASTTLYQLIYRHQHDLVVPMNNDCSNAFWSELVFSNLTTLGNNTPAFNQTIQKIFQLADSFLVKLKA
AMYI_YEAST      TCAASTTLYQLIYR--------------------------------------------------------
AMYH_YEAST      TCAASTTLYQLIYR--------------------------------------------------------
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
AMYG_ASPOR      YAASTGSMAEQYTKTDGSQTSARDLTWSYXXXXXXXXXXXXVVPAPWGETAATSIPSACSTTSASGTYSS
AMYG_ASPSH      HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPGTCAATSASGTYSSVTVTSXXXXXXX
AMYG_ASPNG      HAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSSVPGTCAATSAIGTYSSVTVTSXXXXXXX
AMYG_ASPAW      HAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSSVPGTCAATSAIGTYSSVTVTSXXXXXXX
AMYG_ASPKA      HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSWPGTCAATSASGTYSS
AMYG_NEUCR      YTPSDGSLAEQFDKDSGAPLSATHLTWSYASFLSAAARRAGIVPPSWGAASANSLPGSCSASTVAGSYAT
AMYG_HORRE      YIPSNGSLSEQFNRDTGTPLSAIDLTWSYAAFITMSQRRAGQYPSSWGSRNALXXXXXXXXXXXXGIYTP
AMYG_SCHPO      FQHPNGSMSEQFSRDDGHQKGARDLTWSYSSLLNAIYRREAI----------------------------
AMYG_ARXAD      HTPSSGHMSEEFNRTTGEPRGAKDLTWSYASLLSAAFAREEL----------------------------
AMYG_RHIOR      HAHNNGSLAEEFDRTTGLSTGARDLTWSHASLITA-----------------------------------
AMYH_SACFI      HINDDGSLNEQLNRNTGYSTSAYSLTWSSGALLEAIRLRNKV----------------------------
AMYG_SACFI      HINDDGSLNEQLNRYTGYSTGAYSLTWSSGALLEAIRLRNKV----------------------------
AMYG_YEAST      HVGTDGELSEQFNKYTGFMQGAQHLTWSYTSFWDAYQIRQEVL---------------------------
AMYI_YEAST      ----------------------------------------------------------------------
AMYH_YEAST      ----------------------------------------------------------------------
AMY_STRVL       ----------------------------------------------------------------------
AMY_STRLM       ----------------------------------------------------------------------
AMY_STRGR       ----------------------------------------------------------------------
CDGT_BREBE      ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
CDGT_BACS2      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMY_THECU       ----------------------------------------------------------------------
AMYB_THETU      ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACS3      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
CDGT_BACLI      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
CDGT2_PAEMA     ----------------------------------------------------------------------
CDGT1_BACCI     ----------------------------------------------------------------------
CDGT_BACSS      ----------------------------------------------------------------------
PWD_ARATH       ----------------------------------------------------------------------
CDGT_KLEOX      ----------------------------------------------------------------------
AMT4_PSEST      ----------------------------------------------------------------------
AMT4_PSESA      ----------------------------------------------------------------------
PWD_ORYSJ       ----------------------------------------------------------------------
EPM2A_CANFA     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ATIXXXXXXXXXXXXXXXXXXXXXXSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
AMYG_ASPOR      VVI--TSWPTISGYPGAPDSPCQVPTTVSVTFAVKATTVYGESIKIVGSISQLGSWNPSSATALNADSYT
AMYG_ASPSH      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
AMYG_ASPNG      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
AMYG_ASPAW      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
AMYG_ASPKA      VTV----------------------------FDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYT
AMYG_NEUCR      ATATSFPANLTPASTTVTPPTQTGCAAVLVTFNEKVTTSYGQTVKVVGSIAALGNWAPASGVTLSAKQYS
AMYG_HORRE      AT-------------AAGAPNVTSSCQVSITFNINATTYYGENLYVIGNSSDLGAWNIADAYPLSASAYT
AMYG_SCHPO      ----------------------------------------------------------------------
AMYG_ARXAD      ----------------------------------------------------------------------
AMYG_RHIOR      ----------------------------------------------------------------------
AMYH_SACFI      ----------------------------------------------------------------------
AMYG_SACFI      ----------------------------------------------------------------------
AMYG_YEAST      ----------------------------------------------------------------------
AMYI_YEAST      ----------------------------------------------------------------------
AMYH_YEAST      ----------------------------------------------------------------------
AMY_STRVL       -------------------------------FNVTATTVVGQNIYVTGNRAELGNWAPASALKLDPATY-
AMY_STRLM       ------------------------------SFHVNATTAWGENIYVTGDQAALGNWDP--ARALKLDP--
AMY_STRGR       ------------------------------SFHVNATTAWGENIYVTGDQAALGNWDP--ARALKLDP--
CDGT_BREBE      --------------------------SVRFAVNNAT-TNSGTNVYIVGNVSELGNWDPNKAIGPMFNQVM
CDGT_BACST      --------------------------SVRFVVNNAT-TNLGQNIYIVGNVYELGNWDTSKAIGPMFNQVV
CDGT_BACS2      --------------------------SVRFGVNNAT-TSPGTNLYIVGNVNELGNWDADKAIGPMFNQVM
CDGT_BACOH      --------------------------SIRFAVNNAT-TSLGTNLYMVGNVNELGNWDPDQAIGPMFNQVM
AMY_THECU       ---------------------------VTARFHATVTTWYGQEVAVVGSIPELGSWQPAQGVRLRTD--S
AMYB_THETU      ---------------------------VTFTINNAT-TYYGQNVYIVGSTSDLGNWNTTYARG------P
CDGT_THETU      -------------------------------------TVYGENVYLTGNVAELGNWDTSKAIGPMFNQVV
CDGT2_BACCI     --------------------------SVRFVVNNAT-TALGQNVYLTGSVSELGNWDPAKAIGPMYNQVV
CDGT_BACS3      --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
CDGT_BACS0      --------------------------TVRFVINNAT-TALGQNVFLTGNVSELGNWDPNNAIGPMYNQVV
CDGT_BAC11      --------------------------SVRFVVNNAT-TALGQNVYLAGSVSELGNWDPAKAIGPLYNQVI
CDGT_BACS8      --------------------------SVRFVVNNAT-TALGQNLYLTGNVSELGNWDPAKAIGPMYNQVV
AMYM_BACST      -------------------------TSVVFTVKSAPPTNLGDKIYLTGNIPELGNWSSGAVNNAQGPLLA
CDGT_BACLI      --------------------------SVRFVINNAT-TALGENIYLTGNVSELGNWTTGAASIGPANQVI
CDGT1_PAEMA     ------------------------------------NTNYGTNVYLVGNAAELGSWDPNKAIGPMYNQVI
CDGT2_PAEMA     -------------------------------------TALGQNVYLTGNVAELGNWTAANAIGPMYNQVE
CDGT1_BACCI     -------------------------------------TTLGQNLYLTGNVAELGNWSTSTAIGPAFNQVI
CDGT_BACSS      -------------------------------------TTLGQNIYLTGNVAELGNWSTSTAIGPAFNQVI
PWD_ARATH       -------------------------TKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENG--
CDGT_KLEOX      ----------------------------------------GQSVYIIGNIPQLGGWDLTKAVKISPTQY-
AMT4_PSEST      -------------------------------------TQMGDSVYAVGNVSQLGNWSPAAALRLTD---T
AMT4_PSESA      -------------------------------------TQMGDSVYAVGNVSQLGNWSPASAVRLTD---T
PWD_ORYSJ       --------------------------------------KFGEHVGIIGSTKELGSWEEQV-------ELE
EPM2A_CANFA     -------------------------------------------LLVVGSRPELGRWEPRGAVRLRPXXXX


                         .         .         .         *         .         .         .:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNxxxxxxxxxxxxxxxxxxxxxx
AMYG_ASPOR      TDNPLWTGTINLPAGQSFEYKFIR-VQNGAVTWESDPNRKYTVP------------------------
AMYG_ASPSH      SSNPPWYVTVTLPAGESFEYKFIRVESDDSVEWESDPNREYTVPQ-----------------------
AMYG_ASPNG      SSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQ-----------------------
AMYG_ASPAW      SSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQ-----------------------
AMYG_ASPKA      SSNPLWYVTVTLPAGESFEYKFIRVESDDSVEWESDPNREYTVPQ-----------------------
AMYG_NEUCR      SSNPLWSTTIALPQGTSFKYKYVVVNSDGSVKWENDPDRSYAV-------------------------
AMYG_HORRE      QDRPLWSAAIPLNAGEVISYQYVRQEDCDQPYIYETVNRTLTVP------------------------
AMYG_SCHPO      --------------------------------------------------------------------
AMYG_ARXAD      --------------------------------------------------------------------
AMYG_RHIOR      --------------------------------------------------------------------
AMYH_SACFI      --------------------------------------------------------------------
AMYG_SACFI      --------------------------------------------------------------------
AMYG_YEAST      --------------------------------------------------------------------
AMYI_YEAST      --------------------------------------------------------------------
AMYH_YEAST      --------------------------------------------------------------------
AMY_STRVL       ---PVWKLTVGLPAGTSFEYKYIRKDAAGNVTWESGANRTATVP------------------------
AMY_STRLM       AAYPVWKLDVPLAAGTPFQYKYLRKDAAGKAVWESGANR-----------------------------
AMY_STRGR       AAYPVWKLDVPLAAGTPFQYKYLRKDAAGKAVWESGANR-----------------------------
CDGT_BREBE      YKYPTWYYDISVPAGKNLEYKYIKKDHNGNVTWQSGNNRTYTSP------------------------
CDGT_BACST      YSYPTWYIDVSVPEGKTIEFKFIKKDSQGNVTWESGSNHVYTTPTN----------------------
CDGT_BACS2      YQYPTWYYDISVPAGKNLEYKYIKKDQNGNVVWQSGNNRTYTSP------------------------
CDGT_BACOH      YQYPTWYYDISVPAEENLEYKFIKKDSSGNVVWESGNNHTYTTP------------------------
AMY_THECU       GTYPVWSGAVDLPAGVGFEYKYVK--------------------------------------------
AMYB_THETU      ASCPTWTITLNLLPGEQIQFKAVKIDSSGNVTWEGGSNHTYTVP------------------------
CDGT_THETU      YQYPTWYYDVSVPAGTTIQFKFIKKNGN-TITWEGGSNHTYTVPSS----------------------
CDGT2_BACCI     YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
CDGT_BACS3      YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
CDGT_BACS0      YQYPTWYYDVSVPAGQTIEFKFLKK-QGSTVTWEGGANRTFTTP------------------------
CDGT_BAC11      YQYPTWYYDVTVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAP------------------------
CDGT_BACS8      YQYPNWYYDVSVPAGKTIEFKFLKK-QGSTVTWEGGSNHTFTAPSS----------------------
AMYM_BACST      PNYPDWFYVFSVPAGKTIQFKFFIKRADGTIQWENGSNHVATTP------------------------
CDGT_BACLI      HAYPTWYYDVSVPAGKQLEFKFFKK-NGATITWEGGSNHTFTTP------------------------
CDGT1_PAEMA     AKYPSWYYDVSVPAGTKLDFKFIKK-XXXXXXXXXXXNHTYTTP------------------------
CDGT2_PAEMA     ASYPTWYFDVSVPANTALQFKFI-KVNGSTVTWEGGNNHTFTSPSS----------------------
CDGT1_BACCI     HQYPTWYYDVSVPAGKQLEFKFFKK-NGSTITWESGSNHTFTTP------------------------
CDGT_BACSS      HQYPTWYYDVSVPAGKELEFKFFKK-NGSTITWEGGSNHKFTTP------------------------
PWD_ARATH       -----WVCELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNS----------------------
CDGT_KLEOX      ---PQWSASLELPSDLNVEWKCVKRNETANVEWQSGANNQF---------------------------
AMT4_PSEST      SGYPTWKGSIALPAGQNEEWKCLIRNEANATQWQGGANNSLT--------------------------
AMT4_PSESA      SSYPTWKGSIALPDGQNVEWKLIRNEADATLV------------------------------------
PWD_ORYSJ       WTTNGWVCQLKLPGETLVEFKFVIFLVGGKKIWEDGNNRVVELPKD----------------------
EPM2A_CANFA     XXXXLWLGEVELAPGETFWYKFLKREPGGALSWEGN--------------------------------