[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01675

[Show Plain Result]


## Summary of Sequence Search
    1::270
   48::144     7e-18  43%  174 aa  YEMB_SCHPO RecName: Full=UPF0664 stress-induced protein C29B12.11c;
   37::125     8e-06  32%  359 aa  WBP2L_MOUSE RecName: Full=Postacrosomal sheath WW domain-binding
   36::125     4e-05  30%  313 aa  WBP2L_BOVIN RecName: Full=Postacrosomal sheath WW domain-binding
   45::143     9e-05  33%  261 aa  WBP2_MOUSE RecName: Full=WW domain-binding protein 2;       
   45::133     4e-04  33%  261 aa  WBP2_HUMAN RecName: Full=WW domain-binding protein 2;       
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRPGDESLSLQSS
YEMB_SCHPO      ---------------------------------------------------------------------T
WBP2L_MOUSE     -----------------------------------------------------------PPGSNLFSGTK
WBP2L_BOVIN     ----------------------------------------------------------KPVESYLFNGTK
WBP2_MOUSE      --------------------------------------------------------------------TK
WBP2_HUMAN      --------------------------------------------------------------------TK


                         .         .         *         .         .         .         .:140
query           NGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKM
YEMB_SCHPO      KGLLCLTNQRLVYIAKDTDCDFKDFQSPVANLKDTKLNQPFFGANYYSGTVMPVPNGGIP---CEAEVKL
WBP2L_MOUSE     RGALFLTSYRVIFVTSRADPMF-SFTMPFHLMNNCTVEQPIFGANYIKGTIQAAPDGGWEGSAT---FKI
WBP2L_BOVIN     KGTLFLTSYRVVFVTSHVNDPMLSFMMPFGLMSDCTIEQPIFAPNYIKGTIQAAPGGGW--EGQAV-FKL
WBP2_MOUSE      KGTVYLTPYRVIFLS-KGKDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVK---XXXXXXXXXXXXYKL
WBP2_HUMAN      KGTVYLTPYRVIFLS-KGKDAMQSFMMPFYLMKDCEIKQPVFGANY---IKGTVKXXXXXXXXXXXXYKL


                         +         .         .         .         .         *         .:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISERSSQRDGAYxxxxxxxxxxxxxxxxxxxxxxxxx
YEMB_SCHPO      QFNEGGIFNFVEAWNRLIQRFQEVDSVSR-----------------------------------------
WBP2L_MOUSE     VFRKGGAIDF------------------------------------------------------------
WBP2L_BOVIN     SFRKGGAIEF------------------------------------------------------------
WBP2_MOUSE      TFTAGGAIEF-------GQRMLQVASQA-------SRGEVPNGAY-------------------------
WBP2_HUMAN      TFTAGGAIEF-------GQRMLQVASQA------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YEMB_SCHPO      ------------------------------------------------------------
WBP2L_MOUSE     ------------------------------------------------------------
WBP2L_BOVIN     ------------------------------------------------------------
WBP2_MOUSE      ------------------------------------------------------------
WBP2_HUMAN      ------------------------------------------------------------