[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01687

[Show Plain Result]


## Summary of Sequence Search
    1::385
   14::302     3e-18  33%  316 aa  APD1_YEAST RecName: Full=Actin patches distal protein 1;
  211::307     8e-05  33%  311 aa  YMF0_YEAST RecName: Full=Uncharacterized protein YML050W;
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxEATSVPATGKPAVASKVITAQSPSTLFTVVDPTVDGEDCDHDCA
APD1_YEAST      --------------------------EASQLSAKGREEISQSIKICKS--------DDAANEHSCSGDCK
YMF0_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SCTIKYPAKFSVDYEDELYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIERGGVSAKNGALKLSAS
APD1_YEAST      TEIEEGEAKLKIEHETPLLNSSKTPKIHFVVPTSQIDWQHDACEDPKSVQYKISQW--CDKNSALNCAVS
YMF0_YEAST      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NIPVPDEYYHHPEGEQPTTVLLLPAFTIIDHVTPALVPNLIRQFVDLSPTTTTPLSDVMQIAGQEEPTEQ
APD1_YEAST      SLPKDIMDIDVMRGTK-NNVLILPYFIWLNDLRSD----------DVEATLDGLVPDLL-----------
YMF0_YEAST      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TPSDINIPERPPLDLKDLSESLPTSLRSRPCSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLY
APD1_YEAST      ---DENISR------EKLLETRPNVAVAR---ERAFVFICSHTTRDKRCGITAPYLKKVFDSKLQEHGLY
YMF0_YEAST      -------------------------------------LVCGHYKRDAKCGEMGPDIIAAFQDE-------


                         .         *         .         .         .         .         +:350
query           RDLHDERPGGVGIYFISHVGGHKYSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGASQGIWLARVRPE
APD1_YEAST      RDNSDYRAEGVKIAFVNHVGGHKFAANVQIYLR---------------NPNTL--------IWLGRVTPT
YMF0_YEAST      -KLFPEN----NLALISHIGGHIFAGNVIFYK-------LFGREKMQNKLDS---------LWFGKVYPH


                         .         .         .         .         *         .         .:420
query           DCEGIVKFTVLQGKVVKPGLQLRGGxxxxxxxxxx
APD1_YEAST      IVPSIVEHLIVPEEPTLP-----------------
YMF0_YEAST      NLKLLCE-NLENGKIIDE--MYRGG----------