[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_01746

[Show Plain Result]


## Summary of Sequence Search
    1::195
    9::163     6e-12  32%  167 aa  CID2_SCHPO RecName: Full=Caffeine-induced death protein 2;
   38::178     2e-08  30%  196 aa  YBK7_YEAST RecName: Full=Uncharacterized protein YBL107C;
  354::503     6e-04  26%  520 aa  VG29_HAEIN RecName: Full=Mu-like prophage FluMu protein gp29;
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxFCFNQRALRDFLRISRSTIDDSITQNLNALVTPARKGFDPASTTARQTDFANKTQI
CID2_SCHPO      ---------------CMNIRYLKNVLRKARK-IDDTIQLSLNSAKWEYPEGK------------VHETQ-
YBK7_YEAST      ---------------CVDPSLIDSFLRFLRHGSDDIIRQKLNNY----RKG-----------------SI
VG29_HAEIN      --------------YALNCKSFNDARRIPRFEFDVAESEDLNAFADGLNKLVDIGFRIPKQWAHDKQVPI


                         .         .         *         .         .         .         .:140
query           DPENCEIFKNKVLFPSWQVRSDVLNYCAGVATSPDPEDPDLVLRQVESAKDRERLVDERLDPYSARFFPR
CID2_SCHPO      -EERCQNVKKK-LFEGWLSRDQFLKECQTIVRSQLDQDRNTXXXXXXXXXXXXXXVSERLDPYAKEVQVQ
YBK7_YEAST      NGKNCKEFLKQELYPNWQIRNNIISFCEKEAAEMKNETDQQCGNNKKTT--AEPLIDARIDPYXXXXXXX
VG29_HAEIN      ATENEEVLAKSFQNPTAYMHSKADGKMAVLSVQPDPE--DLLDNLEPTAEDYQAVIDPLLKPVALQKGGY


                         +         .         .         .         .         *         .:210
query           EARTESLAMLIRNERGVETIIRSRTWGMVTERCGNSFEGWEDxxxxxxxxxxxxx
CID2_SCHPO      LSPPEEVQIVLQSELSVEQIIRDQTWEVLTNACPGMFKDWRD-------------
YBK7_YEAST      XXXXTKVTEWVANNRKIEQILTSTTEGILRQNC----------------------
VG29_HAEIN      EFAQEKLAILYMNDEELETLL----------------------------------