[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02126

[Show Plain Result]


## Summary of Sequence Search
    1::598
   39::213     9e-29  45%  278 aa  PMP1_SCHPO RecName: Full=Tyrosine-protein phosphatase pmp1;        
  421::583     8e-20  42%  597 aa  PTPX_CANAL RecName: Full=Probable tyrosine-protein phosphatase;    
  186::398     4e-19  36%  489 aa  MSG5_YEAST RecName: Full=Tyrosine-protein phosphatase MSG5;        
   54::94      9e-16  41%  209 aa  SDP1_YEAST RecName: Full=Dual-specificity protein phosphatase SDP1;
  259::345     2e-12  41%  384 aa  DUS9_HUMAN RecName: Full=Dual specificity protein phosphatase 9;   
  222::359     1e-10  29%  384 aa  DUS5_HUMAN RecName: Full=Dual specificity protein phosphatase 5;   
  204::361     1e-10  29%  375 aa  DUS4_CHICK RecName: Full=Dual specificity protein phosphatase 4;   
  201::312     2e-10  34%  367 aa  DUS1_HUMAN RecName: Full=Dual specificity protein phosphatase 1;   
  202::307     2e-10  33%  665 aa  DUS16_HUMAN RecName: Full=Dual specificity protein phosphatase 16; 
  267::345     2e-10  33%  476 aa  DUSPR_DICDI RecName: Full=Probable rhodanese domain-containing dual
  201::312     2e-10  34%  367 aa  DUS1_RAT RecName: Full=Dual specificity protein phosphatase 1;     
  201::312     2e-10  34%  367 aa  DUS1_MOUSE RecName: Full=Dual specificity protein phosphatase 1;   
  402::470     2e-10  43%  483 aa  DUS10_MOUSE RecName: Full=Dual specificity protein phosphatase 10; 
  401::469     2e-10  43%  482 aa  DUS10_HUMAN RecName: Full=Dual specificity protein phosphatase 10; 
  401::469     2e-10  43%  482 aa  DUS10_BOVIN RecName: Full=Dual specificity protein phosphatase 10; 
  249::343     5e-10  38%  381 aa  DUS6_RAT RecName: Full=Dual specificity protein phosphatase 6;     
  249::343     5e-10  38%  381 aa  DUS6_MOUSE RecName: Full=Dual specificity protein phosphatase 6;   
  249::343     5e-10  38%  381 aa  DUS6_HUMAN RecName: Full=Dual specificity protein phosphatase 6;   
  249::343     5e-10  38%  381 aa  DUS6_BOVIN RecName: Full=Dual specificity protein phosphatase 6;   
  224::381     5e-10  29%  395 aa  DUS4_RAT RecName: Full=Dual specificity protein phosphatase 4;     
  227::384     5e-10  29%  398 aa  DUS4_MOUSE RecName: Full=Dual specificity protein phosphatase 4;   
  161::242     7e-10  40%  280 aa  DUS7_RAT RecName: Full=Dual specificity protein phosphatase 7;     
  249::330     7e-10  40%  368 aa  DUS7_MOUSE RecName: Full=Dual specificity protein phosphatase 7;   
  249::330     7e-10  40%  368 aa  DUS7_HUMAN RecName: Full=Dual specificity protein phosphatase 7;   
   45::131     7e-10  32%  142 aa  123R_IIV6 RecName: Full=Putative tyrosine phosphatase 123R;        
  223::334     9e-10  35%  394 aa  DUS4_HUMAN RecName: Full=Dual specificity protein phosphatase 4;   
  203::329     2e-09  32%  657 aa  VHP1_CAEEL RecName: Full=Tyrosine-protein phosphatase vhp-1;       
   58::140     4e-09  47%  165 aa  PTPH_AMEPV RecName: Full=Putative tyrosine-protein phosphatase
  248::311     6e-09  39%  314 aa  DUS2_HUMAN RecName: Full=Dual specificity protein phosphatase 2;   
  247::315     1e-08  38%  318 aa  DUS2_MOUSE RecName: Full=Dual specificity protein phosphatase 2;   
   89::170     3e-08  33%  223 aa  STYX_MOUSE RecName: Full=Serine/threonine/tyrosine-interacting
   89::170     3e-08  36%  223 aa  STYXA_XENLA RecName: Full=Serine/threonine/tyrosine-interacting
  222::317     3e-08  31%  384 aa  DUS5_RAT RecName: Full=Dual specificity protein phosphatase 5;     
   89::170     4e-08  33%  223 aa  STYX_PONAB RecName: Full=Serine/threonine/tyrosine-interacting
   89::170     4e-08  33%  223 aa  STYX_HUMAN RecName: Full=Serine/threonine/tyrosine-interacting
  448::518     4e-08  41% 1045 aa  SSH_DROME RecName: Full=Protein phosphatase Slingshot;       
  385::458     4e-08  41% 1423 aa  SSH2_MOUSE RecName: Full=Protein phosphatase Slingshot homolog 2;  
  385::458     4e-08  41% 1423 aa  SSH2_HUMAN RecName: Full=Protein phosphatase Slingshot homolog 2;  
  205::301     5e-08  31%  625 aa  DUS8_HUMAN RecName: Full=Dual specificity protein phosphatase 8;   
  112::188     7e-08  38%  212 aa  PTPH_MIMIV RecName: Full=Putative tyrosine-protein phosphatase
  205::301     7e-08  29%  663 aa  DUS8_MOUSE RecName: Full=Dual specificity protein phosphatase 8;   
  104::170     9e-08  37%  223 aa  STYXB_XENLA RecName: Full=Serine/threonine/tyrosine-interacting
   64::167     9e-08  35%  198 aa  DUS14_MOUSE RecName: Full=Dual specificity protein phosphatase 14; 
  372::431     1e-07  45%  691 aa  SSH_XENLA RecName: Full=Protein phosphatase Slingshot homolog;     
   64::167     3e-07  34%  198 aa  DUS14_HUMAN RecName: Full=Dual specificity protein phosphatase 14; 
   64::167     3e-07  34%  198 aa  DUS14_BOVIN RecName: Full=Dual specificity protein phosphatase 14; 
  379::467     4e-07  38% 1049 aa  SSH1_HUMAN RecName: Full=Protein phosphatase Slingshot homolog 1;  
  122::184     6e-07  41%  188 aa  MDSP_HUMAN RecName: Full=Dual specificity protein phosphatase 13
  379::466     7e-07  37% 1042 aa  SSH1_MOUSE RecName: Full=Protein phosphatase Slingshot homolog 1;  
   67::167     7e-07  32%  190 aa  DUS21_HUMAN RecName: Full=Dual specificity protein phosphatase 21; 
  378::461     1e-06  35%  649 aa  SSH3_MOUSE RecName: Full=Protein phosphatase Slingshot homolog 3;  
   76::141     1e-06  38%  275 aa  DUSP3_DICDI RecName: Full=Probable dual specificity protein
   84::178     2e-06  31%  330 aa  PVH1_SCHPO RecName: Full=Tyrosine-protein phosphatase yvh1;        
  129::201     4e-06  35%  217 aa  DUS19_HUMAN RecName: Full=Dual specificity protein phosphatase 19; 
  378::461     6e-06  34%  652 aa  SSH3_RAT RecName: Full=Protein phosphatase Slingshot homolog 3;    
   73::136     6e-06  38%  394 aa  DUSP4_DICDI RecName: Full=Probable dual specificity protein
  128::214     6e-06  33%  220 aa  DUS19_MOUSE RecName: Full=Dual specificity protein phosphatase 19; 
  702::771     8e-06  37%  856 aa  MPL3_DICDI RecName: Full=MAP kinase phosphatase with leucine-rich
  210::306     2e-05  29%  313 aa  STYL1_HUMAN RecName:
  122::168     2e-05  49%  188 aa  MDSP_MOUSE RecName: Full=Dual specificity protein phosphatase
  136::228     2e-05  36%  230 aa  DUSP2_DICDI RecName: Full=Probable dual specificity protein
   65::160     2e-05  34%  204 aa  DUS18_RAT RecName: Full=Dual specificity protein phosphatase 18;   
   53::151     2e-05  35%  294 aa  YO42_CAEEL RecName: Full=Uncharacterized protein ZK757.2;
  626::689     2e-05  42%  695 aa  MPL2_DICDI RecName: Full=MAP kinase phosphatase with leucine-rich
  107::177     2e-05  36%  185 aa  DUS3_PONAB RecName: Full=Dual specificity protein phosphatase 3;   
  107::177     2e-05  36%  185 aa  DUS3_HUMAN RecName: Full=Dual specificity protein phosphatase 3;   
   48::161     2e-05  27%  163 aa  DUS28_MOUSE RecName: Full=Dual specificity phosphatase 28;       
   80::138     2e-05  48%  209 aa  DUS22_XENTR RecName: Full=Dual specificity protein phosphatase 22; 
  120::185     2e-05  36%  210 aa  DUPD1_TAKRU RecName: Full=Dual specificity phosphatase DUPD1;      
  134::231     3e-05  31%  276 aa  PTP3_CHLMO RecName: Full=Dual specificity protein phosphatase;     
   41::110     3e-05  39%  160 aa  PTP2_NPVOP RecName: Full=Tyrosine-protein phosphatase 2;       
  709::774     3e-05  34%  807 aa  PPS1_YEAST RecName: Full=Dual specificity protein phosphatase PPS1;
  765::828     3e-05  41%  834 aa  MPL1_DICDI RecName: Full=MAP kinase phosphatase with leucine-rich
  107::177     4e-05  36%  185 aa  DUS3_MOUSE RecName: Full=Dual specificity protein phosphatase 3;   
   65::160     4e-05  32%  188 aa  DUS18_HUMAN RecName: Full=Dual specificity protein phosphatase 18; 
   80::140     4e-05  39%  183 aa  DS22B_DANRE RecName: Full=Dual specificity protein phosphatase
  381::460     5e-05  33%  659 aa  SSH3_HUMAN RecName: Full=Protein phosphatase Slingshot homolog 3;  
   80::138     5e-05  46%  209 aa  DUS22_XENLA RecName: Full=Dual specificity protein phosphatase 22; 
   92::160     7e-05  40%  402 aa  PTEN_XENLA RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  126::195     7e-05  35%  220 aa  DUPD1_HUMAN RecName: Full=Dual specificity phosphatase DUPD1;      
   80::138     9e-05  46%  184 aa  DUS22_MOUSE RecName: Full=Dual specificity protein phosphatase 22; 
   80::138     9e-05  46%  184 aa  DUS22_HUMAN RecName: Full=Dual specificity protein phosphatase 22; 
   87::145     9e-05  34%  339 aa  DUS12_MOUSE RecName: Full=Dual specificity protein phosphatase 12; 
  117::186     9e-05  33%  209 aa  DUPD1_XENTR RecName: Full=Dual specificity phosphatase DUPD1;      
  122::213     9e-05  36%  214 aa  DUPD1_CHICK RecName: Full=Dual specificity phosphatase DUPD1;      
  134::184     1e-04  45%  203 aa  DUPD1_ORYLA RecName: Full=Dual specificity phosphatase DUPD1;      
   44::129     2e-04  36%  171 aa  DUSP_VACCW RecName: Full=Dual specificity protein phosphatase;     
   44::129     2e-04  36%  171 aa  DUSP_VACCC RecName: Full=Dual specificity protein phosphatase;     
  120::186     2e-04  38%  211 aa  DUPD1_TETNG RecName: Full=Dual specificity phosphatase DUPD1;      
   65::160     2e-04  31%  188 aa  DUS18_PONAB RecName: Full=Dual specificity protein phosphatase 18; 
  126::195     3e-04  33%  222 aa  DUPD1_PIG RecName: Full=Dual specificity phosphatase DUPD1;        
  126::195     3e-04  33%  220 aa  DUPD1_PANTR RecName: Full=Dual specificity phosphatase DUPD1;      
  118::187     3e-04  32%  212 aa  DUPD1_MONDO RecName: Full=Dual specificity phosphatase DUPD1;      
  145::166     3e-04  68%  211 aa  DUS26_BOVIN RecName: Full=Dual specificity protein phosphatase 26; 
   66::160     3e-04  31%  188 aa  DUS18_BOVIN RecName: Full=Dual specificity protein phosphatase 18; 
   87::141     3e-04  36%  339 aa  DUS12_RAT RecName: Full=Dual specificity protein phosphatase 12;   
  117::191     3e-04  34%  209 aa  DUPD1_XENLA RecName: Full=Dual specificity phosphatase DUPD1;      
   48::129     4e-04  38%  171 aa  VH01_RACVI RecName: Full=Dual specificity protein phosphatase;     
   88::142     4e-04  35%  340 aa  DUS12_HUMAN RecName: Full=Dual specificity protein phosphatase 12; 
  141::194     4e-04  37%  215 aa  DUPD1_RAT RecName: Full=Dual specificity phosphatase DUPD1;        
  141::194     4e-04  37%  215 aa  DUPD1_MOUSE RecName: Full=Dual specificity phosphatase DUPD1;      
  137::194     4e-04  36%  216 aa  DUPD1_HORSE RecName: Full=Dual specificity phosphatase DUPD1;      
  134::192     4e-04  38%  217 aa  DUPD1_ANOCA RecName: Full=Dual specificity phosphatase DUPD1;      
   92::161     6e-04  34%  403 aa  PTEN_MOUSE RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   92::161     6e-04  34%  403 aa  PTEN_HUMAN RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   92::161     6e-04  34%  403 aa  PTEN_CANFA RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  275::337     6e-04  37%  764 aa  METE_BLOPB RecName:
   48::129     6e-04  36%  171 aa  DUSP_VARV RecName: Full=Dual specificity protein phosphatase;      
  133::195     6e-04  33%  198 aa  DUS13_MOUSE RecName: Full=Dual specificity protein phosphatase 13; 
   83::167     8e-04  29%  212 aa  DUSP1_DICDI RecName: Full=Probable dual specificity protein
  145::166     8e-04  64%  211 aa  DUS26_RAT RecName: Full=Dual specificity protein phosphatase 26;   
  145::166     8e-04  64%  211 aa  DUS26_PONAB RecName: Full=Dual specificity protein phosphatase 26; 
  145::166     8e-04  64%  211 aa  DUS26_MOUSE RecName: Full=Dual specificity protein phosphatase 26; 
  145::166     8e-04  64%  211 aa  DUS26_HUMAN RecName: Full=Dual specificity protein phosphatase 26; 
  134::185     8e-04  42%  206 aa  DUPD1_GASAC RecName: Full=Dual specificity phosphatase DUPD1;      
  498::589     0.001  27%  703 aa  ZN750_MOUSE RecName: Full=Protein ZNF750;
  133::184     0.001  38%  198 aa  DUS13_HUMAN RecName: Full=Dual specificity protein phosphatase 13; 
  132::183     0.001  41%  211 aa  DUPD1_CALMI RecName: Full=Dual specificity phosphatase DUPD1;      
    1::598

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxPSLKSSHQDQGSVNQSFLRPMSPNANPGPTESSNRRAKNLKNLSLRLPASPFRPPLSTAPIAESGRH
PMP1_SCHPO      ----------------------------------------------------------------------
PTPX_CANAL      ----------------------------------------------------------------------
MSG5_YEAST      ----------------------------------------------------------------------
SDP1_YEAST      ----------------------------------------------------------------------
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      ----------------------------------------------------------------------
DUS4_CHICK      ----------------------------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        ----------------------------------------------------------------------
DUS4_MOUSE      ----------------------------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ----------------------------------------------------------------------
DUSP_VACCC      ----------------------------------------------------------------------
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------------
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------------
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     ---PSSPEDHSRIGPLNLSKKLETNPAATYGPMYASNAQADTLQDLPLNLSVKDLCNAWAPRPALPGPPQ
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LSEPSSPVRPHSRGSKRRPPNLTIQTPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PMP1_SCHPO      ----------------------------------------------------------------------
PTPX_CANAL      ----------------------------------------------------------------------
MSG5_YEAST      ----------------------------------------------------------------------
SDP1_YEAST      ----------------------------------------------------------------------
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      ----------------------------------------------------------------------
DUS4_CHICK      ----------------------------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        ----------------------------------------------------------------------
DUS4_MOUSE      ----------------------------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ----------------------------------------------------------------------
DUSP_VACCC      ----------------------------------------------------------------------
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------------
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------------
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     GAEPAATPKTETKGSEDRTSR--VETP-------------------------------------------
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxGTWCDADLGKASNQTNFNPNEPLIEFGEEDDCPISRESRKGSERGYPDGPIRIYDS
PMP1_SCHPO      ---------------------------------------------CPVPKASKPNSNQPYPNGPVCIYPP
PTPX_CANAL      -------------------------------------------------------SINAYPNGPKNVLNN
MSG5_YEAST      --------------GTLDSTDVNRFSNQKNM---QTTLIFPEEDDLNIDMVHAEIYQRTYLDGXXXXXXX
SDP1_YEAST      ---------------------------------------------------------RIYPKGPLLVLPE
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      ----------------------------------------------------------------------
DUS4_CHICK      ----------------------------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        ----------------------------------------------------------------------
DUS4_MOUSE      ----------------------------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ----------------------------------------------------------------------
DUSP_VACCC      ----------------------------------------------------------------------
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------------
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------------
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GLWLYLEPNEEEASKFDVVFNVAKEVNNPFSTDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFK
PMP1_SCHPO      NIYLYAKPTMPIIQSFDVVINVAKEVLHPFRTDGSKHNLDIQVFDHI-----------------------
PTPX_CANAL      LIYLYSDPAQGDINKFDLVINVAKE--------------------------------------CDNMSLQ
MSG5_YEAST      XXXXXSEPKLEDILSFDLVINVAKEIPN------------------------------------------
SDP1_YEAST      KIYLYSEPTVKELLPFDVVINVAEEAND------------------------------------------
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      ----------------------------------------------------------------------
DUS4_CHICK      ----------------------------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        ----------------------------------------------------------------------
DUS4_MOUSE      ----------------------------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ------------------------------------------------------------DAPSSEVKFK
DUSP_VACCC      ------------------------------------------------------------DAPSSEVKFK
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------SEVKFK
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------SEVKFK
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
PMP1_SCHPO      ---------------------EYVHIHWDHDTQFALELDKLVSFVANAMQLNKKVLINCQMGISRSACLM
PTPX_CANAL      -----YMNQVPN-------QREYVYIPWSHNSNISKDLFQITNKIDKFFTNGRKILIHCQCGVSRSACVV
MSG5_YEAST      --LEFL------IPPEMAHKIKYYHIEWTHTSKIVKDLSRLTRIIHTAHSQGKKILVHCQCGVSRSASLI
SDP1_YEAST      ------------------PAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLI
DUS9_HUMAN      ----------------------------DHWSQNLSRFFPAIEFIDEALSQNCGVLVHCLAGVSRSVTVT
DUS5_HUMAN      ----------------------HLHYKWSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTIC
DUS4_CHICK      TALLNVSSDCP-----NHFEGHYIPVEDNHKADISSWFMEAIEYIDSVKECCGRVLVHCQAGISRSATIC
DUS1_HUMAN      TALINVSANCP-----NHFEGHYIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATIC
DUS16_HUMAN     ------------------PESHFLRVPVNDSEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIA
DUSPR_DICDI     -------------------------------ANIYEHFEPVIQFINDCKKQGGRVLIHCAMGISRSTTVV
DUS1_RAT        TALINVSANCP-----NHFEGHYIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATIC
DUS1_MOUSE      TALINVSANCP-----NHFEGHYIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATIC
DUS10_MOUSE     ---------------------------------------------------GKGLLIHCQAGVSRSATIV
DUS10_HUMAN     ---------------------------------------------------GKGLLIHCQAGVSRSATIV
DUS10_BOVIN     ---------------------------------------------------GKGLLIHCQAGVSRSATIV
DUS6_RAT        ----------------NAGEFKYKQIPIDHWSQNLSQFFPAISFIDEARGKNCGVLVHCLAGISRSVTVT
DUS6_MOUSE      ----------------NAGEFKYKQIPIDHWSQNLSQFFPAISFIDEARGKNCGVLVHCLAGISRSVTVT
DUS6_HUMAN      ----------------NAGEFKYKQIPIDHWSQNLSQFFPAISFIDEARGKNCGVLVHCLAGISRSVTVT
DUS6_BOVIN      ----------------NAGEFKYKQIPIDHWSQNLSQFFPAISFIDEARGKNCGVLVHCLAGISRSVTVT
DUS4_RAT        TALLNVSSDCP-----NHFEGHYIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATIC
DUS4_MOUSE      TALLNVSSDCP-----NHFEGHYIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATIC
DUS7_RAT        ----------------------------DHWSQNLSQFFPAISFIDEARSKKCGVLVHCLAGISRSVTVT
DUS7_MOUSE      ----------------------------DHWSQNLSQFFPAISFIDEARSKKCGVLVHCLAGISRSVTVT
DUS7_HUMAN      ----------------------------DHWSQNLSQFFPAISFIDEARSKKCGVLVHCLAGISRSVTVT
123R_IIV6       ----------------------WINIDDSESSDLYSHLQKVTTLIHDSIENGNKVLVHCQAGISRSATVV
DUS4_HUMAN      TALLNVSSDCP-----NHFEGHYIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATIC
VHP1_CAEEL      SVVINLSMTCPKSV-CIKEDKNFMRIPVDSYQEKLSPYFPMAEFLEKCRRAGKKCLIHCLAGISRSPTLA
PTPH_AMEPV      ----------------------YIHA-YDLTNEIIIDYFDITKFIINKIKEGKKVLIHCYAGISRSASIV
DUS2_HUMAN      -------------------------------------------------NSGGRVLVHCQAGISRSATIC
DUS2_MOUSE      --------------------------------------------IDSVKNSGGRVLVHCQAGISRSATIC
STYX_MOUSE      ----------------------------DNPVENIIRFFPMTEFIDGSLQNGGKVLVHGNAGISRSAAFV
STYXA_XENLA     ----------------------------DNPVENIIRFFPMSEFIDGCLQTGGKVLIHGNAGISRSAALV
DUS5_RAT        ----------------------HLHYKWSHTADISSHFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTIC
STYX_PONAB      ----------------------------DNPVENIIRFFPMTEFIDGSLQMGGKVLVHGNAGISRSAAFV
STYX_HUMAN      ----------------------------DNPVENIIRFFPMTEFIDGSLQMGGKVLVHGNAGISRSAAFV
SSH_DROME       -----------------------------------DDTF---RYITRAKAEGSKVLVHCKMGVSRSASVV
SSH2_MOUSE      ---------------------------------------------------GSKCLVHCKMGVSRSASTV
SSH2_HUMAN      ---------------------------------------------------GSKCLVHCKMGVSRSASTV
DUS8_HUMAN      -------------------ESRFMRVPINDNEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIA
PTPH_MIMIV      ---------------------------------------PMIEIINNAVESGNNILIHCMAGISRSVS-T
DUS8_MOUSE      -------------------ESRFMRIPINDNEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIA
STYXB_XENLA     ------------------------------------------EFIDGCLQTGGKVLIHGNAGISRSAALV
DUS14_MOUSE     -------------PNFNWPQFEYVKVPLADIPHAPIRLYTVADKIHSVSKKHGATLVHCAAGVSRSATLC
SSH_XENLA       --------------------------------------------------QGSRVLVHCKMGVSRSASTV
DUS14_HUMAN     -------------PNFNWPQFEYVKVPLADMPHAPIGLYTVADKIHSVSRKHGATLVHCAAGVSRSATLC
DUS14_BOVIN     -------------PNFNWPQFEYVKVPLADMPHAPIGLYTVADKIHSVSRKHGATLVHCAAGVSRSATLC
SSH1_HUMAN      ------------------------------------------------INKAKRCLVHCKMGVSRSASTV
MDSP_HUMAN      ---------------------------------------------------GAKVLVHCVVGVSRSATLV
SSH1_MOUSE      ------------------------------------------------INKAKRCLVHCKMGVSRSASTV
DUS21_HUMAN     ---------------------QYIKVPVTRDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLC
SSH3_MOUSE      ---------------------------WDEESQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATV
DUSP3_DICDI     -----------------------------------------------RMKKGARVFIHCMAGKSRSASIV
PVH1_SCHPO      -------------PNLSVPEQQHLWLQIEDSSSILQYFEKSNKFIAFALSKNAKVLVHCFAGISRSVTLV
DUS19_HUMAN     --------------------------------------FPECEFIEEAKRKDGVVLVHCNAGVSRAAAIV
SSH3_RAT        ---------------------------WDEESQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATV
DUSP4_DICDI     ------------------------------------------------IEEGRKVLVHCFAGISRSATIC
DUS19_MOUSE     --------------------------------------FPECEFIEQAKLKDGVVLVHCNAGVSRAAAIV
MPL3_DICDI      -----------------------------------------CFIESGRKSGG--VLVHCRAGISRSSTLV
STYL1_HUMAN     ----------------------HIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAI
MDSP_MOUSE      ---------------------------------------------------GAKVLVHCVVGVSRSATLV
DUSP2_DICDI     ------------------------------NVEIFDDVFDKCEFIDSNIGENNGILVHCNAGVSRSATIL
DUS18_RAT       ---------------------QYVQVPVDAPIARLSDFFPIADHIHSVEMKQGRTLLHCAAGVSRSAALC
YO42_CAEEL      ------------------PHMKVVHLPLQDNETT--DLSPHWANVYKEIEEARRALLLCAMGISRSATFG
MPL2_DICDI      --------------------------------------------IDEGREKGG-VLIHCRAGVSRSASAT
DUS3_PONAB      ------------------------------------------DFIDQALAKNGRVLVHCREGYSRSPTLV
DUS3_HUMAN      ------------------------------------------DFIDQALAKNGRVLVHCREGYSRSPTLV
DUS28_MOUSE     -----------PGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVC
DUS22_XENTR     --------------------------------------------------KGEGCLVHCLAGVSRSVTLV
DUPD1_TAKRU     ---------------------------------------PAAQFIHEALSQPHNVLVHCVMGRSRSATLV
PTP3_CHLMO      ----------------------YLSLPLDMEGQDIVALLPSCQFLQQAQASGGVCLVHCLAGISRSASVV
PTP2_NPVOP      ------SDVAPIRHALGLPVGDHIHVYCEATCAALPNAMPLYDYMVRRIGEGKRVLVHCYAGASRSAALA
PPS1_YEAST      ------------------------------------------DFISNSEATGGKVLVHCMVGVSRSATVC
MPL1_DICDI      --------------------------------------------IDEGREKGG-VLIHCRAGVSRSATAT
DUS3_MOUSE      ------------------------------------------DFIDQALAKNGRVLVHCREGYSRSPTLV
DUS18_HUMAN     ---------------------QYMQVPVSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALC
DS22B_DANRE     --------------------------------------------------KGEGCLVHCLAGVSRSVTLV
SSH3_HUMAN      ---------------------------WDEESQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRSAATV
DUS22_XENLA     --------------------------------------------------KGEGCLVHCLAGVSRSVTLV
PTEN_XENLA      ----------------------------DHNPPQLELIKPFCEDLDQLLSENENVAIHCKAGKGRTGVMI
DUPD1_HUMAN     --------------------------------------YPAAAFIDRALSDDSKILVHCVMGRSRSATLV
DUS22_MOUSE     --------------------------------------------------QGESCLVHCLAGVSRSVTLV
DUS22_HUMAN     --------------------------------------------------RGESCLVHCLAGVSRSVTLV
DUS12_MOUSE     -------------------------------TDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVV
DUPD1_XENTR     --------------------------------------YPAAQFIRNALSSSSKVLVNCAMGRSRSASLV
DUPD1_CHICK     ------------------------------------------EFIDNALQDERKVLVHCAMGRSRSATLV
DUPD1_ORYLA     ------------------------------------------------------VLVHCVMGRSRSATLV
DUSP_VACCW      YVLNLTMDKYT-LPNSNI---NIIHIPLVDDSKYFDDVTAFLSKCDQR---NEPVLVHCAAGVNRSGAMI
DUSP_VACCC      YVLNLTMDKYT-LPNSNI---NIIHIPLVDDSKYFDDVTAFLSKCDQR---NEPVLVHCAAGVNRSGAMI
DUPD1_TETNG     ---------------------------------------PAAQFIHEALSQPNNVLVHCVMGRSRSATLV
DUS18_PONAB     ---------------------QYLQVPVADDSRLCDFFDPVADHIHSVEMKQGRTLLHCAAGVSRSAALC
DUPD1_PIG       --------------------------------------YPAAAFIDAALREHSKILVHCAMGRSRSATLV
DUPD1_PANTR     --------------------------------------YPAAAFIDRALRDDSKILVHCVMGRSRSATLV
DUPD1_MONDO     --------------------------------------YSAAEFIESALQSDRKILVHCAMGRSRSATLV
DUS26_BOVIN     ---------------------------------------------------GGRILVHCAVGVSRSATLV
DUS18_BOVIN     ----------------------YVQVPVADTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALC
DUS12_RAT       -------------------------------TDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVV
DUPD1_XENLA     --------------------------------------YPAAQFIHKALSTNSKLLVNCAMGRSRSASLV
VH01_RACVI      YILNLTMDKYSFT----NSNINIIHVPMDTSTDIFDDITAFLSKCDQR---NEPVLVHCAAGVNRSGAMI
DUS12_HUMAN     -------------------------------TDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAII
DUPD1_RAT       -----------------------------------------------------KILVHCAMGRSRSATLV
DUPD1_MOUSE     -----------------------------------------------------KILVHCAMGRSRSATLV
DUPD1_HORSE     -------------------------------------------------SDHSKILVHCVMGRSRSATLV
DUPD1_ANOCA     -----------------------------------------------------KILVHCAMGRSRSAALV
PTEN_MOUSE      ----------------------------DHNPPQLELIKPFCEDLDQWLSEDDNAAIHCKAGKGRTGVMI
PTEN_HUMAN      ----------------------------DHNPPQLELIKPFCEDLDQWLSEDDNAAIHCKAGKGRTGVMI
PTEN_CANFA      ----------------------------DHNPPQLELIKPFCEDLDQWLSEDDNAAIHCKAGKGRTGVMI
METE_BLOPB      -------------------------------------------------------LLHARLPKTLSAGVV
DUSP_VARV       YVLNLTMDKYT-LPNSNI---NIIHIPLVDDSKYFDDVTAFLSKCDQR---NEPVLVHCVAGVNRSGAMI
DUS13_MOUSE     -----------------------------------------------------RVLVHCAMGVSRSATIV
DUSP1_DICDI     ----------------------------DESQKDISSYFQQCHGFIENGRKLGGILVHCSAGVSRSASVV
DUS26_RAT       ---------------------------------------------------GGKILVHCAVGVSRSATLV
DUS26_PONAB     ---------------------------------------------------GGKILVHCAVGVSRSATLV
DUS26_MOUSE     ---------------------------------------------------GGKILVHCAVGVSRSATLV
DUS26_HUMAN     ---------------------------------------------------GGKILVHCAVGVSRSATLV
DUPD1_GASAC     -----------------------------------------------------KVLVHCVMGRSRSAALV
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     -----------------------------------------------------RVLVHCAMGVSRSATLV
DUPD1_CALMI     -----------------------------------------------------KLLVHCAMGRSRSATLV


                         .         .         .         .         *         .         .:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRSPADYNEAMRTAQSSHTQT
PMP1_SCHPO      IAF-IMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQIIR-------------------------
PTPX_CANAL      VAFYM-KKFQLGVNEAYELLKDRIC---PNMNLIFELMEFGDKLNNNEIS--------------------
MSG5_YEAST      VAY-IMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEWGTMLS----KNSPGEEGETVHMPEEDDIGN
SDP1_YEAST      IAY-IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKT----------------------
DUS9_HUMAN      VAY-LMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLR-------------------------
DUS5_HUMAN      MAY-LMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNQPPSCQGEAAGSSLIGHLQT
DUS4_CHICK      LAYLMMKK-RVKLEKAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAVEAASPSGTLRRGKATSTPT
DUS1_HUMAN      LAY-LMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------
DUS16_HUMAN     IAY-IMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKNQTGASGP-----------------
DUSPR_DICDI     LAY-LMKEDHMTYSDAFTFCKQKRSCINPNFGFVKQLKDYQ-----------------------------
DUS1_RAT        LAY-LMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------
DUS1_MOUSE      LAY-LMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------
DUS10_MOUSE     IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR-------------------
DUS10_HUMAN     IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR-------------------
DUS10_BOVIN     IAY-LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR-------------------
DUS6_RAT        VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDF------------------------------
DUS6_MOUSE      VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDF------------------------------
DUS6_HUMAN      VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDF------------------------------
DUS6_BOVIN      VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDF------------------------------
DUS4_RAT        LAYLMMKK-RVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTSCAAEAASPSGPLRRGKATPTPT
DUS4_MOUSE      LAYLMMKK-RVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTSCAAEAASPSGPLRRGKATPTPT
DUS7_RAT        VAY-LMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDF------------------------------
DUS7_MOUSE      VAY-LMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDF------------------------------
DUS7_HUMAN      VAY-LMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDF------------------------------
123R_IIV6       IAY-IMRSKRYSLQDAFNFVKKKRSIIFPNAGFIKQLAQF------------------------------
DUS4_HUMAN      LAYLMMKK-RVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------
VHP1_CAEEL      ISY-IMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVL----IKDHVLDYNQASR---------
PTPH_AMEPV      INYFMNKNINYD-EAEKIVSKKRN--IKPNIFFILQL---------------------------------
DUS2_HUMAN      LAY-LMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQV--------------------------
DUS2_MOUSE      LAY-LIQSHRVRLDEAFDFVKQRRGVISPNFSFMGQLLQLETQV--------------------------
STYX_MOUSE      IAY-IMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEY------------------------------
STYXA_XENLA     IAY-IMETFGIKYRDAFTYVQERRFCINPNAGFVHQLQEY------------------------------
DUS5_RAT        MAY-LMKTKQFRLKEAFEYIKQRRSVVSPNFGFMGQLLQYESEI--------------------------
STYX_PONAB      IAY-IMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEY------------------------------
STYX_HUMAN      IAY-IMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEY------------------------------
SSH_DROME       IAYAM-KAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY------------------------------
SSH2_MOUSE      IAYAM-KEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQ-----GILLASKQRHNKLWR---------
SSH2_HUMAN      IAYAM-KEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQ-----GILLASKQRHNKLWR---------
DUS8_HUMAN      IAY-IMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSLK-------------------------
PTPH_MIMIV      LTYYLMKKYNIPYSQAIKYVKDRRSIVNPNDSFKLQLQGYQSK---------------------------
DUS8_MOUSE      IAY-IMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSLK-------------------------
STYXB_XENLA     IAY-IMETFGIKYRDAFTYVQERRFCINPNAGFVHQLQEY------------------------------
DUS14_MOUSE     IAY-LMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFG------------------------
SSH_XENLA       IAYAM-KEYEWTLETAIRHVKERRSIVQPNAGFMRQLQTYQ-----------------------------
DUS14_HUMAN     IAY-LMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFG------------------------
DUS14_BOVIN     IAY-LMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFG------------------------
SSH1_HUMAN      IAYAM-KEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYE-----GILDASKQRHNKLWRQQTDSSLQ-
MDSP_HUMAN      LAY-LMLHQRLSLRQAVITVRQHR-WVFPNRGFLHQLCRLDQQLRG------------------------
SSH1_MOUSE      IAYAM-KEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYE-----GILDASKQRHNKLWRQQPTDDT--
DUS21_HUMAN     LAY-LMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVR-------------------
SSH3_MOUSE      LAYAM-KQYGWDLEQALIHVQELRPIVRPNHGFLRQLRTYQ-----------------------------
DUSP3_DICDI     LSYLLKRDIHSLSDCLFYLHSKR-LEIRPNDGFMNQLCDLELKL--------------------------
PVH1_SCHPO      AAY-LMKENNWNTEEALSHINERRSGISPNANFLRQL---------------------------------
DUS19_HUMAN     IGF-LMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQ-----------------------------
SSH3_RAT        LAYAM-KQYGWGLEQALIHVQELRPIVRPNPGFLRQLQTYQ-----------------------------
DUSP4_DICDI     IAY-IMRKLNISFEDAHGLVSDARPIIYPNESFIKQLKKY------------------------------
DUS19_MOUSE     IGF-LMSSEEATFTTALSLVKEARPSICPNPGFMEQLRTYQVGKESNGGDKVPAE---------------
MPL3_DICDI      ISY-LMKYQRMTFKQAMDLVQSKRPQIQPNPGFKDQLLKYEAKL--------------------------
STYL1_HUMAN     IAYLMHSNEQ-TLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSIT--------------------
MDSP_MOUSE      LAY-LMLHQQLSLQQAIITVRERR-WIFPN----------------------------------------
DUSP2_DICDI     ISY-LMKKLKIPLSLSLEILKSSRPQCKPNQGFLKQLEIFEKEL--------------------------
DUS18_RAT       LAY-LMKYHVMSLLDAHAWTKSRRPIIRPNSGFWEQLIHYEFQLFG------------------------
YO42_CAEEL      IAYVMQKTLHDSYKAVQ-LARNIIC---PNVGFFQQLIDLEQKLRG------------------------
MPL2_DICDI      MAFIMMKNS-LKFQEAFDITIKGRPRIYPNIGFINQLKKF------------------------------
DUS3_PONAB      IAY-LMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
DUS3_HUMAN      IAY-LMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
DUS28_MOUSE     TAYLMRHRGH-SLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAIPREPID---------------
DUS22_XENTR     VAYVM---TVTDFDALSAVRGARTC-ANPNMGFQKQLEDF------------------------------
DUPD1_TAKRU     LAYLMMEHSLSVVDAI-EHVRQRRC-ILPNHGFLKQL---------------------------------
PTP3_CHLMO      IAY-LMWTQGMPYTEARAMVRRARSKVYPNTGFTLQLQELDRLRESGAI---------------------
PTP2_NPVOP      VYY-------------------------------------------------------------------
PPS1_YEAST      IAECMYLQCDLASAYLFVRVRRLNVIIQPNLFFVYEL---------------------------------
MPL1_DICDI      IAYIMMKNS-VKFQEAFDITIKGRSRIYPNRGFLNQLKKF------------------------------
DUS3_MOUSE      IAY-LMMRQKMDVKSALSTVRQNR-EIGPNDGFLAQLCQLNDRL--------------------------
DUS18_HUMAN     LAY-LMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG------------------------
DS22B_DANRE     VAY-IMTVTTLGWQEALAAVKIARPCASPNTGFQNQLQEFQT----------------------------
SSH3_HUMAN      LAYAM-KQYECSLEQALRHVQELRPIARPNPGFLRQL---------------------------------
DUS22_XENLA     VAYVM---TVTDFDSLSAVRGARTC-ANPNMGFQKQLEDF------------------------------
PTEN_XENLA      CAYLLHRGKFLDF---YGEVRTR-----------------------------------------------
DUPD1_HUMAN     LAYLMIHKDMTLVDAIQQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUS22_MOUSE     IAYIM---TVTDFDALHTVRAGRSC-ANPNLGFQRQLQEF------------------------------
DUS22_HUMAN     IAYIM---TVTDFDALHTVRAGRSC-ANPNVGFQRQLQEF------------------------------
DUS12_MOUSE     MAF-IMKTDQLTFEKAYDILR-------------------------------------------------
DUPD1_XENTR     LAYLMIYENMTVVDSIMQVLKHRC--ILPNRGFLKQLRE-------------------------------
DUPD1_CHICK     LAYMIYKNMTV-VDAIEQVSRHRC--ILPNRGFLKQLRELDIELRRNTKNSLPSNDDENSTT--------
DUPD1_ORYLA     LAYLMIKE-HLSVVDAVEHVRQRRC-ILPNHGFLKQL---------------------------------
DUSP_VACCW      LAYLMSKN--------------------------------------------------------------
DUSP_VACCC      LAYLMSKN--------------------------------------------------------------
DUPD1_TETNG     LAYLMMRHSLSVVDAV-EQVRQRRC-ILPNHGFLKQL---------------------------------
DUS18_PONAB     LAY-LMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG------------------------
DUPD1_PIG       LAYLMIHRNMTLVDAIRQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUPD1_PANTR     LAYLMIHKDMTLVDAIQQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUPD1_MONDO     LAYLMIYRNMTVVDAIEQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUS26_BOVIN     LAY-------------------------------------------------------------------
DUS18_BOVIN     LAY-LMKYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFG------------------------
DUS12_RAT       TAF-IMKTEQLTFEKAY-----------------------------------------------------
DUPD1_XENLA     LAYMIYKNMTV-VESITQVLKHRC--ILPNRGFLKQLRELDIKL--------------------------
VH01_RACVI      LAYLMSKN--------------------------------------------------------------
DUS12_HUMAN     TAF-LMKTDQLPFEKAY-----------------------------------------------------
DUPD1_RAT       LAYLMIHKNMTLVDAIQQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUPD1_MOUSE     LAYLMIHKNMTLVDAIQQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUPD1_HORSE     LAYLMIHRNMTLVDAIQQVAKNRC--VLPNRGFLKQLRE-------------------------------
DUPD1_ANOCA     LAYMIYKNMTV-VDAIDQVLQHRC--ILPNRGFLKQLRELDIKL--------------------------
PTEN_MOUSE      CAYLLHRGKFLKAQEAYGEVRTR-----------------------------------------------
PTEN_HUMAN      CAYLLHRGKFLKAQEAYGEVRTR-----------------------------------------------
PTEN_CANFA      CAYLLHRGKFLKAQEAYGEVRTR-----------------------------------------------
METE_BLOPB      NGRNVWKNLHDWFKKLYPLVGERSLWIGSSCSLLHSPIDLNTEIK-------------------------
DUSP_VARV       LAYLMSKN--------------------------------------------------------------
DUS13_MOUSE     LAFLMIFENMTLVDAIQTVQAHRD--ICPNSGFLRQLQVLDNRLRRET----------------------
DUSP1_DICDI     ISYLMSVFFKPFWYCMQYLRNIRPC-IQPNTGFINQLINYEATI--------------------------
DUS26_RAT       LAY-------------------------------------------------------------------
DUS26_PONAB     LAY-------------------------------------------------------------------
DUS26_MOUSE     LAY-------------------------------------------------------------------
DUS26_HUMAN     LAY-------------------------------------------------------------------
DUPD1_GASAC     LAYLMMEHGLTVVDAI-EHVRQRRC-VLPNHGFLRQL---------------------------------
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     LAFLMICENMTLVEAIQTVQAHRN--ICPNSGFLRQL---------------------------------
DUPD1_CALMI     LAYMIYKNMTV-VDAIQEVIQRRC--ILPNRGFLKQL---------------------------------


                         .         .         +         .         .         .         .:490
query           TDIEREIAHSKAAASTPNNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PMP1_SCHPO      ----------------------------------------------------------------------
PTPX_CANAL      ----------------------------------------------------------------------
MSG5_YEAST      NEV-------------------------------------------------------------------
SDP1_YEAST      ----------------------------------------------------------------------
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      LSPDMQGAYCTFPAS-------------------------------------------------------
DUS4_CHICK      SQFVFSFPVSVGVHATPSS---------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        SQFVFSFPVSVGVHAAPSN---------------------------------------------------
DUS4_MOUSE      SQFVFSFPVSVGVHAAPSN---------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ----------------------------------------------------------------------
DUSP_VACCC      ----------------------------------------------------------------------
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------------
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------------
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PMP1_SCHPO      ----------------------------------------------------------------------
PTPX_CANAL      ----------------------------------------------------------------------
MSG5_YEAST      ----------------------------------------------------------------------
SDP1_YEAST      ----------------------------------------------------------------------
DUS9_HUMAN      ----------------------------------------------------------------------
DUS5_HUMAN      ----------------------------------------------------------------------
DUS4_CHICK      ----------------------------------------------------------------------
DUS1_HUMAN      ----------------------------------------------------------------------
DUS16_HUMAN     ----------------------------------------------------------------------
DUSPR_DICDI     ----------------------------------------------------------------------
DUS1_RAT        ----------------------------------------------------------------------
DUS1_MOUSE      ----------------------------------------------------------------------
DUS10_MOUSE     ----------------------------------------------------------------------
DUS10_HUMAN     ----------------------------------------------------------------------
DUS10_BOVIN     ----------------------------------------------------------------------
DUS6_RAT        ----------------------------------------------------------------------
DUS6_MOUSE      ----------------------------------------------------------------------
DUS6_HUMAN      ----------------------------------------------------------------------
DUS6_BOVIN      ----------------------------------------------------------------------
DUS4_RAT        ----------------------------------------------------------------------
DUS4_MOUSE      ----------------------------------------------------------------------
DUS7_RAT        ----------------------------------------------------------------------
DUS7_MOUSE      ----------------------------------------------------------------------
DUS7_HUMAN      ----------------------------------------------------------------------
123R_IIV6       ----------------------------------------------------------------------
DUS4_HUMAN      ----------------------------------------------------------------------
VHP1_CAEEL      ----------------------------------------------------------------------
PTPH_AMEPV      ----------------------------------------------------------------------
DUS2_HUMAN      ----------------------------------------------------------------------
DUS2_MOUSE      ----------------------------------------------------------------------
STYX_MOUSE      ----------------------------------------------------------------------
STYXA_XENLA     ----------------------------------------------------------------------
DUS5_RAT        ----------------------------------------------------------------------
STYX_PONAB      ----------------------------------------------------------------------
STYX_HUMAN      ----------------------------------------------------------------------
SSH_DROME       ----------------------------------------------------------------------
SSH2_MOUSE      ----------------------------------------------------------------------
SSH2_HUMAN      ----------------------------------------------------------------------
DUS8_HUMAN      ----------------------------------------------------------------------
PTPH_MIMIV      ----------------------------------------------------------------------
DUS8_MOUSE      ----------------------------------------------------------------------
STYXB_XENLA     ----------------------------------------------------------------------
DUS14_MOUSE     ----------------------------------------------------------------------
SSH_XENLA       ----------------------------------------------------------------------
DUS14_HUMAN     ----------------------------------------------------------------------
DUS14_BOVIN     ----------------------------------------------------------------------
SSH1_HUMAN      ----------------------------------------------------------------------
MDSP_HUMAN      ----------------------------------------------------------------------
SSH1_MOUSE      ----------------------------------------------------------------------
DUS21_HUMAN     ----------------------------------------------------------------------
SSH3_MOUSE      ----------------------------------------------------------------------
DUSP3_DICDI     ----------------------------------------------------------------------
PVH1_SCHPO      ----------------------------------------------------------------------
DUS19_HUMAN     ----------------------------------------------------------------------
SSH3_RAT        ----------------------------------------------------------------------
DUSP4_DICDI     ----------------------------------------------------------------------
DUS19_MOUSE     ----------------------------------------------------------------------
MPL3_DICDI      ----------------------------------------------------------------------
STYL1_HUMAN     ----------------------------------------------------------------------
MDSP_MOUSE      ----------------------------------------------------------------------
DUSP2_DICDI     ----------------------------------------------------------------------
DUS18_RAT       ----------------------------------------------------------------------
YO42_CAEEL      ----------------------------------------------------------------------
MPL2_DICDI      ----------------------------------------------------------------------
DUS3_PONAB      ----------------------------------------------------------------------
DUS3_HUMAN      ----------------------------------------------------------------------
DUS28_MOUSE     ----------------------------------------------------------------------
DUS22_XENTR     ----------------------------------------------------------------------
DUPD1_TAKRU     ----------------------------------------------------------------------
PTP3_CHLMO      ----------------------------------------------------------------------
PTP2_NPVOP      ----------------------------------------------------------------------
PPS1_YEAST      ----------------------------------------------------------------------
MPL1_DICDI      ----------------------------------------------------------------------
DUS3_MOUSE      ----------------------------------------------------------------------
DUS18_HUMAN     ----------------------------------------------------------------------
DS22B_DANRE     ----------------------------------------------------------------------
SSH3_HUMAN      ----------------------------------------------------------------------
DUS22_XENLA     ----------------------------------------------------------------------
PTEN_XENLA      ----------------------------------------------------------------------
DUPD1_HUMAN     ----------------------------------------------------------------------
DUS22_MOUSE     ----------------------------------------------------------------------
DUS22_HUMAN     ----------------------------------------------------------------------
DUS12_MOUSE     ----------------------------------------------------------------------
DUPD1_XENTR     ----------------------------------------------------------------------
DUPD1_CHICK     ----------------------------------------------------------------------
DUPD1_ORYLA     ----------------------------------------------------------------------
DUSP_VACCW      ----------------------------------------------------------------------
DUSP_VACCC      ----------------------------------------------------------------------
DUPD1_TETNG     ----------------------------------------------------------------------
DUS18_PONAB     ----------------------------------------------------------------------
DUPD1_PIG       ----------------------------------------------------------------------
DUPD1_PANTR     ----------------------------------------------------------------------
DUPD1_MONDO     ----------------------------------------------------------------------
DUS26_BOVIN     ----------------------------------------------------------------------
DUS18_BOVIN     ----------------------------------------------------------------------
DUS12_RAT       ----------------------------------------------------------------------
DUPD1_XENLA     ----------------------------------------------------------------------
VH01_RACVI      ----------------------------------------------------------------------
DUS12_HUMAN     ----------------------------------------------------------------------
DUPD1_RAT       ----------------------------------------------------------------------
DUPD1_MOUSE     ----------------------------------------------------------------------
DUPD1_HORSE     ----------------------------------------------------------------------
DUPD1_ANOCA     ----------------------------------------------------------------------
PTEN_MOUSE      ----------------------------------------------------------------------
PTEN_HUMAN      ----------------------------------------------------------------------
PTEN_CANFA      ----------------------------------------------------------------------
METE_BLOPB      ----------------------------------------------------------------------
DUSP_VARV       ----------------------------------------------------------------------
DUS13_MOUSE     ----------------------------------------------------------------------
DUSP1_DICDI     ----------------------------------------------------------------------
DUS26_RAT       ----------------------------------------------------------------------
DUS26_PONAB     ----------------------------------------------------------------------
DUS26_MOUSE     ----------------------------------------------------------------------
DUS26_HUMAN     ----------------------------------------------------------------------
DUPD1_GASAC     ----------------------------------------------------------------------
ZN750_MOUSE     ----------------------------------------------------------------------
DUS13_HUMAN     ----------------------------------------------------------------------
DUPD1_CALMI     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PMP1_SCHPO      --------------------------------------
PTPX_CANAL      --------------------------------------
MSG5_YEAST      --------------------------------------
SDP1_YEAST      --------------------------------------
DUS9_HUMAN      --------------------------------------
DUS5_HUMAN      --------------------------------------
DUS4_CHICK      --------------------------------------
DUS1_HUMAN      --------------------------------------
DUS16_HUMAN     --------------------------------------
DUSPR_DICDI     --------------------------------------
DUS1_RAT        --------------------------------------
DUS1_MOUSE      --------------------------------------
DUS10_MOUSE     --------------------------------------
DUS10_HUMAN     --------------------------------------
DUS10_BOVIN     --------------------------------------
DUS6_RAT        --------------------------------------
DUS6_MOUSE      --------------------------------------
DUS6_HUMAN      --------------------------------------
DUS6_BOVIN      --------------------------------------
DUS4_RAT        --------------------------------------
DUS4_MOUSE      --------------------------------------
DUS7_RAT        --------------------------------------
DUS7_MOUSE      --------------------------------------
DUS7_HUMAN      --------------------------------------
123R_IIV6       --------------------------------------
DUS4_HUMAN      --------------------------------------
VHP1_CAEEL      --------------------------------------
PTPH_AMEPV      --------------------------------------
DUS2_HUMAN      --------------------------------------
DUS2_MOUSE      --------------------------------------
STYX_MOUSE      --------------------------------------
STYXA_XENLA     --------------------------------------
DUS5_RAT        --------------------------------------
STYX_PONAB      --------------------------------------
STYX_HUMAN      --------------------------------------
SSH_DROME       --------------------------------------
SSH2_MOUSE      --------------------------------------
SSH2_HUMAN      --------------------------------------
DUS8_HUMAN      --------------------------------------
PTPH_MIMIV      --------------------------------------
DUS8_MOUSE      --------------------------------------
STYXB_XENLA     --------------------------------------
DUS14_MOUSE     --------------------------------------
SSH_XENLA       --------------------------------------
DUS14_HUMAN     --------------------------------------
DUS14_BOVIN     --------------------------------------
SSH1_HUMAN      --------------------------------------
MDSP_HUMAN      --------------------------------------
SSH1_MOUSE      --------------------------------------
DUS21_HUMAN     --------------------------------------
SSH3_MOUSE      --------------------------------------
DUSP3_DICDI     --------------------------------------
PVH1_SCHPO      --------------------------------------
DUS19_HUMAN     --------------------------------------
SSH3_RAT        --------------------------------------
DUSP4_DICDI     --------------------------------------
DUS19_MOUSE     --------------------------------------
MPL3_DICDI      --------------------------------------
STYL1_HUMAN     --------------------------------------
MDSP_MOUSE      --------------------------------------
DUSP2_DICDI     --------------------------------------
DUS18_RAT       --------------------------------------
YO42_CAEEL      --------------------------------------
MPL2_DICDI      --------------------------------------
DUS3_PONAB      --------------------------------------
DUS3_HUMAN      --------------------------------------
DUS28_MOUSE     --------------------------------------
DUS22_XENTR     --------------------------------------
DUPD1_TAKRU     --------------------------------------
PTP3_CHLMO      --------------------------------------
PTP2_NPVOP      --------------------------------------
PPS1_YEAST      --------------------------------------
MPL1_DICDI      --------------------------------------
DUS3_MOUSE      --------------------------------------
DUS18_HUMAN     --------------------------------------
DS22B_DANRE     --------------------------------------
SSH3_HUMAN      --------------------------------------
DUS22_XENLA     --------------------------------------
PTEN_XENLA      --------------------------------------
DUPD1_HUMAN     --------------------------------------
DUS22_MOUSE     --------------------------------------
DUS22_HUMAN     --------------------------------------
DUS12_MOUSE     --------------------------------------
DUPD1_XENTR     --------------------------------------
DUPD1_CHICK     --------------------------------------
DUPD1_ORYLA     --------------------------------------
DUSP_VACCW      --------------------------------------
DUSP_VACCC      --------------------------------------
DUPD1_TETNG     --------------------------------------
DUS18_PONAB     --------------------------------------
DUPD1_PIG       --------------------------------------
DUPD1_PANTR     --------------------------------------
DUPD1_MONDO     --------------------------------------
DUS26_BOVIN     --------------------------------------
DUS18_BOVIN     --------------------------------------
DUS12_RAT       --------------------------------------
DUPD1_XENLA     --------------------------------------
VH01_RACVI      --------------------------------------
DUS12_HUMAN     --------------------------------------
DUPD1_RAT       --------------------------------------
DUPD1_MOUSE     --------------------------------------
DUPD1_HORSE     --------------------------------------
DUPD1_ANOCA     --------------------------------------
PTEN_MOUSE      --------------------------------------
PTEN_HUMAN      --------------------------------------
PTEN_CANFA      --------------------------------------
METE_BLOPB      --------------------------------------
DUSP_VARV       --------------------------------------
DUS13_MOUSE     --------------------------------------
DUSP1_DICDI     --------------------------------------
DUS26_RAT       --------------------------------------
DUS26_PONAB     --------------------------------------
DUS26_MOUSE     --------------------------------------
DUS26_HUMAN     --------------------------------------
DUPD1_GASAC     --------------------------------------
ZN750_MOUSE     --------------------------------------
DUS13_HUMAN     --------------------------------------
DUPD1_CALMI     --------------------------------------