[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02186

[Show Plain Result]


## Summary of Sequence Search
    1::567
  143::437     1e-07  23%  447 aa  YVDP_BACSU RecName: Full=Uncharacterized FAD-linked oxidoreductase
   46::213     2e-07  28%  458 aa  HDNO_ARTOX RecName: Full=6-hydroxy-D-nicotine oxidase;       
  184::510     1e-06  28%  538 aa  RETO_ESCCA RecName: Full=Reticuline oxidase;       
   78::244     1e-06  25%  523 aa  CKX3_ARATH RecName: Full=Cytokinin dehydrogenase 3;       
  191::257     2e-05  37%  535 aa  RETO_PAPSO RecName: Full=Reticuline oxidase;       
  150::254     2e-05  25%  524 aa  CKX4_ARATH RecName: Full=Cytokinin dehydrogenase 4;       
  127::217     4e-05  38%  501 aa  CKX2_ARATH RecName: Full=Cytokinin dehydrogenase 2;       
   99::203     1e-04  36%  451 aa  YGAK_BACSU RecName: Full=Uncharacterized FAD-linked oxidoreductase
  138::246     1e-04  22%  540 aa  CKX5_ARATH RecName: Full=Cytokinin dehydrogenase 5;       
  157::267     3e-04  27%  575 aa  CKX1_ARATH RecName: Full=Cytokinin dehydrogenase 1;       
    1::567

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YVDP_BACSU      ----------------------------------------------------------------------
HDNO_ARTOX      ----------------------------------------------------------------------
RETO_ESCCA      ----------------------------------------------------------------------
CKX3_ARATH      ----------------------------------------------------------------------
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      ----------------------------------------------------------------------
CKX2_ARATH      ----------------------------------------------------------------------
YGAK_BACSU      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
CKX1_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTSDIQTAVKF
YVDP_BACSU      ----------------------------------------------------------------------
HDNO_ARTOX      -----------------------------------------------------------SAGDVAKSVRY
RETO_ESCCA      ----------------------------------------------------------------------
CKX3_ARATH      -----------------------------------------------------------SVEDITDLIKF
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      ----------------------------------------------------------------------
CKX2_ARATH      ----------------------------------------------------------------------
YGAK_BACSU      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
CKX1_ARATH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
YVDP_BACSU      ----------------------------------------------------------------------
HDNO_ARTOX      ACDNGLEISVRSGGHNPNGYATNDGGIVLDLRLMNSIHIDTA----GSRARIGG--------GVISGDLV
RETO_ESCCA      ----------------------------------------------------------------------
CKX3_ARATH      DSQLSFPLAARGHGHSHRGQASAKDGVVVNMRSMVNRD-------RGIKVSRTCL-YVDVDAAWLWIEVL
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      -------------------------------------------------------------AGTMWVDVL
CKX2_ARATH      -------------------------------------------------------------AGTLWVDVL
YGAK_BACSU      -----------------------------------------------------------IEAGAELGEVY
CKX5_ARATH      ---------------------------------------------------------VDVWGGELWVDVL
CKX1_ARATH      -------------------------------------------------------PYVDVSGGEIWINIL


                         .         .         .         +         .         .         .:280
query           RAAAENGVIVVGGSARTVXXXXXXXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
YVDP_BACSU      ---------------------------------SRSIGLISDNLLALKTVDAKGRIIHADQSHNEDLLWA
HDNO_ARTOX      KEAAKFGLAAVTGMHPKVGFCGLALNGGVGF-LTPKYGLASDNILGATLVTATGDVIYCSDDERPELFWA
RETO_ESCCA      ---------------------------------SRKYGLAADNVVDAILIDANGAILD-RQAMGEDVFWA
CKX3_ARATH      NKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQITNVLEMDVITGKGEIATCSKDMNSDLFFA
RETO_PAPSO      ------------------------------------YGLAADNVVDAILIDSNGAILDREKMGD-DVFWA
CKX4_ARATH      KAAVDRGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLNPELFYG
CKX2_ARATH      KKTAEKGVITVGG---TLSNGGIGGQVFRNGPL-------VSNVLELDVITGKGEMLTCSRQLNPELFYG
YGAK_BACSU      RTLWQYGLTLPAGTIANVXXXXXXXXXXXXXXXXXXXXXC-DSLVQLEMIVADEKEGTVSCSNHPDLFWA
CKX5_ARATH      KKTLEHGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEENTRLFHG
CKX1_ARATH      RETLKYGLLTVGGTLSNAGISG--------QAFKH--GPQINNVYQLEIVTGKGEVVTCSEKRNSELFFS


                         .         *         .         .         .         .         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLS
YVDP_BACSU      SRXXXXXNFGYNTQYTFKVHRAPKTATVFNIIWPWEQLETVFKAWQKWAPFVDERLGCYLEIYSKINGLC
HDNO_ARTOX      VRGAGPN-FGVVTEVEVQLYELPRKMLAGFI---------------------------------------
RETO_ESCCA      IRXXXXXVWGAIYAWKIKLLPVPEKVTV----FRVTKNVAIDEA-TSLLHKWQFVAEELEEDF-TLSVLG
CKX3_ARATH      VLGGLGQ-FGIITRARIKLEVAP-----------------------------------------------
RETO_PAPSO      IRXXXXXVWGAIYAWKIKLLPVPEKLTV----FRVTKN--------------------------------
CKX4_ARATH      VLGGLGQ-FGIITRARIALDHAPTRVK-------------------------------------------
CKX2_ARATH      VLGGLGQ-FGIIT---------------------------------------------------------
YGAK_BACSU      SQGGGGGNFGIVTSMTFKAVP-------------------------------------------------
CKX5_ARATH      VLGGLGQ-FGIITRARISLEPAPQRVR-------------------------------------------
CKX1_ARATH      VLGGLGQ-FGIITRARISLEPAPHMVK-------------------------------------------


                         .         .         .         .         *         .         .:420
query           GGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG
YVDP_BACSU      HAE------GIFL---GSKTELIRLLKPLLHAGTP--TEADIKTLYYPDAIDFLDPDENDQSVKFSSAWG
HDNO_ARTOX      ----------------------------------------------------------------------
RETO_ESCCA      GADEKLGFGLKTVAKSTFDLLFPELGLVEEDYLEMSGESFALAGLETVSQLNNRFLKFDERAFKTKVDLT
CKX3_ARATH      ----------------------------------------------------------------------
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      ----------------------------------------------------------------------
CKX2_ARATH      ----------------------------------------------------------------------
YGAK_BACSU      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
CKX1_ARATH      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASAN
YVDP_BACSU      HDFWSDEPISIMRKFLEDATGTEANFF-FINWGGAISRVPKDETAF--FWRHPLFYTEWTASWKNKS---
HDNO_ARTOX      ----------------------------------------------------------------------
RETO_ESCCA      KEPLPSKALLERLSKEPNGFIALNGFG------GQMSKISSDFT-PFPHRSGTRLMVEYIVAW--NQSEQ
CKX3_ARATH      ----------------------------------------------------------------------
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      ----------------------------------------------------------------------
CKX2_ARATH      ----------------------------------------------------------------------
YGAK_BACSU      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
CKX1_ARATH      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFxxxxxxx
YVDP_BACSU      -QEDSNLASVERVRQL--MQPYVAGSYVNVPDQNIENFGKEYYGANFARLREIKAKYDPENVF-------
HDNO_ARTOX      ----------------------------------------------------------------------
RETO_ESCCA      KKKTEFLDWLEVSKRLGYVIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVF-------
CKX3_ARATH      ----------------------------------------------------------------------
RETO_PAPSO      ----------------------------------------------------------------------
CKX4_ARATH      ----------------------------------------------------------------------
CKX2_ARATH      ----------------------------------------------------------------------
YGAK_BACSU      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
CKX1_ARATH      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxx
YVDP_BACSU      -------
HDNO_ARTOX      -------
RETO_ESCCA      -------
CKX3_ARATH      -------
RETO_PAPSO      -------
CKX4_ARATH      -------
CKX2_ARATH      -------
YGAK_BACSU      -------
CKX5_ARATH      -------
CKX1_ARATH      -------