[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02192

[Show Plain Result]


## Summary of Sequence Search
    1::682
  120::330     4e-05  27%  754 aa  CASC3_DANRE RecName: Full=Protein CASC3;AltName: Full=Cancer
    1::682

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxTEAMLNGMKLADDTAGVAEIHFDDMASEHDASPDLSDKATRLPQSQ
CASC3_DANRE     ------------------------TEELVEGEERDESVKEVKADEKGNLAGERQSGD--GQESTEDPENK


                         +         .         .         .         .         *         .:210
query           RRRREQTENGKERGANPAFVPTRGGFFLHDKRSSNSPNGYRTANNKLKSKPHGLIVDSNVRRPPPKPDIT
CASC3_DANRE     GSKGQKLDDDEDR-KNPAYIPRKGLFFEHDVRGQATEEERPKGRNRKLWKDEGRWEHDKFREEEQAPDIR


                         .         .         .         +         .         .         .:280
query           DGPWTHDLHESVNEGPPPASSRPSSTLPSNMPSGQSSKPVPTAPRSTPPNRSFSSTxxxxxxxxxxxxxx
CASC3_DANRE     NGTGPSDGRRSSWQGPPPGNAPQSVTVQSGQPLAPLSAPKPSGPSTQPPQRSFQGS--------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CASC3_DANRE     ----------------------------------------------------