[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02196

[Show Plain Result]


## Summary of Sequence Search
    1::209
    9::140     3e-12  40%  163 aa  YHM7_SCHPO RecName: Full=Uncharacterized N-acetyltransferase
   18::193     3e-07  41%  216 aa  Y0199_DICDI RecName: Full=Uncharacterized N-acetyltransferase
   87::144     7e-05  36%  167 aa  YJGM_SALTY RecName: Full=Uncharacterized N-acetyltransferase yjgM; 
   87::144     1e-04  34%  167 aa  YJGM_ECOLI RecName: Full=Uncharacterized N-acetyltransferase yjgM; 
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHPVRSPRDIATATSLIKSYTDSLGIDLSYQD
YHM7_SCHPO      --------------------------------------ISAVKLPQDLDDFKMLVQEYLQEFGMDLTFQN
Y0199_DICDI     -----------------------------------------------------LFKEYVEWLNIDLSFQN
YJGM_SALTY      ----------------------------------------------------------------------
YJGM_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FSTEISQMPGKYAPEKGGEILLAIQNNSTSDNFYEPVHAEESHGGSVSPRKNYCCSCTYVESDVLGCAAL
YHM7_SCHPO      VDDELANPMRKYGPPHG--IMLV---------------ARDEHG------------------TALGCVAV
Y0199_DICDI     FSEEFNSLPGKYSIENDGRLYIAYSDES------------------------------------------
YJGM_SALTY      ----------------------------------------------------------------------
YJGM_ECOLI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNLPSINPLRICEIKRLYILPRARSLGYRQGAYQMQLSTRPGRKGYAEMRLDTLPTMHSAIALYKSLGF
YHM7_SCHPO      H--PFGGP-GCCEMKRLYVRPESR--GLKLGVLLVKEIIQYSEKGYSSMVLDTLDTLLPAVRLYKSFGF
Y0199_DICDI     ---------KICEMKRLFVKSEFRGLKIGKLLVE-RLINDAKEQNYDYMVLDTLKTLTTAISIYKSFGF
YJGM_SALTY      ----------ICELQKMYFLPVIRGQGLAKKLALMALD-HAREQGFKRCYLETTAFLREAIALYERLGF
YJGM_ECOLI      ----------ICELQKMYFLPAIRGKGLAKKLALMAME-QAREMGFKRCYLETTAFLKEAIALYEHLGF