[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02520

[Show Plain Result]


## Summary of Sequence Search
    1::424
   57::422     e-147  67%  422 aa  PTPA2_ASPFU RecName: Full=Serine/threonine-protein phosphatase 2A
   46::420     e-141  68%  420 aa  PTPA2_EMENI RecName: Full=Serine/threonine-protein phosphatase 2A
   54::422     e-137  68%  422 aa  PTPA2_ASPOR RecName: Full=Serine/threonine-protein phosphatase 2A
   75::449     e-107  57%  449 aa  PTPA2_NEUCR RecName: Full=Serine/threonine-protein phosphatase 2A
   66::432     e-105  52%  432 aa  PTPA2_GIBZE RecName: Full=Serine/threonine-protein phosphatase 2A
   15::382     6e-86  46%  382 aa  PTPA2_CRYNE RecName: Full=Serine/threonine-protein phosphatase 2A
    6::354     4e-82  48%  354 aa  PTPA2_YARLI RecName: Full=Serine/threonine-protein phosphatase 2A
    3::358     5e-81  45%  358 aa  PTPA2_CANAL RecName: Full=Serine/threonine-protein phosphatase 2A
    3::358     4e-79  45%  358 aa  PTPA2_YEAST RecName: Full=Serine/threonine-protein phosphatase 2A
    7::352     4e-79  47%  352 aa  PTPA2_SCHPO RecName: Full=Serine/threonine-protein phosphatase 2A
    3::360     4e-77  43%  360 aa  PTPA2_KLULA RecName: Full=Serine/threonine-protein phosphatase 2A
    4::352     4e-77  46%  367 aa  PTPA2_DEBHA RecName: Full=Serine/threonine-protein phosphatase 2A
    3::358     5e-74  46%  358 aa  PTPA2_CANGA RecName: Full=Serine/threonine-protein phosphatase 2A
   77::359     1e-69  48%  359 aa  PTPA2_ASHGO RecName: Full=Serine/threonine-protein phosphatase 2A
   64::457     1e-69  43%  457 aa  PTPA2_USTMA RecName: Full=Serine/threonine-protein phosphatase 2A
   63::377     4e-62  42%  468 aa  PTPA2_DICDI RecName: Full=Probable serine/threonine-protein
   23::321     5e-57  39%  325 aa  PTPA1_DICDI RecName: Full=Probable serine/threonine-protein
   15::321     2e-48  35%  324 aa  PTPA_BOVIN RecName: Full=Serine/threonine-protein phosphatase 2A
  107::354     9e-47  38%  358 aa  PTPA_HUMAN RecName: Full=Serine/threonine-protein phosphatase 2A
   23::319     1e-45  34%  323 aa  PTPA_MOUSE RecName: Full=Serine/threonine-protein phosphatase 2A
   72::319     5e-43  35%  323 aa  PTPA_RABIT RecName: Full=Serine/threonine-protein phosphatase 2A
   22::321     9e-42  35%  325 aa  PTPA1_SCHPO RecName: Full=Serine/threonine-protein phosphatase 2A
    3::308     4e-41  34%  432 aa  PTPA1_YARLI RecName: Full=Serine/threonine-protein phosphatase 2A
   18::351     1e-40  39%  432 aa  PTPA1_EMENI RecName: Full=Serine/threonine-protein phosphatase 2A
   24::351     1e-39  41%  445 aa  PTPA1_GIBZE RecName: Full=Serine/threonine-protein phosphatase 2A
   20::353     1e-38  38%  478 aa  PTPA1_ASPOR RecName: Full=Serine/threonine-protein phosphatase 2A
  114::362     5e-37  39%  441 aa  PTPA1_DEBHA RecName: Full=Serine/threonine-protein phosphatase 2A
   64::300     1e-35  34%  353 aa  PTPA1_KLULA RecName: Full=Serine/threonine-protein phosphatase 2A
   67::309     3e-35  37%  393 aa  PTPA1_YEAST RecName: Full=Serine/threonine-protein phosphatase 2A
   59::294     1e-34  37%  424 aa  PTPA1_CANGA RecName: Full=Serine/threonine-protein phosphatase 2A
  103::352     4e-34  44%  473 aa  PTPA1_ASPFU RecName: Full=Serine/threonine-protein phosphatase 2A
  168::474     6e-33  41%  617 aa  PTPA1_NEUCR RecName: Full=Serine/threonine-protein phosphatase 2A
   77::348     3e-32  33%  362 aa  PTPA1_CRYNE RecName: Full=Serine/threonine-protein phosphatase 2A
   62::304     4e-32  35%  365 aa  PTPA1_ASHGO RecName: Full=Serine/threonine-protein phosphatase 2A
   49::395     4e-31  35%  487 aa  PTPA1_USTMA RecName: Full=Serine/threonine-protein phosphatase 2A
   92::348     1e-28  34%  424 aa  PTPA1_CANAL RecName: Full=Serine/threonine-protein phosphatase 2A
   81::236     9e-25  40%  247 aa  PTPA_ENCCU RecName: Full=Serine/threonine-protein phosphatase 2A
   95::170     4e-04  40%  592 aa  DTML1_DICDI RecName: Full=Dictomallein-1;       
    1::424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDRPTLTQHQFIRPVPRILSP
PTPA2_ASPFU     ---------------------------------------------------------HTYTRPVRRILSR
PTPA2_EMENI     ----------------------------------------------------PDLSSHSYSRPVRRILSK
PTPA2_ASPOR     ----------------------------------------------------PDLSSHQYARPVCRILSN
PTPA2_NEUCR     -----------------------------------------------------------FQTPVRRILLL
PTPA2_GIBZE     -----------------------------------------------------------FKTPSRRILSK
PTPA2_CRYNE     --------------------------------------------------------------PTKHILSK
PTPA2_YARLI     --------------------------------------------------------------PVRRILSP
PTPA2_CANAL     -----------------------------------------------------------YITPTKRIFTP
PTPA2_YEAST     --------------------------------------------------------------PEKRLLTP
PTPA2_SCHPO     --------------------------------------------------------QNRCFVPVRRILDN
PTPA2_KLULA     ---------------------------------------------------------------IKRLINE
PTPA2_DEBHA     ----------------------------------------------------------EYTKPVRRITNT
PTPA2_CANGA     --------------------------------------------------------------PSKRILTD
PTPA2_ASHGO     ----------------------------------------------------------------------
PTPA2_USTMA     ------------------------------------------------------LQHHNFSEPRKRIVSP
PTPA2_DICDI     -----------------------------------------------------------------RIISK
PTPA1_DICDI     ------------------------------------------------------LENHKFIKPVKVVTNE
PTPA_BOVIN      --------------------------------------------------DAPPTTQN-FIIPKKEIHTV
PTPA_HUMAN      ----------------------------------------------------------------------
PTPA_MOUSE      -----------------------------------------------------------FIIPKKEIHTV
PTPA_RABIT      ----------------------------------------------------------------------
PTPA1_SCHPO     ----------------------------------------------------------QFKTPEKLIVEA
PTPA1_YARLI     -----------------------------------------------------------FSEPQKRISSA
PTPA1_EMENI     ---------------------------------------------------------HNFTKPSKRINES
PTPA1_GIBZE     -----------------------------------------------------------FTTPSKRINEG
PTPA1_ASPOR     ---------------------------------------------------------HTFLEPSKRINEG
PTPA1_DEBHA     ----------------------------------------------------------------------
PTPA1_KLULA     ----------------------------------------------------------------------
PTPA1_YEAST     ----------------------------------------------------------------------
PTPA1_CANGA     ----------------------------------------------------------------------
PTPA1_ASPFU     ----------------------------------------------------------------------
PTPA1_NEUCR     ----------------------------------------------------------------------
PTPA1_CRYNE     ----------------------------------------------------------------------
PTPA1_ASHGO     ----------------------------------------------------------------------
PTPA1_USTMA     -------------------------------------------------------TLNSIVTPVKKITSE
PTPA1_CANAL     ----------------------------------------------------------------------
PTPA_ENCCU      ----------------------------------------------------------------------
DTML1_DICDI     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QDLETFLSSPAHSLIIAFVFNXXXXXXXXXXXXXXXXXXXETIRKVLSILSAIEELIDKHPSLDQNGSRF
PTPA2_ASPFU     KDHETFLASSTYTLVVSFTFSLSDSVRGRAVTDNKDQPASPNISRILSVIDTIRQLVDKHPSIDQGGSRF
PTPA2_EMENI     NDHETFLSSSTYTLVLAFIFGLSDSVRGRAAPDANAEPGYSPISKILSVVDNIRTLVESHPSIDQGGSRF
PTPA2_ASPOR     HDHQXXXXXXXXXXXXAFIFGLSDSVRGRATTDSKDRPVSPNVSKILAVVESIRTLLDQHPSIDQGGSRF
PTPA2_NEUCR     KDHELFLASPSFNLILSFVFSLSESVADTPISAIKDSDLSEPVKAILRILDETEALCKESPPDDQGGSRF
PTPA2_GIBZE     KDHDIFLSSPTCKLVTAWVFGLAESIVDTPNSAIRDADLSALIKTILHILDETEQLVTKSPPNEQGGSRF
PTPA2_CRYNE     AHLAAFQRSKTHSDIFNFI--EELNEDIVGKKLTEAGQGSERTRPLISILDSVREIAESTPPVDNKLSRF
PTPA2_YARLI     KDLEIFGASDTKKQVFGFV--KVLNYYVVGKGNSYETLKHPIIGKLVAILDKVIDLVAKYPPEDATSSRF
PTPA2_CANAL     EDLSKWVGSPTYNTVLDFIVELQSSVTGKSNDSSYETXXXXXXXXXXXXX--VDNLITLHPAHD-SVSRF
PTPA2_YEAST     DDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPIS-ESINSMMNLLSQIKDITQKHPVIDADSSRF
PTPA2_SCHPO     EDLKLFKEGDAYKLIDSFICDLDEAVKDKXXXXXXXXXXXX--EHVLNILDRVGEIKQENPAIDNMGSRF
PTPA2_KLULA     HDMELWNNSKTFEDVIGFI-NTLALSVRGRENNDYTQPISDNVQRVSNLLSKVTEIIGKHEVIDANTSRF
PTPA2_DEBHA     EDLEIWNGSQAYSTILDFVQDLQDSVVGLTNDAQVTVXXXXXXXX--KVLDKVNEIIENNPVVHEKDSRF
PTPA2_CANGA     KDVKIWEESETREDILSFI-ESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEIDKLIKLHPVIDKNTSRF
PTPA2_ASHGO     -----------------------------------------------------------HPVLDAATSRF
PTPA2_USTMA     ASLSRFEHSQAFAEILAFI--CVCNTRVVGKTLTEEIQISSACRTILEMLDQVAALRESTPPDASIGSRF
PTPA2_DICDI     RDLRSFHTSSTYSELLNFIIQLSLDIQGKSLKSNFTIT--KNINSIIVLLNQLDQYITDIPP-KQIRTRF
PTPA1_DICDI     DDIKKFLRSGACRDLLEYI--QTLSDKIKSKPNSTKTQNSNEIKNIVSMLNEISVYIDNIPPLAQP-MRY
PTPA_BOVIN      PDMGKWKRSQAYADYIGFILTLNEGVKGKKLSFEYKVS--EAIEKLVALLNTLDRWIDETPPVDQP-SRF
PTPA_HUMAN      ----------------------------------------EAIEKLVALLNTLDRWIDETPPVDQP-SRF
PTPA_MOUSE      PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFDYKVS--EAIEKLVALLDTLDRWIDETPPVDQP-SRF
PTPA_RABIT      ----------------------------------------EAVEKLLALLDTLDRWIDETPPVDQP-SRF
PTPA1_SCHPO     SDMTAFRQSKAYYRIFDFLQRLNIASVGVNDYHVEYSTRVE---KLVRILCRVKEITKTVPPASGR-HRF
PTPA1_YARLI     ADVDSFKRSQPYATIISLL-DKYSSTVQEHLLPPNEDELAASSKALVTLCRKLSALIDETPPLE-GPRRF
PTPA1_EMENI     QDVAEFLSSKAYVDLMTFLLQLNRSLFPTKLPDGRVLTWEAPVRQLQQLLSKLEAILDEAPP-DTGPRRF
PTPA1_GIBZE     SDVARFLTSLAYRDIGVFILNQSSSPLPRTFPLNSKPATTPSVQTLQALLAKIGSFIDEAPP-DPGPRRF
PTPA1_ASPOR     DDVSEFLCSKAYVDIMTFLLQLNRSMFPAKLPDGRVQTWPAPVRQLQQLLSKIEDLLDATPLMPGEW-RY
PTPA1_DEBHA     ---------------------------------------------LLRILEVLNRYIDETPPL-KGPRRF
PTPA1_KLULA     ---------------------------------------------VVELLKRLSALIDETPP-ERMHSRY
PTPA1_YEAST     ------------------------------------------VNGLMGVLDKLAHLIDETPPLP-GPRRY
PTPA1_CANGA     -------------------------------------------------LDRLDQLVSETPPIP-GPRRY
PTPA1_ASPFU     ---------------------------------------------------------------DTGPRRF
PTPA1_NEUCR     ----------------------------------------ESIKKLQRLLKKVEAIIDEAPP-DPGPRRF
PTPA1_CRYNE     ------------------------------------------IRSLMNMLDQMTSWVEDATPQPQSNQRF
PTPA1_ASHGO     --------------------------------------------RFVCILERLDALMDETPPRTGSARRF
PTPA1_USTMA     TDVEAWKASAAYSIYTLFLQRVCEACVGKPTRLPTRSTDAPVVDKLVSLLWELDQEIEPH----EKPQRF
PTPA1_CANAL     ---------------------------------------------LIELFQYLNKLIDETPPL-KGPTRF
PTPA_ENCCU      ----------------------------------------------------------------------
DTML1_DICDI     ----------------------------------------------------------KLPPTESNGTKY


                         +         .         .         .         .         *         .:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
PTPA2_ASPFU     GNPAFRDLFDDVAAQNATWHREIIGLQNADAIEEVSSYLVHSLGSRDRLDYGSGHELNFMMWLLCLRQMQ
PTPA2_EMENI     GNPAFRDLFDDVAAQSPAWLRDILGIEDAAAVNEISTYLIHSLGSRDRLDYGSGHELNFMMWLLCLRQLG
PTPA2_ASPOR     GNPAFRDLFDDVAAQSAKWHREILGIQDSTAIEEASAYLIHSLGSRDRLDYGSGHELNFMMWLLCLRQMQ
PTPA2_NEUCR     GNKTFRLFLDKVKQRGHQWHAAFLGGKLPAAVTEASAYLNQSFGNRTRIDYGSGHELNFIMWLLCLYQLS
PTPA2_GIBZE     GNKAFRGLLDLAQKNSAAWHHDI-GVQNEDAINELSTYFCESFGNANRIDYGSGHELNFMIWXXXXXXXX
PTPA2_CRYNE     GNPAFKTFYDKVGDASLELHKRIPGLPEEA-IQEVEVYFKESWGNKQRVDYGSGMELNFLSWLLCLAKLG
PTPA2_YARLI     GKPEFRDFHQALEENAKDWISDLGELEDWQLVE-LCTYFAASFGDRTRIDFGSGHELNFICFLFCLRQLG
PTPA2_CANAL     GKIEFRDFYSDLSSKAEEYISEITA----TAIQETSAYFIESWGNSTRIDYGSGHELNFICFLLCLKELG
PTPA2_YEAST     GKVEFRDFYDEVSRNS----RKILRSEFPSLLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYG
PTPA2_SCHPO     GNPAFQSFYDQVYIETPKLHQ-VFGIEHNAAME-AGRYFYESFGNRKRIDYGSGHELYFMSWLLILKQLG
PTPA2_KLULA     GKIEFRDFYDDISEHSNELISKIFGIEKPGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESK
PTPA2_DEBHA     GKIEFRDFYDEICKKSFDILKPLVEKDDPRI--ELATYFNESWGNRTRIDYGSGHELNFIAFLACLQKLG
PTPA2_CANGA     GKVEFRDFYDDVCEKA----DDLLSSHFPALIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYK
PTPA2_ASHGO     GKVEFRDFHKEVQARAEALVLQVPSLTDEQA-QELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYG
PTPA2_USTMA     GNPAFRTFYAKIRENTDRLHRMIPGLETDAARAELSVYFQECWGNEKRIDYGSGMELNMACWXXXXXXXX
PTPA2_DICDI     GNESFVEWFNKVEKETPKLLFNLINLNTPITNEEISTYLQNSWGDKQRIDYGSGHELNFICFLLCLVKIK
PTPA1_DICDI     GNKAYRTFYQKLLDNVEELHKHLLPQSMHSSIIELSSYLMDAMGNQTRLDYGTGHELHFVVWTYCLRRIG
PTPA_BOVIN      GNKAYRTWYAKLDQEAENLVATVVPTNLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
PTPA_HUMAN      GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
PTPA_MOUSE      GNKAYRTWYAKLDQEAENLVATVVPTHLAAAVPEVAVYLKEAVGNSTRIDYGTGHEXXXXXXXXXXXKIG
PTPA_RABIT      GNKAYRTWYAKLDEEAEGXXXXXXXXXXXXXXXXXXXYLKESVGNSTRIDYGTGHEXXXXXXXXXXXKIG
PTPA1_SCHPO     GNPAFRIWHEKLRDSASQIMDIIIPDSLSKAKVELLDYFLGSFGNSQRIDFGTGHELNFLGFIKXXXXXX
PTPA1_YARLI     GNVAVRDWHDKMEAQTTALLTEAFPSINKDSIIELQYYLHGGMGSKQRLDFGTGHELSFMAFVGGLQKLG
PTPA1_EMENI     GNISFRRWYEMVESRAASLSKEILQMPSPTAEVELLAYFLGSWGSPQRLDYGTGHELSFLAFLAGIWKLH
PTPA1_GIBZE     GNVSFR-----------KWHAIFXXVGDGKAKEEVSLYLLGGFGSVQRLDYGTGHELSFVAFLGCLWKLG
PTPA1_ASPOR     ANGAFQVWHDKVKKATPSLLAECLPAEGPTAEVELTEYFLGSWGSRERMDYGTGHELSFLTFLGAIWKLN
PTPA1_DEBHA     GNLACRDWHEDLLKDNIKIHNSSFNSEFDGFIKELKYYIENSFGSAIRLDYGTGHELSFLAFIGGLIDFK
PTPA1_KLULA     GNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLK
PTPA1_YEAST     GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG
PTPA1_CANGA     GNMACRDWHEKIEREIPGLLEDLISSHFPSELQELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLG
PTPA1_ASPFU     GNISFRRWYELVESRASELLGECLPSEDPNSVTELKAYFLGSWGSPQRLDYGTGHELSFLA-----FLAG
PTPA1_NEUCR     GNVSFRTWFKLLEERALRWEQGAXXXXXXGPLEELKAYFLGGFGSAQRLDYGTGHELSFIMFLGGLWKLX
PTPA1_CRYNE     GNLAFRT-YNKLLQERLPPLIDSWDIPSNLRSQLLPLFISHAFGHPTRLDYGTGHELAFVLGLWCCVVPG
PTPA1_ASHGO     GDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLG
PTPA1_USTMA     GNLAFRDWGARLEERIXXXXXXXXPSRLHAFAVELRVYLLDSFGSFTRIDYGSGHELAFFAWLCFLYRLG
PTPA1_CANAL     GNFACRDWHDKIDIIPIKFPQELXXXXXXXXLLESSYYLLNSFGSKIRLDYGTGHELSFLAFIGSLIEFK
PTPA_ENCCU      -------------------------------------YLRNSFGNQIRLDYGTGHELNFLCYLYAQYCRG
DTML1_DICDI     ST----------VHHSIRIPKDWM---KPKMKIQFSTMLL-----KSEFFFPNGHETNLNMWLLPFYLFG


                         .         .         .         +         .         .         .:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
PTPA2_ASPFU     MISTADFPMIVFRVYLEYMRLMRQVQMTYYLEPAGSHGVWGLDDYHFLPFLFGAAQLVDHPYITPLAIHN
PTPA2_EMENI     LFSEPDFEAIVFHVYVRYMRLMREVQSTYYLEPAGSHGVWGLDDYHFLPFLFGAAQLVGHPYITPLAIHN
PTPA2_ASPOR     LYSTADFEMIVFRVYVTYMHLMRDVQSAYYLEPAGSHGVWGLDDYHFLPFLFGAAQLVEHPYITPLAIHN
PTPA2_NEUCR     VLEQSDFKAVVLRVFARYLEVMRLIQMTYYLEPAGSHGVWGLDDYQFLPFLFGASQLLHHHFITPRAIHQ
PTPA2_GIBZE     XXKQSDFKPIVLRVFVRYLEVMRVIQMTYYLEPAGSHGVWGLDDYQFLPFLFGATQLLHHPYITPRAIHQ
PTPA2_CRYNE     VVTKEDYPFLVLGVFWRYIEVMRYLQSTYWLEPAGSHGVWGLDDYHFLPFLWGSGQLRNHKYLRPKAIHD
PTPA2_YARLI     LLD-TDSSAAVLTVFVQYLKTMRAVQASYWLEPAGSHGVWGLDDYHFLPFMFGSAQLACHKYLRPLSIHD
PTPA2_CANAL     QITSADYEGLVLKVFTQYMSIMRKLQKEYWLEPAGSHGVWGLDDYHFLPFLFGAAQLSTHPHMKPKSIHN
PTPA2_YEAST     IFNSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHN
PTPA2_SCHPO     IFTKNDYPALVVRVFVKYVELMRSLQIFYTLEPAGSHGVWGLDDFHFLPFLFGAAQLVNHKYLRPKHVRD
PTPA2_KLULA     VFDENDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHN
PTPA2_DEBHA     IIKHEDYPCVIVRVFTKYMTVMRALQKLYWLEPAGSHGVWGLDDYHFLPFLFGSSQLATHPHMKPKSIHN
PTPA2_CANGA     IFDQRDARNLVLVLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHN
PTPA2_ASHGO     VLSEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPKSIHN
PTPA2_USTMA     XXXXEDGACIVLRIFWTYVQVMRDIQSSYWLEPAGSHGVWGLDDYHFLPFLWGAGQLSSHRHLRPKAIHD
PTPA2_DICDI     FIKREEYELLVLIIFNKYLNMMRRLQESYWLEPAGSHGVWGLDDYHFLPFLFGSSQLIEHKYIRPKSIRN
PTPA1_DICDI     FLKSTDEEDIVLNVFTTYLDLVRKLQRVYGLEPAGTHGVWSLDDYQFIPFIWGASQLIGNPFIKPASVTI
PTPA_BOVIN      VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
PTPA_HUMAN      VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
PTPA_MOUSE      VLRVDDQVAIVFKVFDRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPHLEPRHFVD
PTPA_RABIT      VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPFLEPRHFVD
PTPA1_SCHPO     XXXXXXYKAIALYITHVYLEVCRELVQTYRLEPAGSHGVWGLDDHFFIPYIFGSAQLASSSIIKPDAILN
PTPA1_YARLI     LLETDLPAPDVLFIFETYFVLVRKLIMTYSLEPAGSHGVWGLDDHSHLPYILGSAQKVSRSVTAPSSVMN
PTPA1_EMENI     GFPENSPGVIVLGVIQPYLELVRTIIKRYTLEPAGSHGVWGLDDHSFIPYIFGSAQLA--PAISPGGVTK
PTPA1_GIBZE     FFKDGEQGEIVLKIIEPYLNVVRKLILTYTLEPAGSHGVWGLDDHSFMPYIFGSAQLTGAP--KPSDVTK
PTPA1_ASPOR     GFPKNEPGVIVLGVIEPYLELIRAVIKKYKLEPAGSHGVWGLDDHSFIPYIFGSAQLTGSDAVDPDGVTK
PTPA1_DEBHA     LLSLEELTGSILTIFAKYYDLTRRLILVYSLEPAGSHGVWGLDDHYHLIYIFGAAQFNGDKIIPPVQILT
PTPA1_KLULA     IETIKGPALLYC--FNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDNTSLIPKDISN
PTPA1_YEAST     M-----FPHMVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQLDAQAPLQPREILD
PTPA1_CANGA     ASFDGDQ---VLYIFDRYYSLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAPNDLSD
PTPA1_ASPFU     IWKLNGFPAIVLGVIQPYLELVRTIIKRYTLEPAGSHGVWGLDDHSFIPYILGSAQLAGAP--SPNGVTK
PTPA1_NEUCR     XXXXXXXXXIVLGVVEPYLRVIRRLILTYTLEPAGSHGVWGLDDHSFVPYIFGSAQYTNEP--TPLEITK
PTPA1_CRYNE     WVGGDNXXXLILRVFTRYLELTTFLQKTYNLEPAGSHGVWGLDDYCFLPYLFGSAQLLGSNXXXXXXXXX
PTPA1_ASHGO     LWTEDKFTEDMLYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVQPSDILD
PTPA1_USTMA     FFDASDIQVIGLDIFPLYLMVVWKLQDRYGLEPAGSHGVWGLDDFQFLPYVIGAAQLRRQSGLRPNQVHA
PTPA1_CANAL     ILNHNGKEILI--IFANYYDLVRRLILVYNLEPAGSHGVWGLDDHFHLIYILGASQFINDKLIVQRSLSS
PTPA_ENCCU      SIGID----CVFTILVKYFEIVRLFITKFNLEPAGSHGMWGLDDYQFLPFLFGSSEL----------CNT
DTML1_DICDI     ANDTNTQPLSV-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
PTPA2_ASPFU     TAVLDEEGDKYIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWLKIEGGMKKMFIKEVLGKLPIMQHF
PTPA2_EMENI     TAILDEEGDRYLYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWTKIESGMKKMFVKEVLGKLPIMQHF
PTPA2_ASPOR     NVILDEEGDRYIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWSKIESGMKKMFVKEVLGKLPIMQHF
PTPA2_NEUCR     ELTLEEFGHDFLYLGQVAFVNSTKTVKGLRWHSPMLDDISSAKNWEKIEGGMRRMFVSEVLKKLPVMQHF
PTPA2_GIBZE     DLTLEEFGHEYMYLGQVSFVNSTKTVKGLRWHSPMLDDISSARSWTKIDGGMRRMFVAEVLGKLPVMQHF
PTPA2_CRYNE     PEILGEFSKDYMYLSCIEFINSIKTA-SLRWHSPMLDDISAVKTWEKVNQGMKKMFVAEVLGKLPVMQHA
PTPA2_YARLI     MEMLDMWKHEYLYMGCIHFINSVKTTASLRWHSPMLDDISGVKTWAKVNQGMVKMYDAEVLSKLPILQHF
PTPA2_CANAL     DELVEMYSTKYMYFECINFINKIKTIPSLRWHSPMLDDISAAKNWDKIREGMVKMYKVEVLGKLPIMQHF
PTPA2_YEAST     NELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHF
PTPA2_SCHPO     PEILEMCRADYMYLGYVYFLNKLKPSVSLRFHSPMIDDISAVKTWSKVNEGMIKMYRAEVLGKLPIMQHY
PTPA2_KLULA     PEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDISGVKRWSKVAEGMVKMYKAEVLQKLPIMQHF
PTPA2_DEBHA     EELVESFYKQYMYLECIHFINTIKTTPSLRWHSPMLDDISSAKSWAKIKEGMIKMYKAEVLGKLPIVQHF
PTPA2_CANGA     EELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKMYKAEVLGKLPIMQHF
PTPA2_ASHGO     PEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDISGVRSWTKVSEGMVKMYKAEVLGKLPIMQHF
PTPA2_USTMA     AEIVDEFAPKYMYLACIQFINSVKTA-SLRWHSPMLDDISGAKSWSKVNQGMIKMYRAEVLKKLPIAQHI
PTPA2_DICDI     DEIVNSSSDEYMYLGCIRFIGKVKSGGSLLEHSPMLVDISGVKNWSKVNEGMIKMFKSEVLGKLPIMQHM
PTPA1_DICDI     EKVVDQYYKEYLYIACIKYINTVK--KGFHEHSRDLFNISGAASWQKINTGMMKKFYDDVLSKVPIIQHF
PTPA_BOVIN      EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
PTPA_HUMAN      EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
PTPA_MOUSE      EKAVSENHKDYMFLQCILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
PTPA_RABIT      EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
PTPA1_SCHPO     KKIVDEKANSNLYFSAIKFINVMK--KGPFYHSPILYDITAVPIWSKVNQGLIKMYDVEVLSKYPVVQHF
PTPA1_YARLI     PRIVQQQKTTNLYFAAIAFIYDIKSGPFYE-HSPILYDISGIATWAKIHSGMIKMYIAEVLGKFPVVQHF
PTPA1_EMENI     ANVVERERKHNLYFSAIGFIYDVK--RGPFWHSPMLYDISGIQGWAKINKGMIKMYNAEVLSKFPVVQHF
PTPA1_GIBZE     AVVVEDQRQVNMYFSAIGFINDVK--KGPFWHSPILFDISGIRDWGKINKGMIKMFNAEVLSKFPVVQHF
PTPA1_ASPOR     ANVVEKERKVNMYFSAIGFINDVK--KGPFWHSQMLYNISGVQGWAKINKGMIKMYNAEVLSKFPVVQHF
PTPA1_DEBHA     RPVLDRYKETNLYVNAISFIHKIKS-GPFNEHSPIIFDISSVSLWSKVLSGLLKMFEVEVLGKFPVVQHF
PTPA1_KLULA     TRLMEQNSSSNLFCKSIRFINVVKS-GPFSNHSPLLYNISSVHTWHKMQQGLIKMYKVEVLNKFPVVQHF
PTPA1_YEAST     KSLVREYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIATVPRWSKVCKGLLKMYSVEVLKKFPVVQHF
PTPA1_CANGA     PVLVEQYSRTNIFCKTLNFVFTVKS-GAFREHSPMLFDISSVRTWAKVRKGLWKMYKDEVLNKFPVIQHF
PTPA1_ASPFU     AHIVERERLTNMYFSAIGFIYDVK--KGPFWHSPMLYDISGIQGWGKINKGMIKMYNAEVLSKFPVVQHF
PTPA1_NEUCR     PTAVERYRTENMYFSAIGFIYDVK--KGPFWHSPILFDVSGIKDWGKINKGMIKMYNAEVLSKFPVVQHF
PTPA1_CRYNE     XXXXXXXXXXXLYTLSLHHLTLFKFGASFSEHSPLLYSLSQMPNWVKPHGGLKKMFLGEVVGKRVVVQGW
PTPA1_ASHGO     PKAVARYSETNLYCNSIAFLLRVKT-GHFAQHSPMLHDIATVPTWSKVTTGLIKMYRVEVLNKFPVVQHF
PTPA1_USTMA     SILQTQLATRTLYLSSLLRIHVLKR-GPFHEHSPLLNDISSVPNWLKVYFGMLKMYAAECLAKKVVVQHF
PTPA1_CANAL     QVINSCKLTNF-YINAIAFIFRLKT-GPFNEHSPIIFDINKVFSWTKVRQGLIKMYMVEVFNKFPVLQHF
PTPA_ENCCU      TLRFDELDGSKCYF--------VAVEKKLGGSSRILKSIMD-KDWASINRGMIRMYDDHVLRRSVVTQHF
DTML1_DICDI     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LFGSLIPALPEMGERNEKAEQPDXXXXXXXXXXXXXQNDFWGDCCGIKVPSAVAAGEEMRKRQGGTGLRP
PTPA2_ASPFU     LFGSLLPADPSMGERSDDA-QEDDLHDHGNGNPHARHTDHFGDCCGIKVPSTVAAGAEMRKRIGGTGLRP
PTPA2_EMENI     LFGSLLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQQDWFGDCCGIKVPSTVAAGQEMRKRMGGSSLRP
PTPA2_ASPOR     LFGSLIPAAPGMGEADDVXXXXXXXXXXXXXXXXXXXXXF-GDCCGIKVPSTVAAGAEARKR--GTGLRP
PTPA2_NEUCR     LFGSLIPAAEGMSEQDPNALGSXXXXXXXXXXXXYDDSDGWGDCCGIKVPSSLAAAEEMRKRGQVESLRR
PTPA2_GIBZE     LFGSLVPADDSMSEAGDEADVEDDPHAGHDHTGKAHDGTGWGDCCGIKVPSSIAAAQEMKKRGMNQGLRR
PTPA2_CRYNE     LFGSLLPPTPEEDPELKRAEEDGQSATDMHGHIHDPSEKGWSDCCGIPVPSAFAAAQDANSHKGRPGIKP
PTPA2_YARLI     MFGQLIKA-PE-----GVSPPPDPNAEVQHI------HNHWADCCGIKVPSAIAASEMSQKKLRGSGV--
PTPA2_CANAL     MFGSLLEGIPEHTDENGHGENPEDHCGHAHV-------NTWGDCCGIKIPSGIAASESLKHERKGN----
PTPA2_YEAST     YFSEFLPVSPPRGHIHDGTDKDDECNFEGHV------HTTWGDCCGIKLPSAIAATEMNKKHH-----KP
PTPA2_SCHPO     LFGHLIPASPGMSPAPQDGDDSEVTHV----------HSHYADCCGIKIPSAISAAKNNGSR--------
PTPA2_KLULA     YFGYFLKCPEGVSEPSARAQ--DHHEDDSCCTDGSHGHSTWADCCGIAVPSAIAASQMANK-----DVRL
PTPA2_DEBHA     MFGSIIPCPDGVSEYHEXXXXXXXXXXXXXTV------NTWGDCCGIKIPSALAASE-------------
PTPA2_CANGA     YFSEFL-VCPE-GISEPRTHIHNXXXXXXXXXXXXXXHNTWGDCCGIKIPSLYAANAMEKQSH-----KP
PTPA2_ASHGO     FFSRFLP-VPD-------GVSPPRTSEEELADCSEHAHSTWGDCCGIPIPSAVAASEATRKHS-----KP
PTPA2_USTMA     FFGSLL-RFPEPATGXXXXXXXHPAGKPHAHGTGEGQAAGWGDCCGIPIPSAFAAAEQEKKRQQGTGVRR
PTPA2_DICDI     FFASIIQYIPDIIETDEEINQ-------------------------------------------------
PTPA1_DICDI     LFGSLI----------------------------------------------------------------
PTPA_BOVIN      KFGSLLPIHPVM----------------------------------------------------------
PTPA_HUMAN      KFGSLLPIHP------------------------------------------------------------
PTPA_MOUSE      KFGSLLPIHP------------------------------------------------------------
PTPA_RABIT      KFGSLLPIHP------------------------------------------------------------
PTPA1_SCHPO     HFGNLFPFNP------------------------------------------------------------
PTPA1_YARLI     YFGS------------------------------------------------------------------
PTPA1_EMENI     PFGSL-----------------------------------------------------------------
PTPA1_GIBZE     PFGSL-----------------------------------------------------------------
PTPA1_ASPOR     RFGSL-----------------------------------------------------------------
PTPA1_DEBHA     WFGS------------------------------------------------------------------
PTPA1_KLULA     WFGT------------------------------------------------------------------
PTPA1_YEAST     WFGT------------------------------------------------------------------
PTPA1_CANGA     WFGT------------------------------------------------------------------
PTPA1_ASPFU     PFGSL-----------------------------------------------------------------
PTPA1_NEUCR     PFGSL-----------------------------------------------------------------
PTPA1_CRYNE     CWGEDVPNVEERGDKNE-----------------------------------------------------
PTPA1_ASHGO     WFGT------------------------------------------------------------------
PTPA1_USTMA     AFGGV-----------------------------------------------------------------
PTPA1_CANAL     WCGEVL----------------------------------------------------------------
PTPA_ENCCU      IYGEYL----------------------------------------------------------------
DTML1_DICDI     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IPFD
PTPA2_ASPFU     IPFD
PTPA2_EMENI     IPFD
PTPA2_ASPOR     IPFD
PTPA2_NEUCR     IPFD
PTPA2_GIBZE     IPFD
PTPA2_CRYNE     IPFD
PTPA2_YARLI     LPFD
PTPA2_CANAL     IPFD
PTPA2_YEAST     IPFD
PTPA2_SCHPO     IPFD
PTPA2_KLULA     FPFD
PTPA2_DEBHA     ----
PTPA2_CANGA     IPFD
PTPA2_ASHGO     LPFD
PTPA2_USTMA     IPFD
PTPA2_DICDI     ----
PTPA1_DICDI     ----
PTPA_BOVIN      ----
PTPA_HUMAN      ----
PTPA_MOUSE      ----
PTPA_RABIT      ----
PTPA1_SCHPO     ----
PTPA1_YARLI     ----
PTPA1_EMENI     ----
PTPA1_GIBZE     ----
PTPA1_ASPOR     ----
PTPA1_DEBHA     ----
PTPA1_KLULA     ----
PTPA1_YEAST     ----
PTPA1_CANGA     ----
PTPA1_ASPFU     ----
PTPA1_NEUCR     ----
PTPA1_CRYNE     ----
PTPA1_ASHGO     ----
PTPA1_USTMA     ----
PTPA1_CANAL     ----
PTPA_ENCCU      ----
DTML1_DICDI     ----