[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02554

[Show Plain Result]


## Summary of Sequence Search
    1::149
   26::136     2e-47  81%  138 aa  IF1A_SCHPO RecName: Full=Eukaryotic translation initiation factor
   26::122     2e-45  86%  144 aa  IF1AY_PANTR RecName: Full=Eukaryotic translation initiation factor
   26::122     2e-45  86%  144 aa  IF1AY_HUMAN RecName: Full=Eukaryotic translation initiation factor
   26::122     3e-45  85%  144 aa  IF1AX_PONAB RecName: Full=Eukaryotic translation initiation factor
   26::122     3e-45  85%  144 aa  IF1AX_MOUSE RecName: Full=Eukaryotic translation initiation factor
   26::122     3e-45  85%  144 aa  IF1AX_HUMAN RecName: Full=Eukaryotic translation initiation factor
   26::122     5e-45  84%  144 aa  IF1A_RAT RecName: Full=Eukaryotic translation initiation factor 1A;
   26::122     5e-45  84%  144 aa  IF1A_MOUSE RecName: Full=Eukaryotic translation initiation factor
   26::122     2e-43  82%  144 aa  IF1A_RABIT RecName: Full=Eukaryotic translation initiation factor
   25::141     4e-43  72%  141 aa  IF1A_DICDI RecName: Full=Eukaryotic translation initiation factor
   26::132     9e-42  71%  153 aa  IF1A_YEAST RecName: Full=Eukaryotic translation initiation factor
   26::143     7e-39  63%  145 aa  IF1A_ONOVI RecName: Full=Eukaryotic translation initiation factor
   26::116     4e-36  71%  144 aa  IF1A_WHEAT RecName: Full=Eukaryotic translation initiation factor
   19::92      2e-17  47%  108 aa  IF1A_SULIY RecName: Full=Translation initiation factor 1A;       
   19::92      2e-17  47%  108 aa  IF1A_SULIN RecName: Full=Translation initiation factor 1A;       
   19::92      2e-17  47%  108 aa  IF1A_SULIM RecName: Full=Translation initiation factor 1A;       
   19::92      2e-17  47%  108 aa  IF1A_SULIL RecName: Full=Translation initiation factor 1A;       
   19::92      2e-17  47%  108 aa  IF1A_SULIK RecName: Full=Translation initiation factor 1A;       
   19::92      2e-17  47%  108 aa  IF1A_SULIA RecName: Full=Translation initiation factor 1A;       
   19::92      3e-17  47%  108 aa  IF1A_SULSO RecName: Full=Translation initiation factor 1A;       
   17::98      1e-16  43%  111 aa  IF1A_METKA RecName: Full=Translation initiation factor 1A;       
   25::106     5e-16  46%  116 aa  IF1A_DESK1 RecName: Full=Translation initiation factor 1A;       
   14::96      6e-16  41%   97 aa  IF1A_NATPD RecName: Full=Translation initiation factor 1A;       
   10::95      6e-16  38%   95 aa  IF1A_HALMA RecName: Full=Translation initiation factor 1A;       
   20::93      1e-15  43%  108 aa  IF1A_SULTO RecName: Full=Translation initiation factor 1A;       
   11::94      1e-15  38%   95 aa  IF1A_HALS3 RecName: Full=Translation initiation factor 1A;       
   11::94      1e-15  38%   95 aa  IF1A1_HALSA RecName: Full=Translation initiation factor 1A 1;      
   17::99      1e-15  41%  108 aa  IF1A_PICTO RecName: Full=Translation initiation factor 1A;       
   12::95      3e-15  37%   96 aa  IF1A1_HALWD RecName: Full=Translation initiation factor 1A 1;      
   19::92      7e-15  43%  108 aa  IF1A_METS5 RecName: Full=Translation initiation factor 1A;       
   16::101     9e-15  41%  111 aa  IF1A_AERPE RecName: Full=Translation initiation factor 1A;       
   20::92      1e-14  41%  108 aa  IF1A_SULAC RecName: Full=Translation initiation factor 1A;       
   15::95      6e-14  35%   97 aa  IF1A_ARCFU RecName: Full=Translation initiation factor 1A;       
   35::117     1e-13  37%  123 aa  IF1A_THEVO RecName: Full=Translation initiation factor 1A;       
   31::113     1e-13  37%  119 aa  IF1A_THEAC RecName: Full=Translation initiation factor 1A;       
   37::109     2e-13  44%  111 aa  IF1A_METST RecName: Full=Translation initiation factor 1A;       
   29::109     1e-12  37%  111 aa  IF1A1_METAC RecName: Full=Translation initiation factor 1A 1;      
   25::97      2e-12  38%   99 aa  IF1A_METTH RecName: Full=Translation initiation factor 1A;       
   17::100     2e-12  35%  102 aa  IF1A_METJA RecName: Full=Translation initiation factor 1A;       
   10::93      2e-12  32%   94 aa  IF1A2_HALWD RecName: Full=Translation initiation factor 1A 2;      
   15::95      2e-12  37%   96 aa  IF1A1_METBF RecName: Full=Translation initiation factor 1A 1;      
   25::105     7e-12  35%  106 aa  IF1A_METBU RecName: Full=Translation initiation factor 1A;       
   25::105     7e-12  38%  106 aa  IF1A2_METMA RecName: Full=Translation initiation factor 1A 2;      
   24::104     7e-12  37%  105 aa  IF1A2_METAC RecName: Full=Translation initiation factor 1A 2;      
   36::109     7e-12  39%  111 aa  IF1A1_METMA RecName: Full=Translation initiation factor 1A 1;      
   16::103     1e-11  35%  105 aa  IF1A_META3 RecName: Full=Translation initiation factor 1A;       
   29::109     1e-11  35%  110 aa  IF1A3_METAC RecName: Full=Translation initiation factor 1A 3;      
   34::114     2e-11  35%  115 aa  IF1A2_METBF RecName: Full=Translation initiation factor 1A 2;      
   10::93      2e-11  32%   94 aa  IF1A2_HALSA RecName: Full=Translation initiation factor 1A 2;      
   19::100     1e-10  33%  104 aa  IF1A_METMP RecName: Full=Translation initiation factor 1A;       
   19::100     1e-10  33%  104 aa  IF1A_METM7 RecName: Full=Translation initiation factor 1A;       
   19::100     1e-10  33%  104 aa  IF1A_METM6 RecName: Full=Translation initiation factor 1A;       
   18::99      1e-10  33%  103 aa  IF1A_METM5 RecName: Full=Translation initiation factor 1A;       
   29::102     4e-10  34%  105 aa  IF1A_METLZ RecName: Full=Translation initiation factor 1A;       
   24::107     5e-10  29%  117 aa  IF1A_PYRKO RecName: Full=Translation initiation factor 1A;       
   22::104     9e-10  33%  115 aa  IF1A_PYRHO RecName: Full=Translation initiation factor 1A;       
   22::104     9e-10  33%  115 aa  IF1A_PYRAB RecName: Full=Translation initiation factor 1A;       
   26::102     3e-09  31%  114 aa  IF1A_PYRAE RecName: Full=Translation initiation factor 1A;       
   23::136     1e-07  27%  179 aa  EIF1A_XENTR RecName: Full=Probable RNA-binding protein
   23::118     2e-07  28%  172 aa  EIF1A_DANRE RecName: Full=Probable RNA-binding protein
   23::141     4e-07  26%  169 aa  EIF1A_XENLA RecName: Full=Probable RNA-binding protein
   25::113     9e-07  28%  166 aa  EIF1A_BOVIN RecName: Full=Probable RNA-binding protein
   25::105     3e-06  28%  166 aa  EIF1A_PONAB RecName: Full=Probable RNA-binding protein
   25::105     3e-06  28%  165 aa  EIF1A_MACFA RecName: Full=Probable RNA-binding protein
   25::105     3e-06  28%  165 aa  EIF1A_HUMAN RecName: Full=Probable RNA-binding protein
   23::105     5e-06  29%  170 aa  EIF1A_MOUSE RecName: Full=Probable RNA-binding protein
   25::105     6e-06  26%  167 aa  EIF1A_RAT RecName: Full=Probable RNA-binding protein
   22::104     2e-05  26%  115 aa  IF1A_PYRFU RecName: Full=Translation initiation factor 1A;       
   13::72      1e-04  34%   73 aa  IF1_ACIC1 RecName: Full=Translation initiation factor IF-1;
   13::71      7e-04  36%   72 aa  IF1_SYNWW RecName: Full=Translation initiation factor IF-1;
   13::71      7e-04  31%   72 aa  IF1_PELTS RecName: Full=Translation initiation factor IF-1;
   14::71      0.001  33%   74 aa  IF1_THEM4 RecName: Full=Translation initiation factor IF-1;
    3::71      0.001  31%   72 aa  IF1_PARDP RecName: Full=Translation initiation factor IF-1;
   34::91      0.001  32%  109 aa  IF1C_PSEAK RecName: Full=Translation initiation factor IF-1,
   28::111     0.001  27%  163 aa  EIF1A_DROPS RecName: Full=Probable RNA-binding protein
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
IF1A_SCHPO      -------------------------LTYAEEGQMYAQVTKMLGNGRIEAACFDGVKRLGHIRGKLRKKVW
IF1AY_PANTR     -------------------------LVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVW
IF1AY_HUMAN     -------------------------LVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVW
IF1AX_PONAB     -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
IF1AX_MOUSE     -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
IF1AX_HUMAN     -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
IF1A_RAT        -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKLRKKVW
IF1A_MOUSE      -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKLRKKVW
IF1A_RABIT      -------------------------LVFKEDGQEYAQVIKMLGNGRLEAMLFDGVKRLFHIRGKLRKKVW
IF1A_DICDI      -------------------------LQFKEEGQEYAQVLRMLGNGRLEASCFDGEKRLCHISGRLRKKEW
IF1A_YEAST      -------------------------LIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVW
IF1A_ONOVI      -------------------------LVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVW
IF1A_WHEAT      -------------------------LVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCHIRGKMHKKVW
IF1A_SULIY      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULIN      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULIM      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULIL      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULIK      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULIA      -----------------------------EEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMW
IF1A_SULSO      -----------------------------EEGQTICVVKKMLGGDHLIVLCMDGKERLARIPGKIRKKMW
IF1A_METKA      -----------------------------KEGEIFGVVEKMLGNDRVQVRCVDGKTRVARIPGKMRKRVW
IF1A_DESK1      -----------------------------DEGTIICGVVRHLGGDYLIAKCLDGVDRKIRIPGKLRRKVW
IF1A_NATPD      ------------------------------EGDEFAVVTNMLGANRVKVRCMDGTERTARIPGRMQKRIW
IF1A_HALMA      -------------------------LRMPEEDEVFAVVMDMLGANRVKVRCMDGVERTARIPGKMQKRIW
IF1A_SULTO      ------------------------------EGEVICVVKKMLGAEHVQVICLDGKERLGRIPGKMKKKMW
IF1A_HALS3      -------------------------LRMPEDDEVFAEVTDMLGANRVQVRCADGEERTARIPGRMQKRIW
IF1A1_HALSA     -------------------------LRMPEDDEVFAEVTDMLGANRVQVRCADGEERTARIPGRMQKRIW
IF1A_PICTO      ----------------------------KKSGEIYGIVEKMSGASRLIVMCEDGVTRNCRIPGKMKKRMW
IF1A1_HALWD     -------------------------LRMPDDDEVFAVVTNMLGANRVTVRCADGNERTARIPGRMQKRIW
IF1A_METS5      -----------------------------EEGEVICVVKKMLGAEHIIIACLDGKERTARIPGRMRKKTW
IF1A_AERPE      -------------------------LPSEDEGTMLCIVQRVVGAGFLEVLCTDGEVYMARIPGKMRRRVW
IF1A_SULAC      ------------------------------EGEVICVVKKLFGGEHVQVICTDGKERLGRIPGKLKKKVW
IF1A_ARCFU      ----------------------------RKKGELFGVVTSMLGAGHIKVRCEDGVERLARIPGKMRKKIW
IF1A_THEVO      ----------------------------KKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMW
IF1A_THEAC      ----------------------------KKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMW
IF1A_METST      -------------------------------------VEQILGHGKLKVRCNDKQIRLCRIPGKMKKRIW
IF1A1_METAC     ----------------------------RENNEILATVESLLGANRLRLRCMDGVVRMGRIPGSMKKKTW
IF1A_METTH      -------------------------------------VEQIMGHGKLKVRCADGHIRLGRIPGKMKKRIW
IF1A_METJA      ----------------------------KEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIW
IF1A2_HALWD     -------------------------LRMPSDDEMFAVVVEHNGGNHVRVRCQDGENRMGRIPGRMKYRTW
IF1A1_METBF     ----------------------------RENHEVLATVSSLLGSKRVTLQCMDGVVRMGRIPGSKNKKMW
IF1A_METBU      ----------------------------RENNEILATVSALLGGKRVTLQCMDGIVRMGRIPGSKKKRMW
IF1A2_METMA     ----------------------------KENHEVLATVGSLLGSKRVNLQCMDGVVRMGRIPGSKNKKMW
IF1A2_METAC     ----------------------------KENHEVLATVGSLLGSKRVNLQCMDGVVRMGRIPGSKNKKMW
IF1A1_METMA     -----------------------------------ATVESLLGANRLRLRCMDGVVRMGRIPGSMKKKAW
IF1A_META3      --------------------------TPREENNEILGIIEMLGASRVRVRCMDGHTRMGRIPGKLKRKIW
IF1A3_METAC     ----------------------------KDRNEVLATVASLLGSKRVTLQCMDGVVRMGRIPGSKNKKMW
IF1A2_METBF     ----------------------------KDRNEVLATVLNLLGSKRVTLQCMDGVVRMGRIPGSKKKRMW
IF1A2_HALSA     -------------------------LRMPNDDEVFAVVKRHDGGNHVTLQCEDGKERMGRIPGRMKYRTW
IF1A_METMP      ----------------------------ENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIW
IF1A_METM7      ----------------------------ENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIW
IF1A_METM6      ----------------------------ENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIW
IF1A_METM5      ----------------------------ENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIW
IF1A_METLZ      --------------------------------EQFAQAELMLGSNHIRVRCSDGVTRLXXXXXXXXXXVW
IF1A_PYRKO      ----------------------------RSKGQLFGVIEQALGAGWMDVRCEDGKVRRCRIPGKLKRRMW
IF1A_PYRHO      -----------------------------EGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVW
IF1A_PYRAB      -----------------------------EGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVW
IF1A_PYRAE      ------------------------------EGEILGKVIEMLGDGRFKVICADGQIXXXXXXXXXXXXXX
EIF1A_XENTR     ---------------------------------EHQRIVKVLGNNLHEVETSEGERFLASMPTKFRKNIW
EIF1A_DANRE     ------------------------------EDQQIMRVLGSNGNNLHEAVTGSGERFLLSMPTKFRKNIW
EIF1A_XENLA     ---------------------------------EHQSIVKVLGNNLHEVETAEGERFLASMPTKFRKNIW
EIF1A_BOVIN     --------------------------------QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
EIF1A_PONAB     --------------------------------QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
EIF1A_MACFA     --------------------------------QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
EIF1A_HUMAN     --------------------------------QQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
EIF1A_MOUSE     ---------------------------------DHQQIVKVLGNNLHEVETAQGQRFLVSMPSKYRKNIW
EIF1A_RAT       --------------------------------QQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIW
IF1A_PYRFU      -----------------------------EGNQLFGVVEQALGAGWMDVRCEDGKVXXXXXXXXXXXXVW
IF1_ACIC1       ------------------------------------QVIEPLPNAMFRVELANGHKVLAHISGKMRMHIR
IF1_SYNWW       -------------------------------------VVEPLPNTMFKVELDNGHKVLAHISGKMRMNVR
IF1_PELTS       -------------------------------------VIEPLPNAMFRVELQNGHKVLAHVSGKIRMNIR
IF1_THEM4       -------------------------------------IVEALPNAMFRVELENGHKILAHISGKMRKNIR
IF1_PARDP       ----------------------------KEEMLEFPGVVKLLPNATFRVELENGHEIIAHMAGKMRKRIR
IF1C_PSEAK      -------------------------------------ITQCLSNGMFRVKLENGFKVIAHISGKIRRNIR
EIF1A_DROPS     ------------------------------EQQQIVRVVRSCGNNEVETATPESENFLVSMPNKYRKNMW


                         .         .         *         .         .         .         .:140
query           INQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGHEGLDDNVEFDEDRESAD
IF1A_SCHPO      INQGDIILLSLREFQDEKGDVILKYTADEARTLKNQGELPETAKINETDTFGAEGEDDDFEFDVD-----
IF1AY_PANTR     INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1AY_HUMAN     INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1AX_PONAB     INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1AX_MOUSE     INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1AX_HUMAN     INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1A_RAT        INTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1A_MOUSE      INTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1A_RABIT      INTSDIILVGLREYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------
IF1A_DICDI      INNGDIILIQLRDYQNDKADVILRYNVDEARNLKTYGELPETARINETDAF------DDVE-DIPFEFVA
IF1A_YEAST      MGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINETDNFGFES-DEDVNFE-------
IF1A_ONOVI      IAAGDIILVGLRDYQDDKADVILKLMPDEARLLKAYGELPDNTRLNE--GIGAGGLDEEMDTANDYIEFE
IF1A_WHEAT      IAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTVRLN------------------------
IF1A_SULIY      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULIN      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULIM      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULIL      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULIK      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULIA      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_SULSO      MREGDVVLVGIWDFQPNRCDILYKYGNDEIKRL-------------------------------------
IF1A_METKA      IREGDVVLVKPWEFQPERADVTWRYTRVQVDWLKRKGKLDE-----------------------------
IF1A_DESK1      ITEGDIILVGLWDFSSEKGEVVYKYGKNEVNKLVEKGVVPK-----------------------------
IF1A_NATPD      IREDDVVLVEPWDWQDEKADVVWRYEKQEADQLREEGHITDS----------------------------
IF1A_HALMA      IREDDVVLVEPWDWQDEKADITWRYEKQDADQLREEGHIQE-----------------------------
IF1A_SULTO      VKEGDVVLAAPWDFQPNKCDIIYKYSESEVRRLE------------------------------------
IF1A_HALS3      IREDDIVLVEPWDWQDDKADVTWRYEKSDADQLREEGHI-------------------------------
IF1A1_HALSA     IREDDIVLVEPWDWQDDKADVTWRYEKSDADQLREEGHI-------------------------------
IF1A_PICTO      IREGDLVIVKPWEFQDEKGDIIYRYTKTQAAYLSRNHMLPE-----------------------------
IF1A1_HALWD     IREDDVVLVEPWDWQDEKGDITWRYEKSEADQLREEGRI-------------------------------
IF1A_METS5      IKEGDVVLAAPWDFQPTKADIVYRYMNDEIRKL-------------------------------------
IF1A_AERPE      MREGDVVLFLPWGTADKKGEVVYRYLRDEVRKLIDMNLLPE-----------------------------
IF1A_SULAC      IREGDVVLAAPWDFQPNKCDIVYRYTESEVRRL-------------------------------------
IF1A_ARCFU      IREGDVVIVVPWSFQKDRADIVWRYTNPQVEWLERKGYL-------------------------------
IF1A_THEVO      IREKDLVIVKPWEFQPEKADVVYRYTKTQASYLSRNHMLPE-----------------------------
IF1A_THEAC      IREKDLVIVKPWEFQPEKADVVYRYTKTQASYLSRNHMLPE-----------------------------
IF1A_METST      IREGDVVLVKPWDFQDEKADVIWRYTRTEANYLERRGFL-------------------------------
IF1A1_METAC     IREGDVVIVVPWEFQNEKADVIWKYTRPQVDWLERKGYL-------------------------------
IF1A_METTH      IREGDVVLVKPWEFQEEKADIVWRYTRTESNWLERKGYL-------------------------------
IF1A_METJA      VREGDVVIVKPWEVQDQKCDIIWRYTKTQVEWLKRKGYLDE-----------------------------
IF1A2_HALWD     INEGDVVLVEPWAWQDEKANIEWRYSEQDAEQLRTEGHI-------------------------------
IF1A1_METBF     IHEGDVVIVAPWDIQDSKADVIWKYTRPQVEWLERKGYL-------------------------------
IF1A_METBU      VREGDIVIITPWDFQDSKAEVIWKYTRPQVEWLERKGFL-------------------------------
IF1A2_METMA     IREGDIVIATPWEIQDSKADVIWKYTRPQIEWLERKGYL-------------------------------
IF1A2_METAC     IREGDVVIVTPWEIQDTKADVIWKYTRPQIEWLERKGYL-------------------------------
IF1A1_METMA     IREGDVVIAVPWEFQNEKADVIWKYTRPQVDWLERKGYL-------------------------------
IF1A_META3      VREGDIVIVVPWEVQDQKCDIIWRYTKGQVSWLSKKGYLKQA----------------------------
IF1A3_METAC     VREGDVVIANPWEIQDSKADVIWKYTKPQVDWLERKGYL-------------------------------
IF1A2_METBF     IREGDIVIANPWEIQDSKADVTWKYTRPQVEWLERKGYL-------------------------------
IF1A2_HALSA     INEGDVVLAEPWDWQDEKANVEWRYSDQDADQLREEGHI-------------------------------
IF1A_METMP      VREDDVVIVTPWEVQDEKCDVIWRYTKGQVDWLNRKGYL-------------------------------
IF1A_METM7      VREDDVVIVTPWEVQDEKCDVIWRYTKGQVDWLNKKGYL-------------------------------
IF1A_METM6      VREDDVVIVTPWEVQDEKCDVIWRYTKGQVDWLNKKGYL-------------------------------
IF1A_METM5      VREDDVVIVTPWEVQDEKCDVIWRYTKGQVDWLNRKGYL-------------------------------
IF1A_METLZ      IREGDILIVVPWDFQDDKCDIIYRYTTPQVDWLRAH----------------------------------
IF1A_PYRKO      MRVGDVVIVQPWPVQDERGDIVYRYTRTQVDWLLRKGKITQ-----------------------------
IF1A_PYRHO      IRVGDLVIVQPWPVQDKRGDIVYRYTQTQVDWLLRKGKITQ-----------------------------
IF1A_PYRAB      IRVGDLVIVQPWPVQDKRGDIVYRYTQTQVDWLLRKGKITQ-----------------------------
IF1A_PYRAE      XKAGDYVIVALWDFDREKGDIVHKYEKRDVEELKRRG---------------------------------
EIF1A_XENTR     IKRGDFLIVDIAEGEKVKAEIAFILYKDHQRLLQKEGLWPEGFTQDKTGVVTKENENNGIQSTEALSTAQ
EIF1A_DANRE     IKRGDFVIVDIKEGGKVKGEISFILYRDHIQHLRKLGVWPEGFQEDRTSGERNEG---------------
EIF1A_XENLA     IKRGDFLIVDIVEGEKVKAEIAFILYKDHQRLLQKEGLWPEGFTQDKTGLVAKEKESSGIQSTEAQAKPQ
EIF1A_BOVIN     IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKDGHWPEASQVTEKD---------------------
EIF1A_PONAB     IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEA----------------------------
EIF1A_MACFA     IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEA----------------------------
EIF1A_HUMAN     IKRGDFLIVDIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEA----------------------------
EIF1A_MOUSE     IKRGDFLIVDIEEGEKVKAEISFVLCKNHVRSLQKEGHWPEA----------------------------
EIF1A_RAT       IKRGDFLIVDIEEGEKVKAEISFVLCKNHVRSLQKEGHWPEA----------------------------
IF1A_PYRFU      IKVGDLVIVEPWPVQDKRGDIVYRYTQTQVEWLLRKGKISQ-----------------------------
IF1_ACIC1       ILPGDRVVVELSPYDLNRGRIVYRY---------------------------------------------
IF1_SYNWW       ILPGDRVMVELSPYDLNRGRIIYRF---------------------------------------------
IF1_PELTS       ILAGDRVMVELSPYDLTRGRIVYRY---------------------------------------------
IF1_THEM4       LVPGDKVVVELTIYDLTKGRIVYR----------------------------------------------
IF1_PARDP       VLAGDKVQVEMNTYDLTKGRINYRF---------------------------------------------
IF1C_PSEAK      ILLGDSVIVELSPYDLTRGRIIYR----------------------------------------------
EIF1A_DROPS     VKRGDFLLVEPIEEGDKKAEISKILTNDHVKEYTKAGIWPE-----------------------------


                         +         .         .         .         .         *         .:210
query           EKDIDIDEI
IF1A_SCHPO      ---------
IF1AY_PANTR     ---------
IF1AY_HUMAN     ---------
IF1AX_PONAB     ---------
IF1AX_MOUSE     ---------
IF1AX_HUMAN     ---------
IF1A_RAT        ---------
IF1A_MOUSE      ---------
IF1A_RABIT      ---------
IF1A_DICDI      EDDIDIDTL
IF1A_YEAST      ---------
IF1A_ONOVI      DEDID----
IF1A_WHEAT      ---------
IF1A_SULIY      ---------
IF1A_SULIN      ---------
IF1A_SULIM      ---------
IF1A_SULIL      ---------
IF1A_SULIK      ---------
IF1A_SULIA      ---------
IF1A_SULSO      ---------
IF1A_METKA      ---------
IF1A_DESK1      ---------
IF1A_NATPD      ---------
IF1A_HALMA      ---------
IF1A_SULTO      ---------
IF1A_HALS3      ---------
IF1A1_HALSA     ---------
IF1A_PICTO      ---------
IF1A1_HALWD     ---------
IF1A_METS5      ---------
IF1A_AERPE      ---------
IF1A_SULAC      ---------
IF1A_ARCFU      ---------
IF1A_THEVO      ---------
IF1A_THEAC      ---------
IF1A_METST      ---------
IF1A1_METAC     ---------
IF1A_METTH      ---------
IF1A_METJA      ---------
IF1A2_HALWD     ---------
IF1A1_METBF     ---------
IF1A_METBU      ---------
IF1A2_METMA     ---------
IF1A2_METAC     ---------
IF1A1_METMA     ---------
IF1A_META3      ---------
IF1A3_METAC     ---------
IF1A2_METBF     ---------
IF1A2_HALSA     ---------
IF1A_METMP      ---------
IF1A_METM7      ---------
IF1A_METM6      ---------
IF1A_METM5      ---------
IF1A_METLZ      ---------
IF1A_PYRKO      ---------
IF1A_PYRHO      ---------
IF1A_PYRAB      ---------
IF1A_PYRAE      ---------
EIF1A_XENTR     AKE------
EIF1A_DANRE     ---------
EIF1A_XENLA     GEDSETDD-
EIF1A_BOVIN     ---------
EIF1A_PONAB     ---------
EIF1A_MACFA     ---------
EIF1A_HUMAN     ---------
EIF1A_MOUSE     ---------
EIF1A_RAT       ---------
IF1A_PYRFU      ---------
IF1_ACIC1       ---------
IF1_SYNWW       ---------
IF1_PELTS       ---------
IF1_THEM4       ---------
IF1_PARDP       ---------
IF1C_PSEAK      ---------
EIF1A_DROPS     ---------