[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02566

[Show Plain Result]


## Summary of Sequence Search
    1::287
    9::160     1e-12  35%  224 aa  APTH1_SCHPO RecName: Full=Acyl-protein thioesterase 1;       
    2::209     4e-12  32%  232 aa  APTH1_DEBHA RecName: Full=Acyl-protein thioesterase 1;       
   10::189     4e-12  33%  238 aa  APTH1_CRYNE RecName: Full=Acyl-protein thioesterase 1;       
   11::211     3e-11  33%  245 aa  APTH1_NEUCR RecName: Full=Acyl-protein thioesterase 1;       
    9::152     5e-11  31%  227 aa  APTH1_YARLI RecName: Full=Acyl-protein thioesterase 1;       
    5::223     3e-10  33%  230 aa  APTH1_CANGA RecName: Full=Acyl-protein thioesterase 1;       
   17::230     2e-09  30%  235 aa  APTH1_GIBZE RecName: Full=Acyl-protein thioesterase 1;       
    4::226     3e-09  31%  227 aa  APTH1_YEAST RecName: Full=Acyl-protein thioesterase 1;       
   20::208     4e-09  33%  231 aa  APTH1_CANAL RecName: Full=Acyl-protein thioesterase 1;       
   18::223     6e-09  30%  226 aa  APT11_DICDI RecName: Full=Acyl-protein thioesterase 1 homolog 1;   
   24::158     3e-08  30%  231 aa  LYPA2_RAT RecName: Full=Acyl-protein thioesterase 2;       
   24::158     3e-08  30%  231 aa  LYPA2_MOUSE RecName: Full=Acyl-protein thioesterase 2;       
    7::208     3e-08  30%  239 aa  APTH1_EMENI RecName: Full=Acyl-protein thioesterase 1;       
   24::158     7e-08  30%  231 aa  LYPA2_HUMAN RecName: Full=Acyl-protein thioesterase 2;       
    1::154     9e-08  28%  230 aa  LYPA1_PONAB RecName: Full=Acyl-protein thioesterase 1;       
    1::154     9e-08  28%  230 aa  LYPA1_HUMAN RecName: Full=Acyl-protein thioesterase 1;       
   25::154     1e-07  32%  230 aa  LYPA1_RAT RecName: Full=Acyl-protein thioesterase 1;       
    6::145     1e-07  31%  228 aa  APTH1_KLULA RecName: Full=Acyl-protein thioesterase 1;       
   25::154     3e-07  29%  230 aa  LYPA1_RABIT RecName: Full=Acyl-protein thioesterase 1;       
   25::154     3e-07  29%  230 aa  LYPA1_MOUSE RecName: Full=Acyl-protein thioesterase 1;       
    6::195     4e-07  30%  218 aa  EST1_PSEFL RecName: Full=Carboxylesterase 1;       
    1::154     1e-06  29%  230 aa  LYPA1_BOVIN RecName: Full=Acyl-protein thioesterase 1;       
    6::216     2e-06  29%  218 aa  EST2_PSEFL RecName: Full=Carboxylesterase 2;       
   18::234     2e-06  36%  240 aa  APTH1_USTMA RecName: Full=Acyl-protein thioesterase 1;       
    8::226     9e-06  32%  241 aa  APTH1_ASPFU RecName: Full=Acyl-protein thioesterase 1;       
    7::125     1e-05  30%  222 aa  APT12_DICDI RecName: Full=Acyl-protein thioesterase 1 homolog 2;   
   21::155     4e-05  33%  235 aa  APTH1_ASHGO RecName: Full=Acyl-protein thioesterase 1;       
  621::679     2e-04  36%  726 aa  DPP5_TRISH RecName: Full=Dipeptidyl-peptidase 5;       
   14::132     3e-04  28%  239 aa  LYPL1_MOUSE RecName: Full=Lysophospholipase-like protein 1;        
  621::679     5e-04  36%  726 aa  DPP5_TRITO RecName: Full=Dipeptidyl-peptidase 5;       
  621::679     5e-04  36%  726 aa  DPP5_TRIEQ RecName: Full=Dipeptidyl-peptidase 5;       
  621::679     5e-04  36%  726 aa  DPP5_ARTBE RecName: Full=Dipeptidyl-peptidase 5;       
  576::631     8e-04  32%  657 aa  YUXL_BACSU RecName: Full=Uncharacterized peptidase yuxL;       
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
APTH1_SCHPO     ----------------IINPSVAHTATVIFLHGLGDSGQGWS---FMANTW------SNFKHIKWIFPNA
APTH1_DEBHA     --------SQLIPAVRVAATAKPAKSAIIFVHGLGDSGSGWSWFPQLAKQS---NIIKNCDSINYVFP--
APTH1_CRYNE     -----------------ISPKEAHTATVIFLHGLGDSGHGW--------LPVAKMLWSSFPNVKWILPHA
APTH1_NEUCR     ----------------LVPAVARHTATVIFIHGLGDTGHGWASAVEQWRRRQRLD------EVKFILPHA
APTH1_YARLI     -----------------IPAKAAHTATVIFLHGLGDSGAGWM--FLAEEARKAQRLNHV----KFIFPEA
APTH1_CANGA     --------------VRIASTKKPAKYALIFLHGLGDTGQGW-----SFLAQYLQQYHPCFESTNFIFPNA
APTH1_GIBZE     -----------------------HTATVIFVHGLGDTGHGWASAVENWRRRQKMDEVKFILPHAPQIPIS
APTH1_YEAST     --------------LRVAAKIQPARQTIIFLHGLGDTGSGWG---FLAQYLQQRD-PAAFQHTNFVFPNA
APTH1_CANAL     ----------------------------IFLHGLGDSGDGWSPQLVSQSKLINDPINYVFPN----APKI
APT11_DICDI     -----------------------HSATVIFSHGLGDSGAGWIEVMEEIQSRNNGHIRFICPN----APIQ
LYPA2_RAT       ------------------------TAAVIFLHGLGDTGHSWADALSTIR----------LPHVKYICPHA
LYPA2_MOUSE     ------------------------TAAVIFLHGLGDTGHSWADALSTIR----------LPHVKYICPHA
APTH1_EMENI     ----------------IVPALKKHTATVIMAHGLGDSGAGWVSLAHNWRRRG------LFEEVTFIFPNA
LYPA2_HUMAN     ------------------------TAAVIFLHGLGDTGHSWADALSTIR----------LPHVKYICPHA
LYPA1_PONAB     ----MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSS----------HIKYICPHA
LYPA1_HUMAN     ----MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSS----------HIKYICPHA
LYPA1_RAT       ----------------------------IFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAP----VMPVT
APTH1_KLULA     --------------VRVASKAQPAKNVILVFHGLGDSGSGW-----SFLAEYLQRSPA-FAHTRFVFPNA
LYPA1_RABIT     ----------------------------IFLHGLGDTGHGWAEAFAGIKS----------PHIKYICPHA
LYPA1_MOUSE     ----------------------------IFLHGLGDTGHGWAEAFAGIKS----------PHIKYICPHA
EST1_PSEFL      ----------------ILQPAKPADACVIWLHGLGADRYDFLPV--------AEALQETLLSTRFVLPQA
LYPA1_BOVIN     ----MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSAHIKYICPHAP----VMPVT
EST2_PSEFL      ----------------ILQPAKPADACVIWLHGLGADRYDFMPV--------AEALQESLLTTRFVLPQA
APTH1_USTMA     ------------------------TATLFFLHGLGDSSAGWSDQMLSQR-------PSL-SHVRFVLPNA
APTH1_ASPFU     ---------------YIVPALKKHTATVIMAHGLG-------------------DRMSLAQNWRFIFPNA
APT12_DICDI     -----------------IKSKSTHTATVIFLHGLMDTGKGWETRMENIISMGGLD------HIKFVLPTA
APTH1_ASHGO     ----------------------------IIFHGLGDSGAGWT---FLAEYL--QRDPAL-ASAQFVFPTA
DPP5_TRISH      ----------------------------------------------------------------------
LYPL1_MOUSE     ----------------VVSPTGRHSASLIFLHGSGHSGQGQREWI---KHVLNQDL--TFQHIKIIYPTA
DPP5_TRITO      ----------------------------------------------------------------------
DPP5_TRIEQ      ----------------------------------------------------------------------
DPP5_ARTBE      ----------------------------------------------------------------------
YUXL_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
APTH1_SCHPO     PSPVTVNNGMKMPAWYDIYSFADMKREDE---NGILRSAGQLHELIDAEL-ALGIPSDRILIGGFSQGCM
APTH1_DEBHA     ----NAPLMPITAGWFDIYEFGNPEAKQD--IDGFHKSCETLKSLIKEQIDNHDIPADKIIIGGFSQGAA
APTH1_CRYNE     PT--IPVSLNHGMAWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVD-SGIPENRIVLGGFSQGGA
APTH1_NEUCR     PSPITANWGMKMPGWYDIFAIAEALRRNEDEA-GILTSQAYFHDLIQKEIDS-GIPADRIVIGGFSQGGA
APTH1_YARLI     PQQVSLNFGMRMPSWYDIKELANVNAAQDQ--EGILESVGRLESLIKEETD-AGVPANRIVIGGFSQGCA
APTH1_CANGA     PIKVTANGGMPMPSWFDIKVWDWTTSNVDTVQQSLKEVQKYVDSSISDGIE-----PQNIIVGGFSQGAA
APTH1_GIBZE     -----VNMGMRMPGWFDIKQLGDSLIRNE-DTEGIKLSQKYFHNLIQQEIDS-GIVPERIVLGGFSQGGA
APTH1_YEAST     PEHVTANGGALMPAWFDILEWDPSFSKVDSD--GFMNSLNSIEKTVKQEIDK-GIKPEQIIIGGFSQGAA
APTH1_CANAL     PVTINNGFA--MPAWFDIYELGNPHAKQD--VTGFFKSCEVLKEFILEQHNKFNIPLEKIIIGGFSQGAA
APT11_DICDI     AVTLNGGFK--MPSWYDIKSLSSRGDEDPAQVD---ESKNIIETIIKHEMEEEKIPAERIIIGGFSQGAA
LYPA2_RAT       PRIPVTLNMKMMPSWFDLMGLSPDAPEDEA---GIKKAAENIKALIEHEMKN-GIPANRIVLGGFSQGGA
LYPA2_MOUSE     PRIPVTLNMKMMPSWFDLMGLSPDAPEDEA---GIKKAAENIKALIEHEMKN-GIPANRIVLGGFSQGGA
APTH1_EMENI     PMPITVNFGMSMPGWYDITKLGDLDFQEAVKNQGILKSRDYFNSLIKEQMD-QGIKPSRIVLGGFSQG--
LYPA2_HUMAN     PRIPVTLNMKMMPSWFDLMGLSPDAPEDEA---GIKKAAENIKALIEHEMKN-GIPANRIVLGGFSQGGA
LYPA1_PONAB     PVRPVTLNMNMMPSWFDIIGLSPDSQEDE---SGIKQAAENIKALIDQEVKN-GIPSNRIILGGFSQGGA
LYPA1_HUMAN     PVRPVTLNMNAMPSWFDIIGLSPDSQEDE---SGIKQAAENIKALIDQEVKN-GIPSNRIILGGFSQGGA
LYPA1_RAT       ---LNMSMM--MPSWFDIIGLSPDSQEDE---SGIKQAAETVKALIDQEVKN-GIPSNRIILGGFSQGGA
APTH1_KLULA     PNRIDANGGMSMPAWFNIYDWANPDARVD--VEGIKSSLKVINSFIQEQIDD-GISPENIILGGFSQGAA
LYPA1_RABIT     PVMPVTLNMNMMPSWFDIVGLSPDSQEDE---SGIKQAAETVKALIDQEVKN-GIPSNRIILGGFSQGGA
LYPA1_MOUSE     PVMPVTLNMNMMPSWFDIVGLSPDSQEDE---SGIKQAAETVKALIDQEVKN-GIPSNRIILGGFSQGGA
EST1_PSEFL      PTRINGGY--EMPSWYDIKAMSPA---RSISLEELETSAKTVTDLIETQ-QRTGIDTSRIFLAGFSQGGA
LYPA1_BOVIN     LNMNMA-----MPSWFDIIGLSPDSLEDET---GIKQAAENVKALIDQEVKN-GIPSNRIILGGFSQGGA
EST2_PSEFL      PTRINGGY--EMPSWYDIKAMSPA---RSISLEELEVSAKMVTDLIEAQ-KRTGIDASRIFLAGFSQGGA
APTH1_USTMA     PIQPVTLNMGMMPSWFDILALDDLSGAEDEA--GLLKSTDEIKKLIKAENDLDGHKSERIVVGGFSQGGA
APTH1_ASPFU     PMPITVNFGMTMPGWHDLTKLGSAIRHQDEP--GVLRSRDYFNTLIKEQIDK-GIKPSRIVLGGFSQGAA
APT12_DICDI     PTPISINFGNKGTAWCNVTAFYPGSEE---DLIGLEKSMKLVEALIEEEIK-NGIPAERIILSGFSQGGA
APTH1_ASHGO     PVRITANNFAPATAWLDVRSWLS---HESVDLEGFNESMKLVPKLIEEQVAQ-GIPYERIWIGGFSQGAA
DPP5_TRISH      ----------------------------------------------------------------------
LYPL1_MOUSE     PSRYTPLKGGLSNVWFDRFKISMDCPE---HLESIDSMCQVLSGLIDEEVK-TGIQKSRILIGGFSMGGC
DPP5_TRITO      ----------------------------------------------------------------------
DPP5_TRIEQ      ----------------------------------------------------------------------
DPP5_ARTBE      ----------------------------------------------------------------------
YUXL_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
APTH1_SCHPO     VSLYAGLTYP----KRLAGIMGHSGFLPLASKFPSAL----SRVAKEI----------------------
APTH1_DEBHA     VSLATVAL----LDFKVGGVVALSGFSPIKESLPQIMN--------------------------------
APTH1_CRYNE     ISVLNMLTT----KRKLAGVVALSTWVPLNHKIVQMM----SEHAKDI----------------------
APTH1_NEUCR     MGLFSGLTAKCKLAGIIAXXXXXXXXXKFAELVP------------------------------------
APTH1_YARLI     VSLATGCLT----QTKLGGIVGLSGYVPIKDYI-------------------------------------
APTH1_CANGA     LA----LASAVTLNNKIGAFIGLSGF---------------AYLRNELQETRKNLNP-------------
APTH1_GIBZE     MSLLALTC-----------------------------------------TSKXXXXXXXXXXXXXXKTFA
APTH1_YEAST     LALATSVTLPWKI-GGIVALSGFCS------------------------------IPGIL----------
APTH1_CANAL     ISLATLAL----LDTKIGGCVALSGFCPVRNEI-------TDRYNKNPGVN-----------------FD
APT11_DICDI     LSLYTFY---SQTETKLGGCIALSGYLPLA-----------TKFVA-----------------------N
LYPA2_RAT       LSLYTALTCPHPLAG----IVALSCWLPLHRNFPQA----------------------------------
LYPA2_MOUSE     LSLYTALTCPHPLAG----IVALSCWLPLHRNFPQA----------------------------------
APTH1_EMENI     --------------GAMSLFSGITG---------------QEKLGGVFGLS-CYMLLSDRIKNYIPENFP
LYPA2_HUMAN     LSLYTALTCPHPLAG----IVALSCWLPLHRAFPQA----------------------------------
LYPA1_PONAB     LSLYTALTT----QQKLAGVTALSCWLPLRASFPQ-----------------------------------
LYPA1_HUMAN     LSLYTALTT----QQKLAGVTALSCWLPLRASFPQ-----------------------------------
LYPA1_RAT       LSLYTALTT----QQKLAGVTALSCWLPLRASFSQ-----------------------------------
APTH1_KLULA     LTLASTVTSP----YKLGGFFALSGF--------------------------------------------
LYPA1_RABIT     LSLYTALTT----QQKLAGVTALSCWLPLRASFSQ-----------------------------------
LYPA1_MOUSE     LSLYTALTT----QQKLAGVTALSCWLPLRASFSQ-----------------------------------
EST1_PSEFL      VVFHTAF----------------------------------KKWEGPLGGVIAL--------STYAPTFD
LYPA1_BOVIN     LSLYTALTT----QQKLAGVTALSCWLPLRASFPQ-----------------------------------
EST2_PSEFL      VVFHTAFINQGPLGGVIAL-------------------------------------------STYAPTFG
APTH1_USTMA     ISLLTGLTNPTPVAG----VAALSTWLPL-----------RAKIATRTPTSKTL----------------
APTH1_ASPFU     ISVFTITC-----KEKLGGVFGLSSYLVLSDKLKNYIP-------------------------------E
APT12_DICDI     LTLYT-----------------------------------------------------------------
APTH1_ASHGO     LTMGTALSFP----HRLGGFLSFSGWLEHTV---------------------------------------
DPP5_TRISH      ----------------------------------------------------------------------
LYPL1_MOUSE     MAM-------------------------------------------------------------------
DPP5_TRITO      ----------------------------------------------------------------------
DPP5_TRIEQ      ----------------------------------------------------------------------
DPP5_ARTBE      ----------------------------------------------------------------------
YUXL_BACSU      --------------------------------------------------------------------WD


                         .         .         .         +         .         .         .:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
APTH1_SCHPO     ----------------------------------------------------------------------
APTH1_DEBHA     ------KANLETPIFQGHGTADPIVNFDFGKQTSELYQKLGFNVKFHTYPG-------------------
APTH1_CRYNE     ------------PVFWGHGTNDPVVDYRFGQRSVDFL---------------------------------
APTH1_NEUCR     -KPEFNK---ETPIFMAHGDADPVVNYKLGTMTRDLLKEMGYNVKFTTYPG-------------------
APTH1_YARLI     ----------------------------------------------------------------------
APTH1_CANGA     ----------NTPVFHGHGESDDVVPFPIGVQTAEFFKSAG-ELENYTFKSYRGLGH-SADPAELNDLAE
APTH1_GIBZE     DMVKPTDANRQTPVMMFHGEEDPIVPCERGKLSAELLKGLGYDVAWKTYPGM---GH-SAVPEELDEVEA
APTH1_YEAST     -KQHKNGINVKTPIFHGHGDMDPVVPIGLGIKAKQFYQD-SCEIQNYEFKVYKGMAH-STVPDELEDLAS
APTH1_CANAL     -----------TPIFQGHGTVDPVINYDYGKQTSELYKQLGFNLKFNTYEG-------------------
APT11_DICDI     SLNKE------QPLLMIHGDCDQVVRHQWGKLSFDHLKSQGINGEFITLKGL---GHH-SSPEEIDLMTK
LYPA2_RAT       ----------------------------------------------------------------------
LYPA2_MOUSE     ----------------------------------------------------------------------
APTH1_EMENI     NK--------KTPFFLAHGTEDDIVPHEFGKRSAEMAKELGLDVTFNSY---------------------
LYPA2_HUMAN     ----------------------------------------------------------------------
LYPA1_PONAB     ----------------------------------------------------------------------
LYPA1_HUMAN     ----------------------------------------------------------------------
LYPA1_RAT       ----------------------------------------------------------------------
APTH1_KLULA     ----------------------------------------------------------------------
LYPA1_RABIT     ----------------------------------------------------------------------
LYPA1_MOUSE     ----------------------------------------------------------------------
EST1_PSEFL      NDLQLSASQQRIPTLCLHGQYDEVVQNAMGRSAYEHLKGRGVTVTWQEY---------------------
LYPA1_BOVIN     ----------------------------------------------------------------------
EST2_PSEFL      DELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYP----MGHEVL-PQEIHDIGA
APTH1_USTMA     ------------KVFQAHGDADPVVKYEYGQRTVDFLKELALDVEFHTYPRMPHSAC----PEEIRDLAA
APTH1_ASPFU     NWPNK-----KTPFFLAHGLEDEIVLFDFGDLSAKKMKEIGLDVTFKSY---PNLGH-SADPVEIEDLAR
APT12_DICDI     ----------------------------------------------------------------------
APTH1_ASHGO     ----------------------------------------------------------------------
DPP5_TRISH      SKPELV-AKWSTPQLVIHNDSDFRLSVAEGVGLFNVLQEKGIPSRFLNF---PDETHWVTKPE-------
LYPL1_MOUSE     ----------------------------------------------------------------------
DPP5_TRITO      SKPELV-AKWSTPQLVIHNDFDFRLSVAEGVGLFNVLQEKGIPSRFLNF---PDETHWVTKPE-------
DPP5_TRIEQ      SKPELV-AKWSTPQLVIHNDFDFRLSVAEGVGLFNVLQEKGIPSRFLNF---PDETHWVTKPE-------
DPP5_ARTBE      SKPELV-AKWSTPQLVIHNDFDFRLSVAEGVGLFNVLQEKGIPSRFLNF---PDETHWVTKPE-------
YUXL_BACSU      RSPLKYAANVETPLLILHGERDDRCPIEQAEQLFIALKKMGKETKLVRFPNASH----------------


                         .         *         .         .         .         .         +:350
query           FLESKTS
APTH1_SCHPO     -------
APTH1_DEBHA     -------
APTH1_CRYNE     -------
APTH1_NEUCR     -------
APTH1_YARLI     -------
APTH1_CANGA     FLKS---
APTH1_GIBZE     FLRKQ--
APTH1_YEAST     FIKKSLS
APTH1_CANAL     -------
APT11_DICDI     FI-SKT-
LYPA2_RAT       -------
LYPA2_MOUSE     -------
APTH1_EMENI     -------
LYPA2_HUMAN     -------
LYPA1_PONAB     -------
LYPA1_HUMAN     -------
LYPA1_RAT       -------
APTH1_KLULA     -------
LYPA1_RABIT     -------
LYPA1_MOUSE     -------
EST1_PSEFL      -------
LYPA1_BOVIN     -------
EST2_PSEFL      WLAAR--
APTH1_USTMA     FLE----
APTH1_ASPFU     FLQ----
APT12_DICDI     -------
APTH1_ASHGO     -------
DPP5_TRISH      -------
LYPL1_MOUSE     -------
DPP5_TRITO      -------
DPP5_TRIEQ      -------
DPP5_ARTBE      -------
YUXL_BACSU      -------