[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cimm2:CIRT_02580

[Show Plain Result]


## Summary of Sequence Search
    1::175
  459::581     3e-04  28%  973 aa  ATG1_ASPFU RecName: Full=Serine/threonine-protein kinase atg1;     
  458::564     5e-04  26%  950 aa  ATG1_NEOFI RecName: Full=Serine/threonine-protein kinase atg1;     
    1::175

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxERQDKGDRELIQQLNCYERRLRAWRLENQQQQQDIRAYFLILQGAELIQISSERVGISITL
ATG1_ASPFU      ---------ERQ-KGRNTFSEGSPQIDRQADKLREERERAAQDVRDYVVVEKRAVEVNAFADELAHSPRI
ATG1_NEOFI      --------------------------DRQADKLREERERAAQDVRDYVVVEKRAVEVNAFADELAHSPRI


                         .         .         *         .         .         .         .:140
query           SGTVSMEYASALSSFSQKFVIEKPGVSPSTTQNTLRCELQTRSGYHRKDSVHGHNVSIERKxxxxxxxxx
ATG1_ASPFU      QGNISR--GAQTGALSRRSTVHGPTPSPSPPQATVGKAMQVLSGRSRADSMHNRQGSYERR---------
ATG1_NEOFI      QGGISR--GAQTGALSRRSTVHGPTLNPSPPQATVGKAMQVLSGRSRADSMHNRQSSYERR---------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ATG1_ASPFU      -----------------------------------
ATG1_NEOFI      -----------------------------------